254780938

254780938

4'-phosphopantetheinyl transferase

GeneID in NCBI database:8209960Locus tag:CLIBASIA_04185
Protein GI in NCBI database:254780938Protein Accession:YP_003065351.1
Gene range:+(928660, 929058)Protein Length:132aa
Gene description:4'-phosphopantetheinyl transferase
COG prediction:[I] Phosphopantetheinyl transferase (holo-ACP synthase)
KEGG prediction:acpS; 4'-phosphopantetheinyl transferase (EC:2.7.8.7); K00997 holo-[acyl-carrier protein] synthase [EC:2.7.8.7]
SEED prediction:Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)
Pathway involved in KEGG:Pantothenate and CoA biosynthesis [PATH:las00770]
Subsystem involved in SEED:Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSKAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPFAQAFVVIESLLI
cEEEEEccEEEHHHHHHHHHHccHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccHHEEEEEEcccccEEEEEcHHHHHHHHHccccccccEEEEEEEEcccEEEEEEEEEcccc
cEEEccccHHHHHHHHHHHHHHcHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccHHHEEEEEcccccEEEEEcHHHHHHHHHHcccccccEEEEEEccccHHHHHEEEEEHHcc
miigigsdIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSKAIGTgiskgvswkdievchfpggkpyisisgrasdvlsslvpkgykpvvhltisddfpfAQAFVVIESLLI
miigigsdivsiQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSKAIgtgiskgvswKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPFAQAFVVIESLLI
MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSKAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPFAQAFVVIESLLI
MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSKAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPFAQAFVVIESLLI
MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSKAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPFAQAFVVIESLLI
MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSKAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPFAQAFVVIESLLI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSKAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPFAQAFVVIESLLI
MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSKAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPFAQAFVVIESLLI
MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSKAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPFAQAFVVIESLLI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target132 4'-phosphopantetheinyl transferase [Candidatus Liberiba
315122351134 4'-phosphopantetheinyl transferase [Candidatus Liberiba 1 5e-49
241203887134 4'-phosphopantetheinyl transferase [Rhizobium leguminos 1 2e-38
209548599134 4'-phosphopantetheinyl transferase [Rhizobium leguminos 1 4e-38
163760597133 4'-phosphopantetheinyl transferase [Hoeflea phototrophi 1 8e-38
116251275134 4'-phosphopantetheinyl transferase [Rhizobium leguminos 1 1e-37
227821401139 4'-phosphopantetheinyl transferase [Sinorhizobium fredi 1 2e-37
86357026134 4'-phosphopantetheinyl transferase [Rhizobium etli CFN 1 3e-37
218671655134 4'-phosphopantetheinyl transferase [Rhizobium etli GR56 1 4e-37
218507227134 4'-phosphopantetheinyl transferase [Rhizobium etli Bras 1 5e-37
190891071134 holo-[acyl-carrier-protein] synthase [Rhizobium etli CI 1 7e-37
>gi|315122351|ref|YP_004062840.1| 4'-phosphopantetheinyl transferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 134 Back     alignment and organism information
 Score =  197 bits (500), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 94/131 (71%), Positives = 114/131 (87%)

Query: 1   MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFS 60
           MIIGIGSDIV+I+RI RLLQ+FN+KFE RCFSS EQD C+ S +R +SYAKRFA+KEAFS
Sbjct: 1   MIIGIGSDIVNIERIQRLLQNFNKKFELRCFSSSEQDDCNFSSHRASSYAKRFASKEAFS 60

Query: 61  KAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPF 120
           KA+GTGI++G+SWKDI V + PGGKP IS+ G ASD L +L+P GY+P++HLTISDDFPF
Sbjct: 61  KALGTGIARGISWKDIVVSNLPGGKPCISVLGCASDNLFALIPIGYEPIIHLTISDDFPF 120

Query: 121 AQAFVVIESLL 131
           AQAFVVIE+ L
Sbjct: 121 AQAFVVIEARL 131


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241203887|ref|YP_002974983.1| 4'-phosphopantetheinyl transferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 134 Back     alignment and organism information
>gi|209548599|ref|YP_002280516.1| 4'-phosphopantetheinyl transferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 134 Back     alignment and organism information
>gi|163760597|ref|ZP_02167678.1| 4'-phosphopantetheinyl transferase [Hoeflea phototrophica DFL-43] Length = 133 Back     alignment and organism information
>gi|116251275|ref|YP_767113.1| 4'-phosphopantetheinyl transferase [Rhizobium leguminosarum bv. viciae 3841] Length = 134 Back     alignment and organism information
>gi|227821401|ref|YP_002825371.1| 4'-phosphopantetheinyl transferase [Sinorhizobium fredii NGR234] Length = 139 Back     alignment and organism information
>gi|86357026|ref|YP_468918.1| 4'-phosphopantetheinyl transferase [Rhizobium etli CFN 42] Length = 134 Back     alignment and organism information
>gi|218671655|ref|ZP_03521324.1| 4'-phosphopantetheinyl transferase [Rhizobium etli GR56] Length = 134 Back     alignment and organism information
>gi|218507227|ref|ZP_03505105.1| 4'-phosphopantetheinyl transferase [Rhizobium etli Brasil 5] Length = 134 Back     alignment and organism information
>gi|190891071|ref|YP_001977613.1| holo-[acyl-carrier-protein] synthase [Rhizobium etli CIAT 652] Length = 134 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target132 4'-phosphopantetheinyl transferase [Candidatus Liberiba
PRK00070126 PRK00070, acpS, 4'-phosphopantetheinyl transferase; Pro 3e-42
PRK14659122 PRK14659, acpS, 4'-phosphopantetheinyl transferase; Pro 4e-26
PRK14660125 PRK14660, acpS, 4'-phosphopantetheinyl transferase; Pro 1e-25
PRK14656126 PRK14656, acpS, 4'-phosphopantetheinyl transferase; Pro 4e-25
TIGR00516121 TIGR00516, acpS, holo-[acyl-carrier-protein] synthase 4e-20
PRK14657123 PRK14657, acpS, 4'-phosphopantetheinyl transferase; Pro 8e-19
TIGR00556128 TIGR00556, pantethn_trn, phosphopantethiene--protein tr 3e-17
PRK14663116 PRK14663, acpS, 4'-phosphopantetheinyl transferase; Pro 7e-16
PRK14662120 PRK14662, acpS, 4'-phosphopantetheinyl transferase; Pro 2e-13
PRK14661169 PRK14661, acpS, 4'-phosphopantetheinyl transferase; Pro 7e-10
COG0736127 COG0736, AcpS, Phosphopantetheinyl transferase (holo-AC 1e-34
pfam0164858 pfam01648, ACPS, 4'-phosphopantetheinyl transferase sup 1e-05
>gnl|CDD|178838 PRK00070, acpS, 4'-phosphopantetheinyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|173122 PRK14659, acpS, 4'-phosphopantetheinyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|173123 PRK14660, acpS, 4'-phosphopantetheinyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|173119 PRK14656, acpS, 4'-phosphopantetheinyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|161910 TIGR00516, acpS, holo-[acyl-carrier-protein] synthase Back     alignment and domain information
>gnl|CDD|173120 PRK14657, acpS, 4'-phosphopantetheinyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|161927 TIGR00556, pantethn_trn, phosphopantethiene--protein transferase domain Back     alignment and domain information
>gnl|CDD|173126 PRK14663, acpS, 4'-phosphopantetheinyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|184783 PRK14662, acpS, 4'-phosphopantetheinyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|184782 PRK14661, acpS, 4'-phosphopantetheinyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|31079 COG0736, AcpS, Phosphopantetheinyl transferase (holo-ACP synthase) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|145012 pfam01648, ACPS, 4'-phosphopantetheinyl transferase superfamily Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 132 4'-phosphopantetheinyl transferase [Candidatus Liberiba
PRK00070126 acpS 4'-phosphopantetheinyl transferase; Provisional 100.0
COG0736127 AcpS Phosphopantetheinyl transferase (holo-ACP synthase 100.0
TIGR00556139 pantethn_trn phosphopantethiene--protein transferase do 100.0
TIGR00516131 acpS holo-(acyl-carrier-protein) synthase; InterPro: IP 99.93
COG2091 223 Sfp Phosphopantetheinyl transferase [Coenzyme metabolis 95.73
KOG0945 289 consensus 94.62
pfam0164858 ACPS 4'-phosphopantetheinyl transferase superfamily. Me 98.85
KOG0945289 consensus 98.29
COG2977228 EntD Phosphopantetheinyl transferase component of sider 97.87
PRK10351185 holo-(acyl carrier protein) synthase 2; Provisional 97.6
COG2091223 Sfp Phosphopantetheinyl transferase [Coenzyme metabolis 97.39
PRK10251207 phosphopantetheinyltransferase component of enterobacti 97.69
COG2977 228 EntD Phosphopantetheinyl transferase component of sider 96.37
PRK10251207 phosphopantetheinyltransferase component of enterobacti 95.67
>PRK00070 acpS 4'-phosphopantetheinyl transferase; Provisional Back     alignment and domain information
>COG0736 AcpS Phosphopantetheinyl transferase (holo-ACP synthase) [Lipid metabolism] Back     alignment and domain information
>TIGR00556 pantethn_trn phosphopantethiene--protein transferase domain; InterPro: IPR004568 This domain is active in transferring the phophopantethiene prosthetic group to its attachment site on enzymes and carrier proteins Back     alignment and domain information
>TIGR00516 acpS holo-(acyl-carrier-protein) synthase; InterPro: IPR002582 Holo-acyl carrier protein synthase (ACPS) transfers the 4'-phosphopantetheine (4'-PP) moiety from coenzyme A (CoA) to Ser-36 of acyl carrier protein (ACP) in Escherichia coli Back     alignment and domain information
>COG2091 Sfp Phosphopantetheinyl transferase [Coenzyme metabolism] Back     alignment and domain information
>KOG0945 consensus Back     alignment and domain information
>pfam01648 ACPS 4'-phosphopantetheinyl transferase superfamily Back     alignment and domain information
>KOG0945 consensus Back     alignment and domain information
>COG2977 EntD Phosphopantetheinyl transferase component of siderophore synthetase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10351 holo-(acyl carrier protein) synthase 2; Provisional Back     alignment and domain information
>COG2091 Sfp Phosphopantetheinyl transferase [Coenzyme metabolism] Back     alignment and domain information
>PRK10251 phosphopantetheinyltransferase component of enterobactin synthase multienzyme complex; Provisional Back     alignment and domain information
>COG2977 EntD Phosphopantetheinyl transferase component of siderophore synthetase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10251 phosphopantetheinyltransferase component of enterobactin synthase multienzyme complex; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target132 4'-phosphopantetheinyl transferase [Candidatus Liberiba
3h88_B129 Crystal Structure Of 4'-Phosphopantetheinyl Transfe 3e-30
3f09_A143 1.82 Angstrom Resolution Crystal Structure Of Holo- 7e-22
1f7t_A122 Holo-(Acyl Carrier Protein) Synthase At 1.8a Length 2e-20
1f7l_A121 Holo-(Acyl Carrier Protein) Synthase In Complex Wit 2e-20
1f80_A120 Holo-(Acyl Carrier Protein) Synthase In Complex Wit 9e-20
3h7q_A132 Crystal Structure Of The Holo-[acyl-Carrier-Protein 2e-18
3ne1_A130 Mycobacterium Tuberculosis Acyl Carrier Protein Syn 3e-18
3hqj_A130 Structure-Function Analysis Of Mycobacterium Tuberc 3e-18
3gwm_A129 Crystal Structure Of The Holo-[acyl-Carrier-Protein 2e-17
1fte_A122 Crystal Structure Of Streptococcus Pneumoniae Acyl 2e-16
2jbz_A143 Crystal Structure Of The Streptomyces Coelicolor Ho 5e-16
2wdy_A143 Crystal Structure Of The Streptomyces Coelicolor D1 9e-15
2uv9_A1878 Crystal Structure Of Fatty Acid Synthase From Therm 3e-14
2wds_A143 Crystal Structure Of The Streptomyces Coelicolor H1 8e-14
2bdd_A182 Crystal Structure Of Holo-Acp-Synthase From Plasmod 1e-13
2was_B122 Structure Of The Fungal Type I Fas Ppt Domain Lengt 2e-13
2qg8_A163 Plasmodium Yoelii Acyl Carrier Protein Synthase Py0 2e-13
3hyk_A122 2.31 Angstrom Resolution Crystal Structure Of A Hol 3e-13
2vkz_A1887 Structure Of The Cerulenin-Inhibited Fungal Fatty A 4e-13
2was_A122 Structure Of The Fungal Type I Fas Ppt Domain Lengt 5e-13
3ne9_A153 Mycobacterium Tuberculosis Acyl Carrier Protein Syn 4e-11
>gi|212375084|pdb|3F09|A Chain A, 1.82 Angstrom Resolution Crystal Structure Of Holo-(Acyl- Carrier-Protein) Synthase (Acps) From Staphylococcus Aureus Length = 143 Back     alignment and structure
>gi|14719536|pdb|1F7T|A Chain A, Holo-(Acyl Carrier Protein) Synthase At 1.8a Length = 122 Back     alignment and structure
>gi|14719535|pdb|1F7L|A Chain A, Holo-(Acyl Carrier Protein) Synthase In Complex With Coenzyme A At 1.5a Length = 121 Back     alignment and structure
>gi|14719507|pdb|1F80|A Chain A, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) Length = 120 Back     alignment and structure
>gi|293651869|pdb|3H7Q|A Chain A, Crystal Structure Of The Holo-[acyl-Carrier-Protein] Synthase (Acps) From Mycobacterium Tuberculosis Length = 132 Back     alignment and structure
gi|301016070|pdb|3NE1|A Chain A, Mycobacterium Tuberculosis Acyl Carrier Protein Synthase Adopts Two Different Structural Conformations: Ph Driven Conformational Changes Of Acps Enzyme Length = 130 Back     alignment and structure
>gi|258588534|pdb|3HQJ|A Chain A, Structure-Function Analysis Of Mycobacterium Tuberculosis Acyl Carrier Protein Synthase (Acps) Length = 130 Back     alignment and structure
>gi|293651841|pdb|3GWM|A Chain A, Crystal Structure Of The Holo-[acyl-Carrier-Protein] Synthase (Acps) From Mycobacterium Smegmatis Length = 129 Back     alignment and structure
>gi|15988400|pdb|1FTE|A Chain A, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 1) Length = 122 Back     alignment and structure
>gi|126031113|pdb|2JBZ|A Chain A, Crystal Structure Of The Streptomyces Coelicolor Holo-[acyl- Carrier-Protein] Synthase (Acps) In Complex With Coenzyme A At 1.6 A Length = 143 Back     alignment and structure
>gi|294979318|pdb|2WDY|A Chain A, Crystal Structure Of The Streptomyces Coelicolor D111a Acps Mutant In Complex With Cofactor Coa At 1.4 A Length = 143 Back     alignment and structure
>gi|146387394|pdb|2UV9|A Chain A, Crystal Structure Of Fatty Acid Synthase From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 Length = 1878 Back     alignment and structure
>gi|294979315|pdb|2WDS|A Chain A, Crystal Structure Of The Streptomyces Coelicolor H110a Acps Mutant In Complex With Cofactor Coa At 1.3 A Length = 143 Back     alignment and structure
>gi|82408089|pdb|2BDD|A Chain A, Crystal Structure Of Holo-Acp-Synthase From Plasmodium Yoelii Length = 182 Back     alignment and structure
>gi|256599489|pdb|2WAS|B Chain B, Structure Of The Fungal Type I Fas Ppt Domain Length = 122 Back     alignment and structure
>gi|157835919|pdb|2QG8|A Chain A, Plasmodium Yoelii Acyl Carrier Protein Synthase Py06285 With Adp Bound Length = 163 Back     alignment and structure
>gi|242556809|pdb|3HYK|A Chain A, 2.31 Angstrom Resolution Crystal Structure Of A Holo-(Acyl- Carrier-Protein) Synthase From Bacillus Anthracis Str. Ames In Complex With Coa (3',5'-Adp) Length = 122 Back     alignment and structure
gi|196049652|pdb|2VKZ|A Chain A, Structure Of The Cerulenin-Inhibited Fungal Fatty Acid Synthase Type I Multienzyme Complex Length = 1887 Back     alignment and structure
>gi|256599488|pdb|2WAS|A Chain A, Structure Of The Fungal Type I Fas Ppt Domain Length = 122 Back     alignment and structure
>gi|304445953|pdb|3NE9|A Chain A, Mycobacterium Tuberculosis Acyl Carrier Protein Synthase Adopts Two Different Structural Conformations: Ph Driven Conformational Changes Of Acps Enzyme Length = 153 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target132 4'-phosphopantetheinyl transferase [Candidatus Liberiba
3h88_A129 Holo-[acyl-carrier-protein] synthase; alpha-beta struct 2e-32
2wds_A143 Holo-[acyl-carrier-protein] synthase; phosphopantethein 1e-30
3gwm_A129 Holo-[acyl-carrier-protein] synthase; HOMO-trimer, 9-st 3e-28
1fth_A122 ACPS, acyl carrier protein synthase; bacterial fatty ac 4e-27
3hyk_A122 Holo-[acyl-carrier-protein] synthase; structural genomi 5e-27
3ne9_A153 Phosphopantethiene protein transferase, PPT1P; acyl car 7e-26
1f7l_A121 Holo-(acyl carrier protein) synthase; 9-strand pseudo b 2e-25
3hqj_A130 Holo-[acyl-carrier-protein] synthase; AN/fold, structur 5e-25
2bdd_A182 ACP-synthase; structural genomics, structural genomics 6e-25
2qg8_A163 Acyl carrier protein synthase PY06285; malaria, 3'5'ADP 5e-24
2jbz_A143 Holo-[acyl-carrier-protein] synthase; ACP, magnesium, c 9e-24
3f09_A143 Holo-[acyl-carrier-protein] synthase; structural genomi 4e-23
2was_A122 3-oxoacyl-[acyl-carrier-protein] synthase; COA, FAS, PP 5e-22
2uv9_A1878 Fatty acid synthase alpha subunits; fungal, dehydratase 2e-06
2uv8_A1887 Fatty acid synthase subunit alpha (FAS2); fatty acid bi 6e-05
1qr0_A228 4'-phosphopantetheinyl transferase SFP; protein-coenzym 0.002
2c43_A323 Aminoadipate-semialdehyde dehydrogenase- phosphopanteth 1e-05
>2wds_A Holo-[acyl-carrier-protein] synthase; phosphopantetheine ARM, fatty acid biosynthesis, lipid synthesis, transferase, polyketides; HET: COA; 1.35A {Streptomyces coelicolor} PDB: 2wdo_A* 2jca_A 2jbz_A* 2wdy_A* Length = 143 Back     alignment and structure
>3gwm_A Holo-[acyl-carrier-protein] synthase; HOMO-trimer, 9-stand pseudo beta barrel protein, cytoplasm, fatty acid biosynthesis; 1.70A {Mycobacterium smegmatis} PDB: 3h7q_A* 3ne3_B 3ne1_A 3hqj_A* Length = 129 Back     alignment and structure
>1fth_A ACPS, acyl carrier protein synthase; bacterial fatty acid biosynthesis, acyl carrier synthase, coenzyme A, X-RAY crystallography; HET: A3P; 1.90A {Streptococcus pneumoniae} SCOP: d.150.1.2 PDB: 1fte_A 1ftf_A* Length = 122 Back     alignment and structure
>3hyk_A Holo-[acyl-carrier-protein] synthase; structural genomics, infectious diseases, center for structural genomics of infectious diseases; HET: MSE A3P; 2.31A {Bacillus anthracis} Length = 122 Back     alignment and structure
>3ne9_A Phosphopantethiene protein transferase, PPT1P; acyl carrier protein synthase, acyl carrier protein, fatty A synthase, ACPS; 2.50A {Corynebacterium ammoniagenes} Length = 153 Back     alignment and structure
>1f7l_A Holo-(acyl carrier protein) synthase; 9-strand pseudo beta barrel protein, COA complex protein, coenzyme A complex, transferase; HET: COA; 1.50A {Bacillus subtilis} SCOP: d.150.1.2 PDB: 1f7t_A 1f80_A* Length = 121 Back     alignment and structure
>3hqj_A Holo-[acyl-carrier-protein] synthase; AN/fold, structural genomics, israel structural proteomics center, ISPC, cytoplasm; HET: COA; 1.95A {Mycobacterium tuberculosis} Length = 130 Back     alignment and structure
>2bdd_A ACP-synthase; structural genomics, structural genomics consortium, SGC, transferase; 2.28A {Plasmodium yoelii yoelii} Length = 182 Back     alignment and structure
>2qg8_A Acyl carrier protein synthase PY06285; malaria, 3'5'ADP, SGC, structural genomics consortium, transferase; HET: A3P; 2.00A {Plasmodium yoelii yoelii} Length = 163 Back     alignment and structure
>2jbz_A Holo-[acyl-carrier-protein] synthase; ACP, magnesium, coenzyme A, transferase, poliketides, metal- binding, lipid synthesis; HET: COA; 1.62A {Streptomyces coelicolor} PDB: 2jca_A Length = 143 Back     alignment and structure
>3f09_A Holo-[acyl-carrier-protein] synthase; structural genomics, infectious deseases, cytoplasm, fatty acid biosynthesis, lipid synthesis; 1.82A {Staphylococcus aureus subsp} Length = 143 Back     alignment and structure
>2was_A 3-oxoacyl-[acyl-carrier-protein] synthase; COA, FAS, PPT, NAD, NADP, transferase, phosphoprotein, oxidoreductase, lipid synthesis; 1.90A {Saccharomyces cerevisiae} PDB: 2wat_A* 2was_B Length = 122 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>1qr0_A 4'-phosphopantetheinyl transferase SFP; protein-coenzyme A complex; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.150.1.1 d.150.1.1 Length = 228 Back     alignment and structure
>2c43_A Aminoadipate-semialdehyde dehydrogenase- phosphopantetheinyl transferase; fatty acid biosynthesis, phosphopantetheine transferase, coenzyme A; HET: COA; 1.93A {Homo sapiens} PDB: 2byd_A* 2cg5_A* Length = 323 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target132 4'-phosphopantetheinyl transferase [Candidatus Liberiba
3h88_A129 Holo-[acyl-carrier-protein] synthase; alpha-beta struct 100.0
2bdd_A182 ACP-synthase; structural genomics, structural genomics 100.0
2wds_A143 Holo-[acyl-carrier-protein] synthase; phosphopantethein 100.0
2qg8_A163 Acyl carrier protein synthase PY06285; malaria, 3'5'ADP 100.0
3hyk_A122 Holo-[acyl-carrier-protein] synthase; structural genomi 100.0
3ne9_A153 Phosphopantethiene protein transferase, PPT1P; acyl car 100.0
3f09_A143 Holo-[acyl-carrier-protein] synthase; structural genomi 100.0
1fth_A122 ACPS, acyl carrier protein synthase; bacterial fatty ac 100.0
1f7l_A121 Holo-(acyl carrier protein) synthase; 9-strand pseudo b 100.0
2was_A122 3-oxoacyl-[acyl-carrier-protein] synthase; COA, FAS, PP 100.0
3gwm_A129 Holo-[acyl-carrier-protein] synthase; HOMO-trimer, 9-st 100.0
2uv9_A1878 Fatty acid synthase alpha subunits; fungal, dehydratase 99.62
2uv8_A1887 Fatty acid synthase subunit alpha (FAS2); fatty acid bi 99.46
1qr0_A228 4'-phosphopantetheinyl transferase SFP; protein-coenzym 98.81
2c43_A323 Aminoadipate-semialdehyde dehydrogenase- phosphopanteth 98.67
2c43_A 323 Aminoadipate-semialdehyde dehydrogenase- phosphopanteth 98.18
1qr0_A 228 4'-phosphopantetheinyl transferase SFP; protein-coenzym 97.91
>2bdd_A ACP-synthase; structural genomics, structural genomics consortium, SGC, transferase; 2.28A {Plasmodium yoelii yoelii} Back     alignment and structure
>2wds_A Holo-[acyl-carrier-protein] synthase; phosphopantetheine ARM, fatty acid biosynthesis, lipid synthesis, transferase, polyketides; HET: COA; 1.35A {Streptomyces coelicolor} PDB: 2wdo_A* 2jca_A 2jbz_A* 2wdy_A* Back     alignment and structure
>2qg8_A Acyl carrier protein synthase PY06285; malaria, 3'5'ADP, SGC, structural genomics consortium, transferase; HET: A3P; 2.00A {Plasmodium yoelii yoelii} Back     alignment and structure
>3hyk_A Holo-[acyl-carrier-protein] synthase; structural genomics, infectious diseases, center for structural genomics of infectious diseases; HET: MSE A3P; 2.31A {Bacillus anthracis} Back     alignment and structure
>3ne9_A Phosphopantethiene protein transferase, PPT1P; acyl carrier protein synthase, acyl carrier protein, fatty A synthase, ACPS; 2.50A {Corynebacterium ammoniagenes} Back     alignment and structure
>3f09_A Holo-[acyl-carrier-protein] synthase; structural genomics, infectious deseases, cytoplasm, fatty acid biosynthesis, lipid synthesis; 1.82A {Staphylococcus aureus subsp} Back     alignment and structure
>1fth_A ACPS, acyl carrier protein synthase; bacterial fatty acid biosynthesis, acyl carrier synthase, coenzyme A, X-RAY crystallography; HET: A3P; 1.90A {Streptococcus pneumoniae} SCOP: d.150.1.2 PDB: 1fte_A 1ftf_A* Back     alignment and structure
>1f7l_A Holo-(acyl carrier protein) synthase; 9-strand pseudo beta barrel protein, COA complex protein, coenzyme A complex, transferase; HET: COA; 1.50A {Bacillus subtilis} SCOP: d.150.1.2 PDB: 1f7t_A 1f80_A* Back     alignment and structure
>2was_A 3-oxoacyl-[acyl-carrier-protein] synthase; COA, FAS, PPT, NAD, NADP, transferase, phosphoprotein, oxidoreductase, lipid synthesis; 1.90A {Saccharomyces cerevisiae} PDB: 2wat_A* 2was_B Back     alignment and structure
>3gwm_A Holo-[acyl-carrier-protein] synthase; HOMO-trimer, 9-stand pseudo beta barrel protein, cytoplasm, fatty acid biosynthesis; 1.70A {Mycobacterium smegmatis} PDB: 3h7q_A* 3ne3_B 3ne1_A 3hqj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>1qr0_A 4'-phosphopantetheinyl transferase SFP; protein-coenzyme A complex; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.150.1.1 d.150.1.1 Back     alignment and structure
>2c43_A Aminoadipate-semialdehyde dehydrogenase- phosphopantetheinyl transferase; fatty acid biosynthesis, phosphopantetheine transferase, coenzyme A; HET: COA; 1.93A {Homo sapiens} PDB: 2byd_A* 2cg5_A* Back     alignment and structure
>2c43_A Aminoadipate-semialdehyde dehydrogenase- phosphopantetheinyl transferase; fatty acid biosynthesis, phosphopantetheine transferase, coenzyme A; HET: COA; 1.93A {Homo sapiens} PDB: 2byd_A* 2cg5_A* Back     alignment and structure
>1qr0_A 4'-phosphopantetheinyl transferase SFP; protein-coenzyme A complex; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.150.1.1 d.150.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 132 4'-phosphopantetheinyl transferase [Candidatus Liberiba
d1f7la_118 d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACP 5e-22
d1ftha_117 d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACP 3e-21
d1qr0a2127 d.150.1.1 (A:102-228) 4'-Phosphopantetheinyl transferas 3e-11
>d1f7la_ d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis [TaxId: 1423]} Length = 118 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: 4'-phosphopantetheinyl transferase
superfamily: 4'-phosphopantetheinyl transferase
family: Holo-(acyl carrier protein) synthase ACPS
domain: Holo-(acyl carrier protein) synthase ACPS
species: Bacillus subtilis [TaxId: 1423]
 Score = 96.9 bits (241), Expect = 5e-22
 Identities = 46/129 (35%), Positives = 65/129 (50%), Gaps = 15/129 (11%)

Query: 2   IIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLS--CNRVASYAKRFAAKEAF 59
           I GIG DI  ++RI+ +     ++F  R  +  E D         +    A RFAAKEAF
Sbjct: 2   IYGIGLDITELKRIASMAGR-QKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAF 60

Query: 60  SKAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFP 119
           SKA GTGI + +S++DIE+     GKPYI  +  +               VH++I+    
Sbjct: 61  SKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLS------------PAAVHVSITHTKE 108

Query: 120 FAQAFVVIE 128
           +A A VVIE
Sbjct: 109 YAAAQVVIE 117


>d1ftha_ d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACPS {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 Back     information, alignment and structure
>d1qr0a2 d.150.1.1 (A:102-228) 4'-Phosphopantetheinyl transferase SFP {Bacillus subtilis [TaxId: 1423]} Length = 127 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target132 4'-phosphopantetheinyl transferase [Candidatus Liberiba
d1ftha_117 Holo-(acyl carrier protein) synthase ACPS {Streptococcu 100.0
d1f7la_118 Holo-(acyl carrier protein) synthase ACPS {Bacillus sub 100.0
d1qr0a2127 4'-Phosphopantetheinyl transferase SFP {Bacillus subtil 99.4
d1qr0a1101 4'-Phosphopantetheinyl transferase SFP {Bacillus subtil 97.87
>d1ftha_ d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACPS {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: 4'-phosphopantetheinyl transferase
superfamily: 4'-phosphopantetheinyl transferase
family: Holo-(acyl carrier protein) synthase ACPS
domain: Holo-(acyl carrier protein) synthase ACPS
species: Streptococcus pneumoniae [TaxId: 1313]
Probab=100.00  E-value=3.4e-42  Score=258.74  Aligned_cols=114  Identities=35%  Similarity=0.513  Sum_probs=104.5

Q ss_pred             CEEEEEEEEEEHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCC--CCCCCCCCEEEECCCEEEEECCCCCCCCCCCEEEE
Q ss_conf             9679976544589999999742276898751978899984036--87420011123121123464066789874310799
Q gi|254780938|r    1 MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSC--NRVASYAKRFAAKEAFSKAIGTGISKGVSWKDIEV   78 (132)
Q Consensus         1 MI~GIG~Div~i~Ri~~~l~~~~~~f~~ri~t~~E~~~~~~~~--~~~~~lAgrfAaKEA~~KAlg~g~~~~~~~~dIeI   78 (132)
                      ||+|||+|||+++||+++++++ ++|++|+||+.|+++|...+  ++.++||||||||||++||||+|++ +++|+||||
T Consensus         1 MI~GIG~Div~i~Ri~~~l~~~-~~f~~rift~~E~~~~~~~~~~~~~~~lA~rfAaKEA~~KAlg~g~~-~~~~~dIeI   78 (117)
T d1ftha_           1 MIVGHGIDIEELASIESAVTRH-EGFAKRVLTALEMERFTSLKGRRQIEYLAGRWSAKEAFSKAMGTGIS-KLGFQDLEV   78 (117)
T ss_dssp             CEEEEEEEEEEHHHHHHHHHTT-SSHHHHHSCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHTSCSS-SSCGGGCEE
T ss_pred             CCEEEEEEEEEHHHHHHHHHHC-HHHHHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCEEEE
T ss_conf             9139988776859999999877-67998628988988887431206899999989999999877634753-346636999


Q ss_pred             EECCCCCEEEEECHHHHHHHHHHCCCCCCEEEEEEEECCCCEEEEEEEEEE
Q ss_conf             988888749999758999999614677712899998717976899999873
Q gi|254780938|r   79 CHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPFAQAFVVIES  129 (132)
Q Consensus        79 ~~~~~G~P~i~l~~~~~~~~~~~~~~~~~~~i~iSiSHd~~~A~A~vIlE~  129 (132)
                      .++++|+|++.+.+.             ..++|||||||++||+|+||+|+
T Consensus        79 ~~~~~G~P~~~~~~~-------------~~~~~lSISH~~~~a~A~vi~e~  116 (117)
T d1ftha_          79 LNNERGAPYFSQAPF-------------SGKIWLSISHTDQFVTASVILEE  116 (117)
T ss_dssp             EECTTSCEEEEECSC-------------CSEEEEEEEECSSEEEEEEEEEC
T ss_pred             EECCCCCEEEEECCC-------------CCEEEEEEECCCCCEEEEEEEEE
T ss_conf             999999979997799-------------88899999689997999999975



>d1f7la_ d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qr0a2 d.150.1.1 (A:102-228) 4'-Phosphopantetheinyl transferase SFP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qr0a1 d.150.1.1 (A:1-101) 4'-Phosphopantetheinyl transferase SFP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 132 4'-phosphopantetheinyl transferase [Candidatus Lib
3h88_A_129 (A:) Holo-[acyl-carrier-protein] synthase; alpha-b 2e-32
3hqj_A_130 (A:) Holo-[acyl-carrier-protein] synthase; AN/fold 5e-32
2qg8_A_163 (A:) Acyl carrier protein synthase PY06285; malari 5e-29
2was_A_122 (A:) 3-oxoacyl-[acyl-carrier-protein] synthase; CO 2e-26
1fth_A_122 (A:) ACPS, acyl carrier protein synthase; bacteria 2e-25
3hyk_A_122 (A:) Holo-[acyl-carrier-protein] synthase; structu 1e-24
2bdd_A_182 (A:) ACP-synthase; structural genomics, structural 3e-23
2uv9_A_1684-1878195 (A:1684-1878) Fatty acid synthase alpha subunits; 3e-23
1f7l_A_121 (A:) Holo-(acyl carrier protein) synthase; 9-stran 6e-23
2jbz_A_143 (A:) Holo-[acyl-carrier-protein] synthase; ACP, ma 5e-22
3f09_A_143 (A:) Holo-[acyl-carrier-protein] synthase; structu 5e-21
2c43_A_323 (A:) Aminoadipate-semialdehyde dehydrogenase- phos 3e-15
1qr0_A_228 (A:) 4'-phosphopantetheinyl transferase SFP; prote 2e-10
>3hqj_A (A:) Holo-[acyl-carrier-protein] synthase; AN/fold, structural genomics, israel structural proteomics center, ISPC, cytoplasm; HET: COA; 1.95A {Mycobacterium tuberculosis}Length = 130 Back     alignment and structure
>2qg8_A (A:) Acyl carrier protein synthase PY06285; malaria, 3'5'ADP, SGC, structural genomics consortium, transferase; HET: A3P; 2.00A {Plasmodium yoelii yoelii}Length = 163 Back     alignment and structure
>2was_A (A:) 3-oxoacyl-[acyl-carrier-protein] synthase; COA, FAS, PPT, NAD, NADP, transferase, phosphoprotein, oxidoreductase, lipid synthesis; 1.90A {Saccharomyces cerevisiae} PDB: 2wat_A* 2was_BLength = 122 Back     alignment and structure
>1fth_A (A:) ACPS, acyl carrier protein synthase; bacterial fatty acid biosynthesis, acyl carrier synthase, coenzyme A, X-RAY crystallography; HET: A3P; 1.90A {Streptococcus pneumoniae}Length = 122 Back     alignment and structure
>3hyk_A (A:) Holo-[acyl-carrier-protein] synthase; structural genomics, infectious diseases, center for structural genomics of infectious diseases; HET: MSE A3P; 2.31A {Bacillus anthracis}Length = 122 Back     alignment and structure
>2bdd_A (A:) ACP-synthase; structural genomics, structural genomics consortium, SGC, transferase; 2.28A {Plasmodium yoelii yoelii}Length = 182 Back     alignment and structure
>2uv9_A (A:1684-1878) Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A*Length = 195 Back     alignment and structure
>1f7l_A (A:) Holo-(acyl carrier protein) synthase; 9-strand pseudo beta barrel protein, COA complex protein, coenzyme A complex, transferase; HET: COA; 1.50A {Bacillus subtilis}Length = 121 Back     alignment and structure
>2jbz_A (A:) Holo-[acyl-carrier-protein] synthase; ACP, magnesium, coenzyme A, transferase, poliketides, metal- binding, lipid synthesis; HET: COA; 1.62A {Streptomyces coelicolor} PDB: 2jca_ALength = 143 Back     alignment and structure
>3f09_A (A:) Holo-[acyl-carrier-protein] synthase; structural genomics, infectious deseases, cytoplasm, fatty acid biosynthesis, lipid synthesis; 1.82A {Staphylococcus aureus subsp}Length = 143 Back     alignment and structure
>2c43_A (A:) Aminoadipate-semialdehyde dehydrogenase- phosphopantetheinyl transferase; fatty acid biosynthesis, phosphopantetheine transferase, coenzyme A; HET: COA; 1.93A {Homo sapiens} PDB: 2byd_A* 2cg5_A*Length = 323 Back     alignment and structure
>1qr0_A (A:) 4'-phosphopantetheinyl transferase SFP; protein-coenzyme A complex; HET: COA; 1.90A {Bacillus subtilis}Length = 228 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target132 4'-phosphopantetheinyl transferase [Candidatus Liberiba
2qg8_A_163 Acyl carrier protein synthase PY06285; malaria, 3' 100.0
3hqj_A_130 Holo-[acyl-carrier-protein] synthase; AN/fold, str 100.0
3h88_A_129 Holo-[acyl-carrier-protein] synthase; alpha-beta s 100.0
2was_A_122 3-oxoacyl-[acyl-carrier-protein] synthase; COA, FA 100.0
2bdd_A_182 ACP-synthase; structural genomics, structural geno 99.97
3hyk_A_122 Holo-[acyl-carrier-protein] synthase; structural g 99.97
1f7l_A_121 Holo-(acyl carrier protein) synthase; 9-strand pse 99.97
1fth_A_122 ACPS, acyl carrier protein synthase; bacterial fat 99.97
3f09_A_143 Holo-[acyl-carrier-protein] synthase; structural g 99.95
2jbz_A_143 Holo-[acyl-carrier-protein] synthase; ACP, magnesi 99.95
2uv9_A_1684-1878195 Fatty acid synthase alpha subunits; fungal, dehydr 99.86
2c43_A_323 Aminoadipate-semialdehyde dehydrogenase- phosphopa 99.41
1qr0_A_228 4'-phosphopantetheinyl transferase SFP; protein-co 99.34
1qr0_A_ 228 4'-phosphopantetheinyl transferase SFP; protein-co 98.34
2c43_A_ 323 Aminoadipate-semialdehyde dehydrogenase- phosphopa 98.27
2uv9_A_1684-1878 195 Fatty acid synthase alpha subunits; fungal, dehydr 94.75
>2qg8_A (A:) Acyl carrier protein synthase PY06285; malaria, 3'5'ADP, SGC, structural genomics consortium, transferase; HET: A3P; 2.00A {Plasmodium yoelii yoelii} Back     alignment and structure
Probab=100.00  E-value=1.1e-42  Score=263.68  Aligned_cols=125  Identities=32%  Similarity=0.447  Sum_probs=115.5

Q ss_pred             CEEEEEEEEEEHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCC--------------CCCCCCEEEECCCEEEEECCC
Q ss_conf             967997654458999999974227689875197889998403687--------------420011123121123464066
Q gi|254780938|r    1 MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNR--------------VASYAKRFAAKEAFSKAIGTG   66 (132)
Q Consensus         1 MI~GIG~Div~i~Ri~~~l~~~~~~f~~ri~t~~E~~~~~~~~~~--------------~~~lAgrfAaKEA~~KAlg~g   66 (132)
                      ||+|||||||+++||+++++++ ++|++|+||+.|+.||..+.++              .++||||||||||++||||+|
T Consensus         4 mi~gIG~DIv~i~Ri~~~l~~~-~rf~~rilt~~E~~~~~~~~~~~~~~~~~~~~~~~~~~~lAgRwAaKEAv~KAlg~~   82 (163)
T 2qg8_A            4 HIIGIGTDILCVNRIYKILEKN-INFIKKVLNPFELAEFETQKKKLNEKINKSNELKKLAIYVSKKFAAKEAILKSMGRG   82 (163)
T ss_dssp             EEEEEEEEEEEHHHHHHHHHHC-GGGHHHHSCHHHHHHHHHTC-------CHHHHHHHHHHHHHHHHHHHHHHHHHTTCC
T ss_pred             EEEEEEEEEEEHHHHHHHHHHC-HHHHHHHCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             3999968603869999999868-438988589999999997312024444210001017899999999999999975104


Q ss_pred             CCC----CCCCCEEEEEECCCCCEEEEECHHHHHHHHHHCCCCCCEEEEEEEECCCCEEEEEEEEEEC
Q ss_conf             789----8743107999888887499997589999996146777128999987179768999998730
Q gi|254780938|r   67 ISK----GVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPFAQAFVVIESL  130 (132)
Q Consensus        67 ~~~----~~~~~dIeI~~~~~G~P~i~l~~~~~~~~~~~~~~~~~~~i~iSiSHd~~~A~A~vIlE~l  130 (132)
                      ++.    +++|+||||+++++|+|.+.|+|++++++++++..    .++||||||++||+|+||+|+-
T Consensus        83 ~~~~~~~~~~~~dIeI~~~~~G~P~v~l~g~~~~~~~~~~~~----~~~lSISHd~~yAvA~vi~e~~  146 (163)
T 2qg8_A           83 LSSISKYGLSMNDIEIKNDKYGKPHVYLYGKAKKVAYEMGIV----KIFLSISDEKIINSQTNNISSN  146 (163)
T ss_dssp             BC-----CBCGGGEEEEECTTSCEEEEECHHHHHHHHHTTCC----EEEEEEEEEEC-----------
T ss_pred             CCCCCCCCCCEEEEEEEECCCCCEEEEECHHHHHHHHHCCCC----EEEEEECCCCCCCCCCCCCCHH
T ss_conf             566677885403899998899982899898999999986998----4999722578531225541200



>3hqj_A (A:) Holo-[acyl-carrier-protein] synthase; AN/fold, structural genomics, israel structural proteomics center, ISPC, cytoplasm; HET: COA; 1.95A {Mycobacterium tuberculosis} Back     alignment and structure
>2was_A (A:) 3-oxoacyl-[acyl-carrier-protein] synthase; COA, FAS, PPT, NAD, NADP, transferase, phosphoprotein, oxidoreductase, lipid synthesis; 1.90A {Saccharomyces cerevisiae} PDB: 2wat_A* 2was_B Back     alignment and structure
>2bdd_A (A:) ACP-synthase; structural genomics, structural genomics consortium, SGC, transferase; 2.28A {Plasmodium yoelii yoelii} Back     alignment and structure
>3hyk_A (A:) Holo-[acyl-carrier-protein] synthase; structural genomics, infectious diseases, center for structural genomics of infectious diseases; HET: MSE A3P; 2.31A {Bacillus anthracis} Back     alignment and structure
>1f7l_A (A:) Holo-(acyl carrier protein) synthase; 9-strand pseudo beta barrel protein, COA complex protein, coenzyme A complex, transferase; HET: COA; 1.50A {Bacillus subtilis} Back     alignment and structure
>1fth_A (A:) ACPS, acyl carrier protein synthase; bacterial fatty acid biosynthesis, acyl carrier synthase, coenzyme A, X-RAY crystallography; HET: A3P; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>3f09_A (A:) Holo-[acyl-carrier-protein] synthase; structural genomics, infectious deseases, cytoplasm, fatty acid biosynthesis, lipid synthesis; 1.82A {Staphylococcus aureus subsp} Back     alignment and structure
>2jbz_A (A:) Holo-[acyl-carrier-protein] synthase; ACP, magnesium, coenzyme A, transferase, poliketides, metal- binding, lipid synthesis; HET: COA; 1.62A {Streptomyces coelicolor} PDB: 2jca_A Back     alignment and structure
>2uv9_A (A:1684-1878) Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2c43_A (A:) Aminoadipate-semialdehyde dehydrogenase- phosphopantetheinyl transferase; fatty acid biosynthesis, phosphopantetheine transferase, coenzyme A; HET: COA; 1.93A {Homo sapiens} PDB: 2byd_A* 2cg5_A* Back     alignment and structure
>1qr0_A (A:) 4'-phosphopantetheinyl transferase SFP; protein-coenzyme A complex; HET: COA; 1.90A {Bacillus subtilis} Back     alignment and structure
>1qr0_A (A:) 4'-phosphopantetheinyl transferase SFP; protein-coenzyme A complex; HET: COA; 1.90A {Bacillus subtilis} Back     alignment and structure
>2c43_A (A:) Aminoadipate-semialdehyde dehydrogenase- phosphopantetheinyl transferase; fatty acid biosynthesis, phosphopantetheine transferase, coenzyme A; HET: COA; 1.93A {Homo sapiens} PDB: 2byd_A* 2cg5_A* Back     alignment and structure
>2uv9_A (A:1684-1878) Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure