254780936

254780936

hypothetical protein CLIBASIA_04175

GeneID in NCBI database:8209958Locus tag:CLIBASIA_04175
Protein GI in NCBI database:254780936Protein Accession:YP_003065349.1
Gene range:-(927212, 927760)Protein Length:182aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:hypothetical protein
SEED prediction:Mll7752 protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MFDPREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAYLKNEIARDPDEDKK
cccccccEEEEEEHHHHHHHHHHccccccHHHHHHHHHHccEEEEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEEEEccccccccccccccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHcccEEEEEEEEEccccccHHHHHHHcccEEEHHHHHHHHccccccccc
cccccccEEEEEcHHHHHHHHHHccccccHHHHHHHHHccccEEEEEEEEEEccccHcccccHHHHHHHHHHcccEEEEEEEEEEccccccEEEEccccHHEEHHHHHHcccccEEEEEEccccHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHcccccHHHHHHHHccccccccc
MFDPREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYttvvgdpeqqfsplhplldwlhynGFQVVAKVAKEFTencgrkrvksSMDVELAVDAFeqseglehlvifsgDGCFTTLVAALQRKVKKVTIVSTvlsdpsmasdQLRRQADYFMDLAYLKNeiardpdedkk
MFDPREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVAKVAKEFTencgrkrvkssMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVAALQRKVKKVTIVstvlsdpsmasdqLRRQADYFMDLAYLKneiardpdedkk
MFDPREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAYLKNEIARDPDEDKK
****REK*ALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAY**************
MFDPREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAYLKNEIA********
***PREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAYLKNEIA********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDPREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAYLKNEIARDPDEDKK
MFDPREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAYLKNEIARDPDEDKK
MFDPREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAYLKNEIARDPDEDKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target182 hypothetical protein CLIBASIA_04175 [Candidatus Liberib
315122349205 hypothetical protein CKC_03005 [Candidatus Liberibacter 1 2e-85
15964816192 hypothetical protein SMc02407 [Sinorhizobium meliloti 1 1 2e-66
51102762191 RtsE [Sinorhizobium meliloti] Length = 191 1 2e-66
227821396192 hypothetical protein NGR_c08220 [Sinorhizobium fredii N 1 3e-66
222148076192 hypothetical protein Avi_1440 [Agrobacterium vitis S4] 1 3e-66
150395899193 hypothetical protein Smed_0675 [Sinorhizobium medicae W 1 3e-66
159184584189 hypothetical protein Atu1028 [Agrobacterium tumefaciens 1 7e-66
325292407189 hypothetical protein AGROH133_05017 [Agrobacterium sp. 1 1e-65
227819053194 hypothetical protein NGR_b08150 [Sinorhizobium fredii N 1 2e-65
222085384194 hypothetical protein Arad_1584 [Agrobacterium radiobact 1 2e-65
>gi|315122349|ref|YP_004062838.1| hypothetical protein CKC_03005 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 205 Back     alignment and organism information
 Score =  318 bits (816), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 150/179 (83%), Positives = 169/179 (94%)

Query: 1   MFDPREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQF 60
           MFDPREKIALFIDGANLYA+SKALGFDIDYRKLLKAF++RA V+RAYYYTTV+GD +QQ+
Sbjct: 1   MFDPREKIALFIDGANLYAASKALGFDIDYRKLLKAFKARARVLRAYYYTTVLGDSDQQY 60

Query: 61  SPLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFS 120
           SPLHPLLDWLHYNGF+VV+KVAKEFTE+CGRK++K+SMDVELAVDAFEQSEG++HLVIFS
Sbjct: 61  SPLHPLLDWLHYNGFKVVSKVAKEFTESCGRKKIKASMDVELAVDAFEQSEGIDHLVIFS 120

Query: 121 GDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAYLKNEIARDPDE 179
           GDG F TLV ALQRK KKVTIVSTVLS+PSM SDQLRRQAD+F+DLAYLKNEI R+  E
Sbjct: 121 GDGDFATLVEALQRKSKKVTIVSTVLSNPSMVSDQLRRQADHFIDLAYLKNEIQRESCE 179


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15964816|ref|NP_385169.1| hypothetical protein SMc02407 [Sinorhizobium meliloti 1021] Length = 192 Back     alignment and organism information
>gi|51102762|gb|AAT95984.1| RtsE [Sinorhizobium meliloti] Length = 191 Back     alignment and organism information
>gi|227821396|ref|YP_002825366.1| hypothetical protein NGR_c08220 [Sinorhizobium fredii NGR234] Length = 192 Back     alignment and organism information
>gi|222148076|ref|YP_002549033.1| hypothetical protein Avi_1440 [Agrobacterium vitis S4] Length = 192 Back     alignment and organism information
>gi|150395899|ref|YP_001326366.1| hypothetical protein Smed_0675 [Sinorhizobium medicae WSM419] Length = 193 Back     alignment and organism information
>gi|159184584|ref|NP_354050.2| hypothetical protein Atu1028 [Agrobacterium tumefaciens str. C58] Length = 189 Back     alignment and organism information
>gi|325292407|ref|YP_004278271.1| hypothetical protein AGROH133_05017 [Agrobacterium sp. H13-3] Length = 189 Back     alignment and organism information
>gi|227819053|ref|YP_002823024.1| hypothetical protein NGR_b08150 [Sinorhizobium fredii NGR234] Length = 194 Back     alignment and organism information
>gi|222085384|ref|YP_002543914.1| hypothetical protein Arad_1584 [Agrobacterium radiobacter K84] Length = 194 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target182 hypothetical protein CLIBASIA_04175 [Candidatus Liberib
pfam01936140 pfam01936, DUF88, Protein of unknown function DUF88 7e-24
cd06167149 cd06167, LabA_like, LabA_like proteins 5e-22
COG1432181 COG1432, COG1432, Uncharacterized conserved protein [Fu 1e-29
>gnl|CDD|145225 pfam01936, DUF88, Protein of unknown function DUF88 Back     alignment and domain information
>gnl|CDD|100118 cd06167, LabA_like, LabA_like proteins Back     alignment and domain information
>gnl|CDD|31621 COG1432, COG1432, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 182 hypothetical protein CLIBASIA_04175 [Candidatus Liberib
cd06167149 LabA_like LabA_like proteins. A well conserved group of 99.97
COG1432181 Uncharacterized conserved protein [Function unknown] 99.95
pfam01936140 DUF88 Protein of unknown function DUF88. This highly co 99.94
TIGR00288161 TIGR00288 conserved hypothetical protein TIGR00288; Int 98.94
pfam04396149 consensus 98.59
TIGR00593 1005 pola DNA polymerase I; InterPro: IPR002298 DNA carries 93.9
PRK09482256 xni exonuclease IX; Provisional 91.24
PRK05929 870 consensus 91.09
PRK08928 861 consensus 90.63
smart00475259 53EXOc 5'-3' exonuclease. 95.54
cd00008240 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonuclease dom 94.69
pfam02739169 5_3_exonuc_N 5'-3' exonuclease, N-terminal resolvase-li 94.45
COG0603222 Predicted PP-loop superfamily ATPase [General function 93.07
PRK07456 975 consensus 90.33
>cd06167 LabA_like LabA_like proteins Back     alignment and domain information
>COG1432 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam01936 DUF88 Protein of unknown function DUF88 Back     alignment and domain information
>TIGR00288 TIGR00288 conserved hypothetical protein TIGR00288; InterPro: IPR002790 This entry describes archaebacterial proteins of unknown function Back     alignment and domain information
>pfam04396 consensus Back     alignment and domain information
>TIGR00593 pola DNA polymerase I; InterPro: IPR002298 DNA carries the biological information that instructs cells how to exist in an ordered fashion Back     alignment and domain information
>PRK09482 xni exonuclease IX; Provisional Back     alignment and domain information
>PRK05929 consensus Back     alignment and domain information
>PRK08928 consensus Back     alignment and domain information
>smart00475 53EXOc 5'-3' exonuclease Back     alignment and domain information
>cd00008 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonuclease domains may co-occur with DNA polymerase I (Pol I) domains, or be part of Pol I containing complexes Back     alignment and domain information
>pfam02739 5_3_exonuc_N 5'-3' exonuclease, N-terminal resolvase-like domain Back     alignment and domain information
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>PRK07456 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target182 hypothetical protein CLIBASIA_04175 [Candidatus Liberib
2qip_A165 Crystal Structure Of A Protein Of Unknown Function 3e-27
>gi|157835942|pdb|2QIP|A Chain A, Crystal Structure Of A Protein Of Unknown Function Vpa0982 From Vibrio Parahaemolyticus Rimd 2210633 Length = 165 Back     alignment and structure
 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 46/168 (27%), Positives = 72/168 (42%), Gaps = 15/168 (8%)

Query: 3   DPREKIALFIDGANLYASSK-ALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFS 61
           D +EKIA+ +D  N+Y + + A   + DY +          V+ A  Y     DP     
Sbjct: 7   DHKEKIAILVDVQNVYYTCREAYRSNFDYNQFWYVATQEKEVVSAKAYAIASNDP----- 61

Query: 62  PLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSG 121
                   L   GF+V  K   +  +       K   DV + +DA E +  ++ +++ SG
Sbjct: 62  KQRQFHHILRGVGFEVXLKPYIQRRDGSA----KGDWDVGITLDAIEIAPDVDRVILVSG 117

Query: 122 DGCFTTLVAAL-QRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAY 168
           DG F+ LV  + QR  KKVT+       P + S  L   AD F+ +  
Sbjct: 118 DGDFSLLVERIQQRYNKKVTV----YGVPRLTSQTLIDCADNFVAIDD 161


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target182 hypothetical protein CLIBASIA_04175 [Candidatus Liberib
2qip_A165 Protein of unknown function VPA0982; APC85975, structur 1e-29
>2qip_A Protein of unknown function VPA0982; APC85975, structural genomics, PSI-2, protein structure initiative; 1.48A {Vibrio parahaemolyticus rimd 2210633} Length = 165 Back     alignment and structure
 Score =  124 bits (311), Expect = 1e-29
 Identities = 44/165 (26%), Positives = 75/165 (45%), Gaps = 13/165 (7%)

Query: 3   DPREKIALFIDGANLYASSK-ALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFS 61
           D +EKIA+ +D  N+Y + + A   + DY +          V+ A  Y     DP+Q+  
Sbjct: 7   DHKEKIAILVDVQNVYYTCREAYRSNFDYNQFWYVATQEKEVVSAKAYAIASNDPKQR-- 64

Query: 62  PLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSG 121
                   L   GF+V+ K   +  +   +       DV + +DA E +  ++ +++ SG
Sbjct: 65  ---QFHHILRGVGFEVMLKPYIQRRDGSAKG----DWDVGITLDAIEIAPDVDRVILVSG 117

Query: 122 DGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDL 166
           DG F+ LV  +Q++  K   V  V   P + S  L   AD F+ +
Sbjct: 118 DGDFSLLVERIQQRYNKKVTVYGV---PRLTSQTLIDCADNFVAI 159


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target182 hypothetical protein CLIBASIA_04175 [Candidatus Liberib
2qip_A165 Protein of unknown function VPA0982; APC85975, structur 100.0
1exn_A290 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enteroba 93.9
>2qip_A Protein of unknown function VPA0982; APC85975, structural genomics, PSI-2, protein structure initiative; 1.48A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
Probab=100.00  E-value=8.4e-33  Score=224.25  Aligned_cols=153  Identities=29%  Similarity=0.456  Sum_probs=134.1

Q ss_pred             CCCCEEEEEEEHHHHHHHHHH-CCCCCCHHHHHHHHHHCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             788718999807899999985-0876798999999851792999999730688731467775799988975595697534
Q gi|254780936|r    3 DPREKIALFIDGANLYASSKA-LGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVAKV   81 (182)
Q Consensus         3 ~~~~rvaIfID~~Nl~~~~~~-~~~~~d~~~L~~~l~~~~~l~~~~~y~~~~~~~~~~~~~~~~~~~~l~~~g~~v~~~~   81 (182)
                      ++++||||||||+|+|++++. .++++||.+|++++.+.+++.++++|.+++.+...     ..+.+.+...|++++.++
T Consensus         7 ~~~~rvaIfID~~Nl~~~~k~~~~~~~d~~~l~~~~~~~~~v~~~~~y~~~~~~~~~-----~~~~~~~~~~~~~~~~~~   81 (165)
T 2qip_A            7 DHKEKIAILVDVQNVYYTCREAYRSNFDYNQFWYVATQEKEVVSAKAYAIASNDPKQ-----RQFHHILRGVGFEVMLKP   81 (165)
T ss_dssp             CCCEEEEEEEEHHHHHHHHHHHHSSCBCHHHHHHHHTTTEEEEEEEEEECCCCCHHH-----HHHHHHHHHHTCEEEECC
T ss_pred             CCCCEEEEEEEHHHHHHHHHHHCCCCCCHHHHHHHHHCCCEEEEEEEEECCCCCHHH-----HHHHHHHHHCCCEEEEEC
T ss_conf             887709999956768999987437776799999999638908999998236771655-----445789997693688634


Q ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHH-CCCEEEEEEEECCCCCCCHHHHHHHC
Q ss_conf             58953788865435653299999999942115889998386658999999998-49889999831577654708999852
Q gi|254780936|r   82 AKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVAALQR-KVKKVTIVSTVLSDPSMASDQLRRQA  160 (182)
Q Consensus        82 ~~~~~~~~~~~~~kk~~Dv~laiD~~~~a~~~d~~iLvSGD~Df~pli~~lr~-~Gk~V~v~~~~~~~~~~~S~~L~~~a  160 (182)
                      ...+.++    ..++++|+.|++|+|.+++++|++|||||||||+|++++||+ .|++|+++++    ++.+|.+|+++|
T Consensus        82 ~~~~~~~----~~~~~~Dv~l~id~~~~~~~~d~~vLvSgDsDf~p~v~~lr~~~gk~V~v~~~----~~~~s~~L~~~a  153 (165)
T 2qip_A           82 YIQRRDG----SAKGDWDVGITLDAIEIAPDVDRVILVSGDGDFSLLVERIQQRYNKKVTVYGV----PRLTSQTLIDCA  153 (165)
T ss_dssp             CCCCSSC----CCSCCCHHHHHHHHHHHGGGCSEEEEECCCGGGHHHHHHHHHHHCCEEEEEEC----GGGSCHHHHHHS
T ss_pred             CEECCCC----CCCCCCHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEC----CCCCCHHHHHHC
T ss_conf             4651678----78861179999999962776898999957762899999999858978999978----998839999869


Q ss_pred             CCCEEHHH
Q ss_conf             11151899
Q gi|254780936|r  161 DYFMDLAY  168 (182)
Q Consensus       161 d~fi~l~~  168 (182)
                      |+|++|++
T Consensus       154 d~fi~id~  161 (165)
T 2qip_A          154 DNFVAIDD  161 (165)
T ss_dssp             SEEEECSG
T ss_pred             CEEEECCC
T ss_conf             98899173



>1exn_A 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enterobacteria phage T5} SCOP: a.60.7.1 c.120.1.2 PDB: 1ut5_A 1ut8_A 1xo1_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target182 hypothetical protein CLIBASIA_04175 [Candidatus Liberib
d1xo1a2167 T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} 96.22
d1cmwa2164 5' to 3' exonuclease domain of DNA polymerase Taq {Ther 96.12
d1tfra2169 T4 RNase H {Bacteriophage T4 [TaxId: 10665]} 95.75
>d1xo1a2 c.120.1.2 (A:19-185) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PIN domain-like
superfamily: PIN domain-like
family: 5' to 3' exonuclease catalytic domain
domain: T5 5'-exonuclease
species: Bacteriophage T5 [TaxId: 10726]
Probab=96.22  E-value=0.019  Score=32.95  Aligned_cols=42  Identities=26%  Similarity=0.200  Sum_probs=28.0

Q ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             653299999999942115889998386658999999998498899998
Q gi|254780936|r   96 SSMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVAALQRKVKKVTIVS  143 (182)
Q Consensus        96 k~~Dv~laiD~~~~a~~~d~~iLvSGD~Df~pli~~lr~~Gk~V~v~~  143 (182)
                      -.+|=-|+.=+-.....-+.++|+|||.||..|+.      .+|.++.
T Consensus       109 ~EADDiIa~l~~~~~~~~~~v~IvS~DkD~~QLv~------~~v~~~~  150 (167)
T d1xo1a2         109 VEADDMAAYIVKLIGHLYDHVWLISTDGDWDTLLT------DKVSRFS  150 (167)
T ss_dssp             BCHHHHHHHHHHHHGGGSSCEEEECSCGGGGGGCB------TTEEEEC
T ss_pred             CCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHEE------CCEEEEE
T ss_conf             04366999999986338987999717865888400------9879995



>d1tfra2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 182 hypothetical protein CLIBASIA_04175 [Candidatus Li
2qip_A_165 (A:) Protein of unknown function VPA0982; APC85975 9e-29
>2qip_A (A:) Protein of unknown function VPA0982; APC85975, structural genomics, PSI-2, protein structure initiative; 1.48A {Vibrio parahaemolyticus rimd 2210633}Length = 165 Back     alignment and structure
 Score =  120 bits (303), Expect = 9e-29
 Identities = 44/168 (26%), Positives = 72/168 (42%), Gaps = 13/168 (7%)

Query: 3   DPREKIALFIDGANLYASSK-ALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFS 61
           D +EKIA+ +D  N+Y + + A   + DY +          V+ A  Y     DP+Q   
Sbjct: 7   DHKEKIAILVDVQNVYYTCREAYRSNFDYNQFWYVATQEKEVVSAKAYAIASNDPKQ--- 63

Query: 62  PLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSG 121
                   L   GF+V  K   +  +       K   DV + +DA E +  ++ +++ SG
Sbjct: 64  --RQFHHILRGVGFEVXLKPYIQRRDGSA----KGDWDVGITLDAIEIAPDVDRVILVSG 117

Query: 122 DGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAYL 169
           DG F+ LV  +Q++  K      V   P + S  L   AD F+ +   
Sbjct: 118 DGDFSLLVERIQQRYNKKVT---VYGVPRLTSQTLIDCADNFVAIDDD 162


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target182 hypothetical protein CLIBASIA_04175 [Candidatus Liberib
2qip_A_165 Protein of unknown function VPA0982; APC85975, str 100.0
1tfr_A_1-182_262-281202 T4 RNAse H; 5U-3U exonuclease, RNA:RNA, DNA:DNA, m 95.16
3g1w_A_1-108_243-305171 Sugar ABC transporter; sugar-binding protein, targ 90.55
1exn_A_1-181_262-290210 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Ent 94.11
3eaf_A_122-261_351-391181 ABC transporter, substrate binding protein; PSI2, 92.54
2qv7_A_1-140140 Diacylglycerol kinase DGKB; alpha-beta domain 1, b 90.19
>2qip_A (A:) Protein of unknown function VPA0982; APC85975, structural genomics, PSI-2, protein structure initiative; 1.48A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
Probab=100.00  E-value=4.5e-32  Score=220.66  Aligned_cols=155  Identities=28%  Similarity=0.422  Sum_probs=138.4

Q ss_pred             CCCCEEEEEEEHHHHHHHHHH-CCCCCCHHHHHHHHHHCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             788718999807899999985-0876798999999851792999999730688731467775799988975595697534
Q gi|254780936|r    3 DPREKIALFIDGANLYASSKA-LGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVAKV   81 (182)
Q Consensus         3 ~~~~rvaIfID~~Nl~~~~~~-~~~~~d~~~L~~~l~~~~~l~~~~~y~~~~~~~~~~~~~~~~~~~~l~~~g~~v~~~~   81 (182)
                      ++.+|+||||||+|++++.++ .++++|+.+|++.+.+.+++.++++|++.+.+..     ...|.++|++.||+++.+|
T Consensus         7 ~~~~rvaifiDg~Nl~~~~~~~~~~~~d~~~l~~~~~~~~~i~~~~~y~~~~~~~~-----~~~~~~~l~~~g~~v~~~~   81 (165)
T 2qip_A            7 DHKEKIAILVDVQNVYYTCREAYRSNFDYNQFWYVATQEKEVVSAKAYAIASNDPK-----QRQFHHILRGVGFEVXLKP   81 (165)
T ss_dssp             CCCEEEEEEEEHHHHHHHHHHHHSSCBCHHHHHHHHTTTEEEEEEEEEECCCCCHH-----HHHHHHHHHHHTCEEEECC
T ss_pred             CCCCCEEEEEEHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCEEEEEEEECCCCCHH-----HCCHHHHHHHCCCEEEEEE
T ss_conf             87782899981653699998743767799999999970792899999705778555-----4125689884574256641


Q ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHH-CCCEEEEEEEECCCCCCCHHHHHHHC
Q ss_conf             58953788865435653299999999942115889998386658999999998-49889999831577654708999852
Q gi|254780936|r   82 AKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVAALQR-KVKKVTIVSTVLSDPSMASDQLRRQA  160 (182)
Q Consensus        82 ~~~~~~~~~~~~~kk~~Dv~laiD~~~~a~~~d~~iLvSGD~Df~pli~~lr~-~Gk~V~v~~~~~~~~~~~S~~L~~~a  160 (182)
                      ...+..+    ..||++|+.|++||+++++++|++||||||+||+|++++||+ .|++|+++++    ++.+|++|+++|
T Consensus        82 ~~~~~~~----~~~k~~Dv~laid~~~~~~~~d~~vlvSgD~Df~p~i~~lr~~~g~~V~v~~~----~~~~s~~L~~~a  153 (165)
T 2qip_A           82 YIQRRDG----SAKGDWDVGITLDAIEIAPDVDRVILVSGDGDFSLLVERIQQRYNKKVTVYGV----PRLTSQTLIDCA  153 (165)
T ss_dssp             CCCCSSC----CCSCCCHHHHHHHHHHHGGGCSEEEEECCCGGGHHHHHHHHHHHCCEEEEEEC----GGGSCHHHHHHS
T ss_pred             EEECCCC----CCCCCCHHHHHHHHHHHHHHCCEEEEEECCCCHHHHHHHHHHHCCCEEEEEEC----CCCCCHHHHHHC
T ss_conf             1551678----78872379999999976523799999978825899999999838958999978----998829999869


Q ss_pred             CCCEEHHHHH
Q ss_conf             1115189978
Q gi|254780936|r  161 DYFMDLAYLK  170 (182)
Q Consensus       161 d~fi~l~~l~  170 (182)
                      |.|++|+++.
T Consensus       154 d~~~~l~~~~  163 (165)
T 2qip_A          154 DNFVAIDDDF  163 (165)
T ss_dssp             SEEEECSGGG
T ss_pred             CEEEECCCHH
T ss_conf             9889857221



>1tfr_A (A:1-182,A:262-281) T4 RNAse H; 5U-3U exonuclease, RNA:RNA, DNA:DNA, metal-dependent, magnesium-containing, hydrolase (nucleic acid); 2.06A {Enterobacteria phage T4} Back     alignment and structure
>3g1w_A (A:1-108,A:243-305) Sugar ABC transporter; sugar-binding protein, target 11229F, transport protein, structural genomics, PSI-2; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>1exn_A (A:1-181,A:262-290) 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enterobacteria phage T5} Back     alignment and structure
>3eaf_A (A:122-261,A:351-391) ABC transporter, substrate binding protein; PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>2qv7_A (A:1-140) Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP complex, transferase; HET: ADP; 2.30A {Staphylococcus aureus} Back     alignment and structure