254780935

254780935

rare lipoprotein A

GeneID in NCBI database:8209957Locus tag:CLIBASIA_04170
Protein GI in NCBI database:254780935Protein Accession:YP_003065348.1
Gene range:+(925929, 926759)Protein Length:276aa
Gene description:rare lipoprotein A
COG prediction:[M] Lipoproteins
KEGG prediction:rare lipoprotein A; K03642 rare lipoprotein A
SEED prediction:Rare lipoprotein A precursor
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQKQREISLRERKKSNLIPLPNGYSPPRKMGKIPIPSRF
cccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccEEEEEEEEEcccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccEEEEccHHHHHHcccccccEEEEEEEEEEccccccccccccccccccccccccccccHHHcccccccccccccccEEccccccHHHHHHHHHHHHHHcccccccccccccccHHHccccccccc
cccccHHHHHHccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEcccEEEcccccccccccEEEEccccccccccccccEccHHHccccccccccccEEEEEEcccccEEEEEEccccccccccEEEHHHHHHHHHccccccccEEEEEEEEcccccccccccccccccccccccccccHcccccccccccccccccEEccccccHHHHHHHHHcccHHHccccccccccccccccccccccccccc
mkrfscdcllkgSVVCVVVLGMSscffsstykddkleyfpesmygvtasdrivsgkrvprgggryflgkpyqimgrwyvprQYTAYAAVGMASWygkafhgrltangevygteyitaahptlplpsyvrvtNMENGISLVVRVndrgpyhsnrliDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVnsatvlplgcqyreeIVVIPYLLTrsrtvhlnncdddslqKQREISLRErkksnliplpngyspprkmgkipipsrf
mkrfscdcllkGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESmygvtasdrivsgkrvprgggryflgkpyqimGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTvhlnncdddslqKQREIslrerkksnliplpngyspprkmgkipipsrf
MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQKQREISLRERKKSNLIPLPNGYSPPRKMGKIPIPSRF
*********LKGSVVCVVVLGMSS**********************************************YQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA*********************************************************************************************
MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQKQREISLRERKKSNLIPLPNGYSPPRKMGKIPIPSRF
*KRFSCDCLLKGSVVCVVVLGMSSCFFS**********FPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQKQREISLRERKKSNLIPLPNGYSPPRKMGKIPI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQKQREISLRERKKSNLIPLPNGYSPPRKMGKIPIPSRF
MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQKQREISLRERKKSNLIPLPNGYSPPRKMGKIPIPSRF
MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQKQREISLRERKKSNLIPLPNGYSPPRKMGKIPIPSRF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target276 rare lipoprotein A [Candidatus Liberibacter asiaticus s
315122348315 rare lipoprotein A [Candidatus Liberibacter solanacearu 1 1e-104
150396512346 rare lipoprotein A [Sinorhizobium medicae WSM419] Lengt 1 1e-54
241204718364 rare lipoprotein A [Rhizobium leguminosarum bv. trifoli 1 5e-54
116252225368 outer membrane protein [Rhizobium leguminosarum bv. vic 1 9e-54
209549401364 lipoprotein A [Rhizobium leguminosarum bv. trifolii WSM 1 1e-53
190891839368 rare lipoprotein A precursor protein [Rhizobium etli CI 1 2e-53
307312734346 rare lipoprotein A [Sinorhizobium meliloti BL225C] Leng 1 2e-53
15965359346 putative rare lipoprotein A precursor [Sinorhizobium me 1 2e-53
222086015 395 rare lipoprotein A precursor protein [Agrobacterium rad 1 3e-53
218516197347 rare lipoprotein A precursor protein [Rhizobium etli 8C 1 4e-53
>gi|315122348|ref|YP_004062837.1| rare lipoprotein A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 315 Back     alignment and organism information
 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/261 (72%), Positives = 213/261 (81%), Gaps = 8/261 (3%)

Query: 1   MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPR 60
           M RFS     +  ++ +  LGMSSCFFSS    +  EYFPES YGV+ASDRIV GKRVPR
Sbjct: 1   MARFSFSFFWRMGIISITSLGMSSCFFSSDSIKNNYEYFPESKYGVSASDRIVFGKRVPR 60

Query: 61  GGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           GGGRY LGKPYQI GR Y+PRQY +YAA+GMASWYGKAFHGRLTANGE+YGTEYITAAHP
Sbjct: 61  GGGRYLLGKPYQIKGRQYIPRQYISYAAIGMASWYGKAFHGRLTANGEIYGTEYITAAHP 120

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           TLPLPSYVRVTN+ENGISLVVRVNDRGPYH NRLIDLSNAAAKIL +EERG++KVHV+YL
Sbjct: 121 TLPLPSYVRVTNLENGISLVVRVNDRGPYHDNRLIDLSNAAAKILHIEERGIAKVHVQYL 180

Query: 181 GMALLNGMDQEYLRSTVMVNSAT---VLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDS 237
           GMA L+G DQ YL+S  M+ S T    LPLGCQY EEIV IPYLLTR +TV L+NCDD+S
Sbjct: 181 GMASLSGTDQGYLKS--MIGSYTQKMSLPLGCQYVEEIVKIPYLLTRRQTVSLSNCDDNS 238

Query: 238 LQKQREISLRERKKSNLIPLP 258
           L++Q +ISL    K   IP+P
Sbjct: 239 LRRQNDISL---GKKTAIPIP 256


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396512|ref|YP_001326979.1| rare lipoprotein A [Sinorhizobium medicae WSM419] Length = 346 Back     alignment and organism information
>gi|241204718|ref|YP_002975814.1| rare lipoprotein A [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 364 Back     alignment and organism information
>gi|116252225|ref|YP_768063.1| outer membrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 368 Back     alignment and organism information
>gi|209549401|ref|YP_002281318.1| lipoprotein A [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 364 Back     alignment and organism information
>gi|190891839|ref|YP_001978381.1| rare lipoprotein A precursor protein [Rhizobium etli CIAT 652] Length = 368 Back     alignment and organism information
>gi|307312734|ref|ZP_07592365.1| rare lipoprotein A [Sinorhizobium meliloti BL225C] Length = 346 Back     alignment and organism information
>gi|15965359|ref|NP_385712.1| putative rare lipoprotein A precursor [Sinorhizobium meliloti 1021] Length = 346 Back     alignment and organism information
>gi|222086015|ref|YP_002544547.1| rare lipoprotein A precursor protein [Agrobacterium radiobacter K84] Length = 395 Back     alignment and organism information
>gi|218516197|ref|ZP_03513037.1| rare lipoprotein A precursor protein [Rhizobium etli 8C-3] Length = 347 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target276 rare lipoprotein A [Candidatus Liberibacter asiaticus s
TIGR00413208 TIGR00413, rlpA, rare lipoprotein A 2e-30
PRK10672361 PRK10672, PRK10672, rare lipoprotein A; Provisional 8e-28
pfam0333076 pfam03330, DPBB_1, Rare lipoprotein A (RlpA)-like doubl 2e-11
COG0797233 COG0797, RlpA, Lipoproteins [Cell envelope biogenesis, 1e-42
>gnl|CDD|161866 TIGR00413, rlpA, rare lipoprotein A Back     alignment and domain information
>gnl|CDD|182636 PRK10672, PRK10672, rare lipoprotein A; Provisional Back     alignment and domain information
>gnl|CDD|146125 pfam03330, DPBB_1, Rare lipoprotein A (RlpA)-like double-psi beta-barrel Back     alignment and domain information
>gnl|CDD|31140 COG0797, RlpA, Lipoproteins [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 276 rare lipoprotein A [Candidatus Liberibacter asiaticus s
PRK10672 369 rare lipoprotein A; Provisional 100.0
COG0797233 RlpA Lipoproteins [Cell envelope biogenesis, outer memb 100.0
TIGR00413218 rlpA rare lipoprotein A; InterPro: IPR012997 This is a 100.0
pfam0333076 DPBB_1 Rare lipoprotein A (RlpA)-like double-psi beta-b 99.48
COG4305232 Endoglucanase C-terminal domain/subunit and related pro 95.99
COG3584109 Uncharacterized protein conserved in bacteria [Function 92.35
pfam00967119 Barwin Barwin family. 96.02
smart0083787 DPBB_1 Rare lipoprotein A (RlpA)-like double-psi beta-b 93.62
PRK10781133 rcsF outer membrane lipoprotein; Reviewed 92.93
>PRK10672 rare lipoprotein A; Provisional Back     alignment and domain information
>COG0797 RlpA Lipoproteins [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00413 rlpA rare lipoprotein A; InterPro: IPR012997 This is a domain found in some bacterial lipoproteins Back     alignment and domain information
>pfam03330 DPBB_1 Rare lipoprotein A (RlpA)-like double-psi beta-barrel Back     alignment and domain information
>COG4305 Endoglucanase C-terminal domain/subunit and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3584 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam00967 Barwin Barwin family Back     alignment and domain information
>smart00837 DPBB_1 Rare lipoprotein A (RlpA)-like double-psi beta-barrel Back     alignment and domain information
>PRK10781 rcsF outer membrane lipoprotein; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target276 rare lipoprotein A [Candidatus Liberibacter asiaticus s
3d30_A208 YOAJ, expansin like protein; peptidoglycan associated p 5e-06
>3d30_A YOAJ, expansin like protein; peptidoglycan associated protein, unknown function, MLTA, bacteria autolysis, peptidoglycan-binding protein; 1.90A {Bacillus subtilis} PDB: 2bh0_A Length = 208 Back     alignment and structure
 Score = 46.9 bits (111), Expect = 5e-06
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 11/100 (11%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP---------SYVRVTNMENGISLV 140
           G A++ G  + G       +     ITA +P              SY+ V          
Sbjct: 9   GYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEG--PKGKTT 66

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V V D  P  +   +DLS  A + +   + G   +    +
Sbjct: 67  VYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVV 106


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target276 rare lipoprotein A [Candidatus Liberibacter asiaticus s
3d30_A208 YOAJ, expansin like protein; peptidoglycan associated p 99.07
2hcz_X245 Beta-expansin 1A; domain 1 is A beta barrel and domain 97.41
1wc2_A181 Endoglucanase; hydrolase, cellulase, cellulose, double- 97.37
1n10_A241 PHL P I, pollen allergen PHL P 1; plant allergen, expan 96.16
1bw3_A125 Barwin, basic barley SEED protein; lectin; NMR {Hordeum 97.87
>3d30_A YOAJ, expansin like protein; peptidoglycan associated protein, unknown function, MLTA, bacteria autolysis, peptidoglycan-binding protein; 1.90A {Bacillus subtilis} PDB: 2bh0_A Back     alignment and structure
Probab=99.07  E-value=6.5e-10  Score=78.87  Aligned_cols=97  Identities=21%  Similarity=0.175  Sum_probs=77.7

Q ss_pred             CCEEEEEEEEECCCCCCCCCCCCCEECCCCCEEECCCCC---------CCCEEEEEECCCCCEEEEEECCCCCCCCCEEE
Q ss_conf             824679988856841687065887224610102036689---------98489999889985799996688888696187
Q gi|254780935|r   85 AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLP---------LPSYVRVTNMENGISLVVRVNDRGPYHSNRLI  155 (276)
Q Consensus        85 ~y~~~G~ASwYg~~f~G~~TAnGE~~~~~~lTAAH~tLP---------l~s~VrVTNl~nGrsvvVrVNDRGPf~~gRiI  155 (276)
                      +....|.|+|||..+.|.-...+.+-......|.+..+-         .|..++||+  ++++|+|+|+||+|.-....|
T Consensus         4 ~~~~~G~aT~yg~~~~gGac~~~~~p~~~~~~Al~~~~~~~~~~~~~~CG~c~~v~~--~~~sv~v~V~D~Cp~c~~~~~   81 (208)
T 3d30_A            4 DDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEG--PKGKTTVYVTDLYPEGARGAL   81 (208)
T ss_dssp             TCCEEEEEEECSTTSSSCTTCCCCCCTTCCEEEECHHHHTGGGCTTTTTTCEEEEEE--TTEEEEEEEEEECTTCCTTCE
T ss_pred             CCEEEEEEEEECCCCCCCCCCCCCCCCCCEEEEECHHHHCCCCCCCCCCCCEEEEEC--CCCCEEEEEEECCCCCCCCEE
T ss_conf             750788888878999886466898876766899688995878755355887899996--998699999872899989938


Q ss_pred             ECCHHHHHHHCCCCCCEEEEEEEEEECC
Q ss_conf             7588999870973258189999998528
Q gi|254780935|r  156 DLSNAAAKILRVEERGVSKVHVEYLGMA  183 (276)
Q Consensus       156 DLS~~AA~~Lg~~~~Gva~V~ve~lg~a  183 (276)
                      |||..|+.+|+-...|+.+|..+.+.-.
T Consensus        82 DLS~~aF~~ia~~~~G~~~v~~~~V~C~  109 (208)
T 3d30_A           82 DLSPNAFRKIGNMKDGKINIKWRVVKAP  109 (208)
T ss_dssp             EECHHHHHHHSCGGGSSEEEEEEEECCC
T ss_pred             ECCHHHHHHHCCCCCCEEEEEEEEEECC
T ss_conf             7799999853556887799999997289



>2hcz_X Beta-expansin 1A; domain 1 is A beta barrel and domain 2 is A immunoglobulin like beta-sandwich, allergen; HET: NAG MAN FCA; 2.75A {Zea mays} Back     alignment and structure
>1wc2_A Endoglucanase; hydrolase, cellulase, cellulose, double-PSI fold, glycoside hydrolase; 1.2A {Mytilus edulis} SCOP: b.52.1.1 Back     alignment and structure
>1n10_A PHL P I, pollen allergen PHL P 1; plant allergen, expansin, immunoglobulin-like fold, double-PSI beta barrel, structural genomics; HET: NAG; 2.90A {Phleum pratense} SCOP: b.7.3.1 b.52.1.3 Back     alignment and structure
>1bw3_A Barwin, basic barley SEED protein; lectin; NMR {Hordeum vulgare} SCOP: b.52.1.2 PDB: 1bw4_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target276 rare lipoprotein A [Candidatus Liberibacter asiaticus s
d1n10a2143 Pollen allergen PHL P 1 N-terminal domain {Timothy gras 97.69
d1wc2a1180 Endoglucanase (CMCase) {Blue mussel (Mytilus edulis) [T 97.23
d1bw3a_125 Barwin {Barley (Hordeum vulgare) [TaxId: 4513]} 95.19
>d1n10a2 b.52.1.3 (A:1003-1145) Pollen allergen PHL P 1 N-terminal domain {Timothy grass (Phleum pratense) [TaxId: 15957]} Back     information, alignment and structure
class: All beta proteins
fold: Double psi beta-barrel
superfamily: Barwin-like endoglucanases
family: Pollen allergen PHL P 1 N-terminal domain
domain: Pollen allergen PHL P 1 N-terminal domain
species: Timothy grass (Phleum pratense) [TaxId: 15957]
Probab=97.69  E-value=0.00017  Score=44.28  Aligned_cols=93  Identities=19%  Similarity=0.196  Sum_probs=65.1

Q ss_pred             EEEEEEEECCCCCCCCC-----CCCCE-EC---CCCCEEECC------CCCCCCEEEEEECCC----CCEEEEEECCCCC
Q ss_conf             67998885684168706-----58872-24---610102036------689984899998899----8579999668888
Q gi|254780935|r   88 AVGMASWYGKAFHGRLT-----ANGEV-YG---TEYITAAHP------TLPLPSYVRVTNMEN----GISLVVRVNDRGP  148 (276)
Q Consensus        88 ~~G~ASwYg~~f~G~~T-----AnGE~-~~---~~~lTAAH~------tLPl~s~VrVTNl~n----GrsvvVrVNDRGP  148 (276)
                      ..|.|+|||.. +|.-|     |.|-- .+   ...++||-.      ..-.|-..+|+...+    +++|+|+|.|+.|
T Consensus        18 ~~g~AT~Yg~~-~~~~~~~~gGACGyg~~~~~p~g~~~aAls~~l~~~g~~CG~cyev~c~~~~~c~~~sv~V~vtd~c~   96 (143)
T d1n10a2          18 LDAKSTWYGKP-TGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE   96 (143)
T ss_dssp             EEEEEEEEC-----------CCTTCCCCTTSTTTTTCEEEECHHHHGGGTTSSCEEEEEECSSTTBCSCCEEEEEEEECS
T ss_pred             EEEEEEEECCC-CCCCCCCCCCCCCCCCCCCCCCCCEEEEECHHHCCCCCCCCCCEEEECCCCCCCCCCCEEEEEEECCC
T ss_conf             71478696998-88877788604788876657776567770775716887677664857689976149987999975556


Q ss_pred             CCC-CEEEECCHHHHHHHCCC-------CCCEEEEEEEEEE
Q ss_conf             869-61877588999870973-------2581899999985
Q gi|254780935|r  149 YHS-NRLIDLSNAAAKILRVE-------ERGVSKVHVEYLG  181 (276)
Q Consensus       149 f~~-gRiIDLS~~AA~~Lg~~-------~~Gva~V~ve~lg  181 (276)
                      --. ..-+|||..|+.+|.-.       +.|+.+|+.+.+.
T Consensus        97 ~~~~~~hfDLS~~AF~~iA~~~~~~~~~~~Giv~V~yRrV~  137 (143)
T d1n10a2          97 EPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVK  137 (143)
T ss_dssp             SCSSSSEEEEEHHHHHTTBSTTCHHHHHTTCSEEEEEEECC
T ss_pred             CCCCCCCCCCCHHHHHHHCCCCCHHHHEECCCCCEEEEEEE
T ss_conf             99997266289999962134420012300670213899975



>d1wc2a1 b.52.1.1 (A:1-180) Endoglucanase (CMCase) {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1bw3a_ b.52.1.2 (A:) Barwin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 276 rare lipoprotein A [Candidatus Liberibacter asiati
1bw3_A_125 (A:) Barwin, basic barley SEED protein; lectin; NM 3e-21
3d30_A_1-109109 (A:1-109) YOAJ, expansin like protein; peptidoglyc 2e-19
>1bw3_A (A:) Barwin, basic barley SEED protein; lectin; NMR {Hordeum vulgare}Length = 125 Back     alignment and structure
 Score = 96.9 bits (241), Expect = 3e-21
 Identities = 16/115 (13%), Positives = 28/115 (24%), Gaps = 8/115 (6%)

Query: 69  KPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEY----ITAAHPTLPL 124
              +    +Y P Q          S Y   +      +                      
Sbjct: 4   NDVRATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGPRGQAAC 63

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAA-KILRVEERGVSKVHVE 178
              +RVTN   G  +  R+ D+        +DL        +     G  + H+ 
Sbjct: 64  GKCLRVTNPATGAQITARIVDQCANGG---LDLDWDTVFTKIDTNGIGYQQGHLN 115


>3d30_A (A:1-109) YOAJ, expansin like protein; peptidoglycan associated protein, unknown function, MLTA, bacteria autolysis, peptidoglycan-binding protein; 1.90A {Bacillus subtilis} PDB: 2bh0_ALength = 109 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target276 rare lipoprotein A [Candidatus Liberibacter asiaticus s
1bw3_A_125 Barwin, basic barley SEED protein; lectin; NMR {Ho 99.67
3d30_A_1-109109 YOAJ, expansin like protein; peptidoglycan associa 99.6
2hcz_X_1-142142 Beta-expansin 1A; domain 1 is A beta barrel and do 98.06
1n10_A_1-143143 PHL P I, pollen allergen PHL P 1; plant allergen, 97.56
1wc2_A_181 Endoglucanase; hydrolase, cellulase, cellulose, do 97.16
3czb_A_1-86_249-351189 Putative transglycosylase; structural genomics, un 95.51
2pnw_A_380 AGR_C_15P, membrane-bound lytic murein transglycos 92.35
2ae0_X_1-104_248-345202 Membrane-bound lytic murein transglycosylase A; do 90.19
>1bw3_A (A:) Barwin, basic barley SEED protein; lectin; NMR {Hordeum vulgare} Back     alignment and structure
Probab=99.67  E-value=5e-19  Score=135.65  Aligned_cols=99  Identities=17%  Similarity=0.112  Sum_probs=85.9

Q ss_pred             CEEEEECCCCCCEEEEEEEEECCCCCCCCCCCCCEECCC----CCEEECCCCCCCCEEEEEECCCCCEEEEEECCCCCCC
Q ss_conf             488962578782467998885684168706588722461----0102036689984899998899857999966888886
Q gi|254780935|r   75 GRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTE----YITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYH  150 (276)
Q Consensus        75 Gk~Y~P~~~~~y~~~G~ASwYg~~f~G~~TAnGE~~~~~----~lTAAH~tLPl~s~VrVTNl~nGrsvvVrVNDRGPf~  150 (276)
                      +.+|.|.....|...|.|+|||..++|..+++++.|+..    .++.+|..+++|+.++|||+.|||+|+|+|+||+|  
T Consensus        10 ~~~~~~a~at~y~~~G~at~yg~~g~G~~~~~~~~~~~~~aa~s~~~~~~~~~CG~c~~Vt~~~~gksV~v~V~D~cp--   87 (125)
T 1bw3_A           10 YHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGPRGQAACGKCLRVTNPATGAQITARIVDQCA--   87 (125)
T ss_dssp             CCCSSCGGGTTCTTSTTTCCTTHHHHTTSCHHHHHHSCCEESCSTTCCCSGGGTTCEEEEEETTTTEEEEEEEEECCS--
T ss_pred             EEECCCCCCCCCCCHHHHHHHEEECCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCEEEEEECCCCCEEEEEEEECCC--
T ss_conf             764176646733116665431010237986402368875477637787575553322786532668788999975036--


Q ss_pred             CCEEEECCH-HHHHHHCCCCCCEEEEE
Q ss_conf             961877588-99987097325818999
Q gi|254780935|r  151 SNRLIDLSN-AAAKILRVEERGVSKVH  176 (276)
Q Consensus       151 ~gRiIDLS~-~AA~~Lg~~~~Gva~V~  176 (276)
                       ++.||||. +|+++|++...|+..++
T Consensus        88 -~~~iDLS~~aAf~~lg~~~~g~~~G~  113 (125)
T 1bw3_A           88 -NGGLDLDWDTVFTKIDTNGIGYQQGH  113 (125)
T ss_dssp             -SSSCCSCSSSSHHHHCSSCHHHHHSE
T ss_pred             -CCCCCCCCHHHHHEECCCCCCCCCCC
T ss_conf             -89885670765401467883100662



>3d30_A (A:1-109) YOAJ, expansin like protein; peptidoglycan associated protein, unknown function, MLTA, bacteria autolysis, peptidoglycan-binding protein; 1.90A {Bacillus subtilis} PDB: 2bh0_A Back     alignment and structure
>2hcz_X (X:1-142) Beta-expansin 1A; domain 1 is A beta barrel and domain 2 is A immunoglobulin like beta-sandwich, allergen; HET: NAG MAN FCA; 2.75A {Zea mays} Back     alignment and structure
>1n10_A (A:1-143) PHL P I, pollen allergen PHL P 1; plant allergen, expansin, immunoglobulin-like fold, double-PSI beta barrel, structural genomics; HET: NAG; 2.90A {Phleum pratense} Back     alignment and structure
>1wc2_A (A:) Endoglucanase; hydrolase, cellulase, cellulose, double-PSI fold, glycoside hydrolase; 1.2A {Mytilus edulis} Back     alignment and structure
>3czb_A (A:1-86,A:249-351) Putative transglycosylase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Caulobacter crescentus CB15} Back     alignment and structure
>2pnw_A (A:) AGR_C_15P, membrane-bound lytic murein transglycosylase; structural genomics, PSI-2, protein structure initiative; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ae0_X (X:1-104,X:248-345) Membrane-bound lytic murein transglycosylase A; double-PSI beta-barrel, small mixed parallel/antiparallel six stranded beta barrel; 2.00A {Escherichia coli} Back     alignment and structure