254780939

254780939

type I signal peptidase

GeneID in NCBI database:8209961Locus tag:CLIBASIA_04190
Protein GI in NCBI database:254780939Protein Accession:YP_003065352.1
Gene range:+(929121, 929867)Protein Length:248aa
Gene description:type I signal peptidase
COG prediction:[U] Signal peptidase I
KEGG prediction:lepB; type I signal peptidase; K03100 signal peptidase I [EC:3.4.21.89]
SEED prediction:Signal peptidase I (EC 3.4.21.89)
Pathway involved in KEGG:Protein export [PATH:las03060]
Subsystem involved in SEED:Signal peptidase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MWIAKKWTCSIFGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMRWDRLFKIL
cccccccccccHHHHHHHHHHHHHHHHHHHHHEEEEEEEEcccccccccccccEEEEEcccccccccccccccccccccccccccccccEEEEEcccccccEEEEEEEEccccEEEEEccEEEEccEEEEcccccccccccccccccccccEEEEcccccccccccccccccccccccEEEccccEEEEcccccccccccccccEEccHHHEEEEEEEEEEcccccccccccccccccccHHHccccc
cccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEccccEEEEEccccccccccEcccccccccEEEccccccccEEEEEccccccccEEEEEEcccccEEEEEccEEEEcccccccccccccccccccccccccEEEEEEccccEEEEccccccccccccccEEEEccccEEEEcccccccccccccccccccHHHcccEEEEEEEEccccccccccccccccccHHHccccc
mwiakkwtcsifgsdTLKSILQALFFAILIRTflfqpsvipsgsmiptllVGDYIIVNKfsygyskysfpfsynlfngrifnnqprrgdvvvfrypkdpsidyVKRViglpgdrislekgiiyingapvvrhmegyfsyhykedwssnvpifqeklsngvlynvlsqdflapssniseflvpkghyfmmgdnrdkskdsrwvevgfvpeenlvgRASFVLFsiggdtpfskVWLWIPNMRWDRLFKIL
mwiakkwtcsifgSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFrypkdpsidyvKRVIglpgdrislekgiiyinGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMRWDRLFKIL
MWIAKKWTCSIFGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMRWDRLFKIL
***********FGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMRWDRLFKIL
MWIAKKWTCSIFGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMRWDRLFKIL
MWIAKKWTCSIFGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMRWDRLFKIL
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWIAKKWTCSIFGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMRWDRLFKIL
MWIAKKWTCSIFGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMRWDRLFKIL
MWIAKKWTCSIFGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMRWDRLFKIL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target248 type I signal peptidase [Candidatus Liberibacter asiati
315122352247 type I signal peptidase [Candidatus Liberibacter solana 1 1e-108
15888376248 type I signal peptidase [Agrobacterium tumefaciens str. 1 3e-81
325292413248 type I signal peptidase [Agrobacterium sp. H13-3] Lengt 1 4e-81
209548600247 signal peptidase I [Rhizobium leguminosarum bv. trifoli 1 6e-79
218461556247 signal peptidase I [Rhizobium etli Kim 5] Length = 247 1 6e-79
86357027247 signal peptidase I protein [Rhizobium etli CFN 42] Leng 1 1e-78
241203888247 signal peptidase I [Rhizobium leguminosarum bv. trifoli 1 1e-78
190891072247 signal peptidase I protein [Rhizobium etli CIAT 652] Le 1 2e-78
116251276247 signal peptidase [Rhizobium leguminosarum bv. viciae 38 1 6e-78
222148080247 signal peptidase I [Agrobacterium vitis S4] Length = 24 1 3e-77
>gi|315122352|ref|YP_004062841.1| type I signal peptidase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 247 Back     alignment and organism information
 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/248 (77%), Positives = 215/248 (86%), Gaps = 1/248 (0%)

Query: 1   MWIAKKWTCSIFGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKF 60
           MWI KKW  SI  +D LKSILQAL  A+L RTFL QPSVIPSGSMIPTLLVGDYII+NKF
Sbjct: 1   MWIKKKWQSSILINDMLKSILQALLLAVLFRTFLIQPSVIPSGSMIPTLLVGDYIIINKF 60

Query: 61  SYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKG 120
           SYGYSKYSFPFS+NLF GRIF   P+RGDVVVFR+ KD S+DYVKRVIGLPGDRISL+K 
Sbjct: 61  SYGYSKYSFPFSFNLFKGRIFAGSPQRGDVVVFRFTKD-SVDYVKRVIGLPGDRISLKKS 119

Query: 121 IIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFL 180
           +IYIN  PV RH+EG FSYHYKEDW  ++P+F+E+LSNG+ Y VLSQ+  APSSNI +F 
Sbjct: 120 VIYINDVPVTRHLEGMFSYHYKEDWGHDIPLFREELSNGMSYKVLSQNSFAPSSNIPDFF 179

Query: 181 VPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMR 240
           VPKGHYFMMGDNRDKSKDSRW+EVGFVPEENL+GRAS VLFSIG + PFSK+WLWIPN+R
Sbjct: 180 VPKGHYFMMGDNRDKSKDSRWIEVGFVPEENLIGRASLVLFSIGDNIPFSKIWLWIPNIR 239

Query: 241 WDRLFKIL 248
           W+RL KIL
Sbjct: 240 WNRLCKIL 247


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15888376|ref|NP_354057.1| type I signal peptidase [Agrobacterium tumefaciens str. C58] Length = 248 Back     alignment and organism information
>gi|325292413|ref|YP_004278277.1| type I signal peptidase [Agrobacterium sp. H13-3] Length = 248 Back     alignment and organism information
>gi|209548600|ref|YP_002280517.1| signal peptidase I [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 247 Back     alignment and organism information
>gi|218461556|ref|ZP_03501647.1| signal peptidase I [Rhizobium etli Kim 5] Length = 247 Back     alignment and organism information
>gi|86357027|ref|YP_468919.1| signal peptidase I protein [Rhizobium etli CFN 42] Length = 247 Back     alignment and organism information
>gi|241203888|ref|YP_002974984.1| signal peptidase I [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 247 Back     alignment and organism information
>gi|190891072|ref|YP_001977614.1| signal peptidase I protein [Rhizobium etli CIAT 652] Length = 247 Back     alignment and organism information
>gi|116251276|ref|YP_767114.1| signal peptidase [Rhizobium leguminosarum bv. viciae 3841] Length = 247 Back     alignment and organism information
>gi|222148080|ref|YP_002549037.1| signal peptidase I [Agrobacterium vitis S4] Length = 247 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target248 type I signal peptidase [Candidatus Liberibacter asiati
PRK10861324 PRK10861, PRK10861, signal peptidase I; Provisional 9e-43
TIGR02227163 TIGR02227, sigpep_I_bact, signal peptidase I, bacterial 1e-40
KOG0171176 KOG0171, KOG0171, KOG0171, Mitochondrial inner membrane 1e-14
COG0681166 COG0681, LepB, Signal peptidase I [Intracellular traffi 9e-12
pfam0071767 pfam00717, Peptidase_S24, Peptidase S24-like 4e-11
cd0646284 cd06462, Peptidase_S24_S26, The S24, S26 LexA/signal pe 9e-10
KOG1568174 KOG1568, KOG1568, KOG1568, Mitochondrial inner membrane 1e-04
cd0652981 cd06529, S24_LexA-like, Peptidase S24 LexA-like protein 0.001
cd0653085 cd06530, S26_SPase_I, The S26 Type I signal peptidase ( 3e-15
cd0653085 cd06530, S26_SPase_I, The S26 Type I signal peptidase ( 6e-06
pfam10502138 pfam10502, Peptidase_S26, Peptidase S26 6e-06
TIGR02771171 TIGR02771, TraF_Ti, conjugative transfer signal peptida 3e-04
>gnl|CDD|182787 PRK10861, PRK10861, signal peptidase I; Provisional Back     alignment and domain information
>gnl|CDD|162773 TIGR02227, sigpep_I_bact, signal peptidase I, bacterial type Back     alignment and domain information
>gnl|CDD|35392 KOG0171, KOG0171, KOG0171, Mitochondrial inner membrane protease, subunit IMP1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31025 COG0681, LepB, Signal peptidase I [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|144350 pfam00717, Peptidase_S24, Peptidase S24-like Back     alignment and domain information
>gnl|CDD|119396 cd06462, Peptidase_S24_S26, The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families Back     alignment and domain information
>gnl|CDD|36781 KOG1568, KOG1568, KOG1568, Mitochondrial inner membrane protease, subunit IMP2 [Posttranslational modification, protein turnover, chaperones, Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|119397 cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell Back     alignment and domain information
>gnl|CDD|119398 cd06530, S26_SPase_I, The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3 Back     alignment and domain information
>gnl|CDD|119398 cd06530, S26_SPase_I, The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3 Back     alignment and domain information
>gnl|CDD|151062 pfam10502, Peptidase_S26, Peptidase S26 Back     alignment and domain information
>gnl|CDD|131818 TIGR02771, TraF_Ti, conjugative transfer signal peptidase TraF Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 248 type I signal peptidase [Candidatus Liberibacter asiati
PRK10861324 lsignal peptidase I; Provisional 100.0
TIGR02227203 sigpep_I_bact signal peptidase I; InterPro: IPR000223 P 100.0
KOG0171176 consensus 99.97
KOG1568174 consensus 99.89
pfam10502138 Peptidase_S26 Peptidase S26. This is a family of serine 99.96
PRK13884178 conjugal transfer peptidase TraF; Provisional 99.81
TIGR02771183 TraF_Ti conjugative transfer signal peptidase TraF; Int 99.73
PRK13838176 conjugal transfer pilin processing protease TraF; Provi 99.67
COG4959173 TraF Type IV secretory pathway, protease TraF [Posttran 99.31
cd0653085 S26_SPase_I The S26 Type I signal peptidase (SPase; Lep 99.91
TIGR0275490 sod_Ni_protease nickel-type superoxide dismutase matura 99.61
cd0646284 Peptidase_S24_S26 The S24, S26 LexA/signal peptidase su 99.08
COG0681166 LepB Signal peptidase I [Intracellular trafficking and 99.8
TIGR02228175 sigpep_I_arch signal peptidase I; InterPro: IPR001733 P 98.96
pfam0071767 Peptidase_S24 Peptidase S24-like. 98.74
COG2932214 Predicted transcriptional regulator [Transcription] 98.04
cd0652981 S24_LexA-like Peptidase S24 LexA-like proteins are invo 97.82
KOG3342180 consensus 97.36
PRK00215204 LexA repressor; Validated 96.74
PRK10276139 DNA polymerase V subunit UmuD; Provisional 96.24
PHA00361165 cI Repressor 96.2
PRK12423202 LexA repressor; Provisional 95.47
COG1974201 LexA SOS-response transcriptional repressors (RecA-medi 92.56
COG0681166 LepB Signal peptidase I [Intracellular trafficking and 96.27
>PRK10861 lsignal peptidase I; Provisional Back     alignment and domain information
>TIGR02227 sigpep_I_bact signal peptidase I; InterPro: IPR000223 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>KOG0171 consensus Back     alignment and domain information
>KOG1568 consensus Back     alignment and domain information
>pfam10502 Peptidase_S26 Peptidase S26 Back     alignment and domain information
>PRK13884 conjugal transfer peptidase TraF; Provisional Back     alignment and domain information
>TIGR02771 TraF_Ti conjugative transfer signal peptidase TraF; InterPro: IPR014139 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>PRK13838 conjugal transfer pilin processing protease TraF; Provisional Back     alignment and domain information
>COG4959 TraF Type IV secretory pathway, protease TraF [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>cd06530 S26_SPase_I The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3 Back     alignment and domain information
>TIGR02754 sod_Ni_protease nickel-type superoxide dismutase maturation protease; InterPro: IPR014124 Members of this protein family are predicted proteases that are encoded adjacent to the genes for a nickel-type superoxide dismutase (IPR014123 from INTERPRO) Back     alignment and domain information
>cd06462 Peptidase_S24_S26 The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families Back     alignment and domain information
>COG0681 LepB Signal peptidase I [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02228 sigpep_I_arch signal peptidase I; InterPro: IPR001733 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>pfam00717 Peptidase_S24 Peptidase S24-like Back     alignment and domain information
>COG2932 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>cd06529 S24_LexA-like Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell Back     alignment and domain information
>KOG3342 consensus Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>PRK10276 DNA polymerase V subunit UmuD; Provisional Back     alignment and domain information
>PHA00361 cI Repressor Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>COG1974 LexA SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG0681 LepB Signal peptidase I [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target248 type I signal peptidase [Candidatus Liberibacter asiati
1t7d_A250 Crystal Structure Of Escherichia Coli Type I Signal 1e-38
1b12_A248 Crystal Structure Of Type 1 Signal Peptidase From E 3e-38
1kn9_A249 Crystal Structure Of A Bacterial Signal Peptidase A 3e-38
>gi|51247604|pdb|1T7D|A Chain A, Crystal Structure Of Escherichia Coli Type I Signal Peptidase In Complex With A Lipopeptide Inhibitor Length = 250 Back     alignment and structure
 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 80/260 (30%), Positives = 126/260 (48%), Gaps = 55/260 (21%)

Query: 28  ILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRR 87
           +++R+F+++P  IPSGSM+PTLL+GD+I+V KF+YG     +  +       I    P+R
Sbjct: 1   MIVRSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTL------IETGHPKR 54

Query: 88  GDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRHME------------- 134
           GD+VVF+YP+DP +DY+KR +GLPGD+++ +     +   P     +             
Sbjct: 55  GDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNV 114

Query: 135 -------------------GYFSYHYKEDWSSNVPIFQEKLSNG----------VLYNVL 165
                              G+F     E   + + + + K + G          +  + +
Sbjct: 115 EPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQV 174

Query: 166 SQDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGG 225
              +  P   ++ ++VP G YFMMGDNRD S DSR+   GFVPE NLVGRA+ +  S   
Sbjct: 175 GMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRY--WGFVPEANLVGRATAIWMSFDK 232

Query: 226 DTPFSKVWLWIPNMRWDRLF 245
                    W   +R  R+ 
Sbjct: 233 QEG-----EWPTGLRLSRIG 247


>gi|6730070|pdb|1B12|A Chain A, Crystal Structure Of Type 1 Signal Peptidase From Escherichia Coli In Complex With A Beta-Lactam Inhibitor Length = 248 Back     alignment and structure
>gi|18655553|pdb|1KN9|A Chain A, Crystal Structure Of A Bacterial Signal Peptidase Apo- Enzyme, Implications For Signal Peptide Binding And The Ser-Lys Dyad Mechanism. Length = 249 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target248 type I signal peptidase [Candidatus Liberibacter asiati
1b12_A248 Signal peptidase I; serine proteinase, serine-dependant 5e-37
>1b12_A Signal peptidase I; serine proteinase, serine-dependant hydrolase, signal peptide processing, protein translocation, membrane bound proteinase; HET: 1PN; 1.95A {Escherichia coli} SCOP: b.87.1.2 PDB: 1t7d_A* 1kn9_A Length = 248 Back     alignment and structure
 Score =  149 bits (377), Expect = 5e-37
 Identities = 84/260 (32%), Positives = 127/260 (48%), Gaps = 55/260 (21%)

Query: 30  IRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGD 89
           +R+F+++P  IPSGSM+PTLL+GD+I+V KF+YG     +  +       I    P+RGD
Sbjct: 1   VRSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKT------LIETGHPKRGD 54

Query: 90  VVVFRYPKDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRH----------------- 132
           +VVF+YP+DP +DY+KR +GLPGD+++ +     +   P                     
Sbjct: 55  IVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEP 114

Query: 133 ---------------MEGYFSYHYKEDWSSNVPIFQEKLSNG-----VLYNVLSQDFLA- 171
                            G+F     E   + + + + K + G     +L   ++QD +  
Sbjct: 115 SDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGM 174

Query: 172 ----PSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDT 227
               P   ++ ++VP G YFMMGDNRD S DSR+   GFVPE NLVGRA+ +  S     
Sbjct: 175 YYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRY--WGFVPEANLVGRATAIWMSFDKQE 232

Query: 228 PFSKVWLWIPNMRWDRLFKI 247
                  W   +R  R+  I
Sbjct: 233 -----GEWPTGLRLSRIGGI 247


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target248 type I signal peptidase [Candidatus Liberibacter asiati
1b12_A248 Signal peptidase I; serine proteinase, serine-dependant 100.0
1jhf_A202 LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {E 97.12
2hnf_A133 Repressor protein CI101-229DM-K192A; viral protein; 1.8 97.01
1kca_A109 Repressor protein CI; gene regulation, DNA-binding, lam 96.95
3k2z_A196 LEXA repressor; winged helix-turn-helix, SOS system, au 96.92
1umu_A116 UMUD'; induced mutagenesis, SOS mutagenesis, DNA repair 96.81
3bdn_A236 Lambda repressor; repressor, allostery; HET: DNA; 3.91A 96.16
2fjr_A189 Repressor protein CI; genetic switch, regulation, coope 95.18
>1b12_A Signal peptidase I; serine proteinase, serine-dependant hydrolase, signal peptide processing, protein translocation; HET: 1PN; 1.95A {Escherichia coli BL21} SCOP: b.87.1.2 PDB: 1t7d_A* 3iiq_A* 1kn9_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=387.68  Aligned_cols=204  Identities=39%  Similarity=0.723  Sum_probs=148.1

Q ss_pred             HHHEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCHHHEEEEEEE
Q ss_conf             87516898998786677643369889998400587664122115422221125553347046640144200310000003
Q gi|254780939|r   30 IRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIG  109 (248)
Q Consensus        30 ir~fv~~~f~Ips~SM~PTL~~GD~i~VnK~~YG~~~~~~p~~~~~~~~~i~~~~p~RGDIVVF~~P~d~~~~yVKRvIG  109 (248)
                      ||+|++|+|+|||+||+|||+.||+|||||++||+|.|.....      .+....|+|||||||++|.+++..|||||||
T Consensus         1 Ir~fv~~~f~IPs~SMePTL~~GD~l~V~K~~Yg~r~P~~~~~------i~~~~~~~~gdivvf~~p~~~~~~~vKR~ig   74 (248)
T 1b12_A            1 VRSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKT------LIETGHPKRGDIVVFKYPEDPKLDYIKRAVG   74 (248)
T ss_dssp             -CBCCEEEEECCSCTTTTTSCTTEEEEEEESEEEEECGGGSCE------EEEECCCCTTCEEEEECTTCTTSEEEEEEEE
T ss_pred             CEEEEEEEEEECCCCCHHHHCCCCEEEEEECCCCCCCCCCCCE------EEECCCCCCCCEEEECCCCCCCCCEEECCCC
T ss_conf             9499999689286036203206999999934258677875866------4004898528999986788888652223567


Q ss_pred             ECHHHEEECCC--CEEECCCCCCCCCCCCCEEEC-----------------CCC---------------CCEEEEEECCC
Q ss_conf             04234320077--324535312245446400221-----------------478---------------62012210221
Q gi|254780939|r  110 LPGDRISLEKG--IIYINGAPVVRHMEGYFSYHY-----------------KED---------------WSSNVPIFQEK  155 (248)
Q Consensus       110 lPGDtV~i~~~--~l~INg~~i~~~~~~~~~~~~-----------------~~~---------------~~~~~~~~~e~  155 (248)
                      +|||+|++++.  .+++|+...............                 ...               .........|+
T Consensus        75 ~pGD~i~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  154 (248)
T 1b12_A           75 LPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKET  154 (248)
T ss_dssp             CTTCEEEEETTTTEEEEETTCCSSCCCCCCCCEEECCCEEEEEEEEEECGGGSCEEEEEEECCTTCCCTTEEEEEEEEEE
T ss_pred             CCCCEEEEECCCCEEEECCCCCCCEEEECCEEEECCCCCCCHHHHEECCCCCCCCCCCEEECCCCCCCCCCEEEEEEEEC
T ss_conf             89877787446531786225556636523255202434741211000002676124530431455435575683023321


Q ss_pred             CCCCCCCCEE---------ECCCCCCCCCCCEEECCCCEEEEEECCCCCCCCCCCCCCCCCCHHHEEEEEEEEEEECCCC
Q ss_conf             4678500022---------1245578874530232446499971788777644536530260888253389999743788
Q gi|254780939|r  156 LSNGVLYNVL---------SQDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGD  226 (248)
Q Consensus       156 l~~~~~~~~~---------~~~~~~~~~~~~~~~VP~g~yfvlGDNRdnS~DSR~~~~G~Vp~~~IvGka~~i~~S~d~~  226 (248)
                      +++ ..+..+         ......+.++.++++||+||||||||||+||+||||  ||+||+++|+|||+++|||+|..
T Consensus       155 ~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Vp~~~yfvmGDNR~nS~DSR~--~G~Vp~~~I~Gka~~i~~p~~~~  231 (248)
T 1b12_A          155 LGD-VTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRY--WGFVPEANLVGRATAIWMSFDKQ  231 (248)
T ss_dssp             ETT-EEEEEEECTTCCCCGGGSCCCTTCCTTEEECCTTEEEEECSBTTSCCCHHH--HCCEEGGGEEEEEEEEEEEBC--
T ss_pred             CCC-CEEEEEECCCCCCCCCCCCCCCCCCCCEEEECCCEEEEECCCCCCCCCCCC--CCCCCHHHEEEEEEEEEEECCCC
T ss_conf             587-202566414420011100037765452089628849997179886640155--57776899588889999988887


Q ss_pred             CCCCCCCCCCCCCCHHHCCCC
Q ss_conf             775435554567013342232
Q gi|254780939|r  227 TPFSKVWLWIPNMRWDRLFKI  247 (248)
Q Consensus       227 ~~~~~~~~~~~~iRw~R~f~~  247 (248)
                      ..     .|+.++||+||++.
T Consensus       232 ~~-----~~~~~~R~~Rig~i  247 (248)
T 1b12_A          232 EG-----EWPTGLRLSRIGGI  247 (248)
T ss_dssp             -----------CBCGGGCBCC
T ss_pred             CC-----CCCCCCCCCCCCCC
T ss_conf             68-----68777663016127



>1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 1jhc_A 1jhe_A 1lea_A 1leb_A Back     alignment and structure
>2hnf_A Repressor protein CI101-229DM-K192A; viral protein; 1.80A {Escherichia coli} PDB: 2ho0_A 1f39_A Back     alignment and structure
>1kca_A Repressor protein CI; gene regulation, DNA-binding, lambda repressor, protein oligomerization, DNA-looping; 2.91A {Enterobacteria phage lambda} SCOP: b.87.1.1 Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>1umu_A UMUD'; induced mutagenesis, SOS mutagenesis, DNA repair, beta- lactamase cleavage reaction, LEXA repressor, lambda CI; 2.50A {Escherichia coli} SCOP: b.87.1.1 PDB: 1i4v_A 1ay9_A Back     alignment and structure
>3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Back     alignment and structure
>2fjr_A Repressor protein CI; genetic switch, regulation, cooperativity, transcription regulator; 1.95A {Enterobacteria phage 186} PDB: 2fkd_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 248 type I signal peptidase [Candidatus Liberibacter asiati
d1b12a_247 b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli 4e-38
>d1b12a_ b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure

class: All beta proteins
fold: LexA/Signal peptidase
superfamily: LexA/Signal peptidase
family: Type 1 signal peptidase
domain: Type 1 signal peptidase
species: Escherichia coli [TaxId: 562]
 Score =  152 bits (383), Expect = 4e-38
 Identities = 84/259 (32%), Positives = 126/259 (48%), Gaps = 55/259 (21%)

Query: 31  RTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDV 90
           R+F+++P  IPSGSM+PTLL+GD+I+V KF+YG     +  +       I    P+RGD+
Sbjct: 1   RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKT------LIETGHPKRGDI 54

Query: 91  VVFRYPKDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRH------------------ 132
           VVF+YP+DP +DY+KR +GLPGD+++ +     +   P                      
Sbjct: 55  VVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPS 114

Query: 133 --------------MEGYFSYHYKEDWSSNVPIFQEKLSNG-----VLYNVLSQDFLA-- 171
                           G+F     E   + + + + K + G     +L   ++QD +   
Sbjct: 115 DFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMY 174

Query: 172 ---PSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTP 228
              P   ++ ++VP G YFMMGDNRD S DSR+   GFVPE NLVGRA+ +  S      
Sbjct: 175 YQQPGQQLATWIVPPGQYFMMGDNRDNSADSRY--WGFVPEANLVGRATAIWMSFDKQE- 231

Query: 229 FSKVWLWIPNMRWDRLFKI 247
                 W   +R  R+  I
Sbjct: 232 ----GEWPTGLRLSRIGGI 246


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target248 type I signal peptidase [Candidatus Liberibacter asiati
d1b12a_247 Type 1 signal peptidase {Escherichia coli [TaxId: 562]} 100.0
d1jhfa2126 LexA C-terminal domain {Escherichia coli [TaxId: 562]} 97.34
d1f39a_101 lambda repressor C-terminal domain {Bacteriophage lambd 97.21
d1umua_105 UmuD' {Escherichia coli [TaxId: 562]} 96.96
>d1b12a_ b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: LexA/Signal peptidase
superfamily: LexA/Signal peptidase
family: Type 1 signal peptidase
domain: Type 1 signal peptidase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=386.62  Aligned_cols=203  Identities=40%  Similarity=0.754  Sum_probs=150.3

Q ss_pred             HHEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCHHHEEEEEEEE
Q ss_conf             75168989987866776433698899984005876641221154222211255533470466401442003100000030
Q gi|254780939|r   31 RTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGL  110 (248)
Q Consensus        31 r~fv~~~f~Ips~SM~PTL~~GD~i~VnK~~YG~~~~~~p~~~~~~~~~i~~~~p~RGDIVVF~~P~d~~~~yVKRvIGl  110 (248)
                      |+|++|+|+|||+||||||+.||+|||||++||+|.|....      ..+..+.|+|||||||++|.+++..|||||+|+
T Consensus         1 R~f~~~~f~IPs~SMePTL~~GD~l~V~K~~Yg~r~P~~~~------~~~~~~~~~rgdivvf~~p~~~~~~~ikR~ig~   74 (247)
T d1b12a_           1 RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQK------TLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGL   74 (247)
T ss_dssp             CBCCEEEEECCSCTTTTTSCTTEEEEEEESEEEEECGGGSC------EEEEECCCCTTCEEEEECTTCTTSEEEEEEEEC
T ss_pred             CEEEEEEEEECCCCCCCHHCCCCEEEEECCCCCCCCCCCCC------CCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCC
T ss_conf             97999989938602601121698899992656766776585------002246864472555368888875431024478


Q ss_pred             CHHHEEECCCCEEECCCCCCCCCCCCCE---EECC-------------------------------CCCCEEEEEECCCC
Q ss_conf             4234320077324535312245446400---2214-------------------------------78620122102214
Q gi|254780939|r  111 PGDRISLEKGIIYINGAPVVRHMEGYFS---YHYK-------------------------------EDWSSNVPIFQEKL  156 (248)
Q Consensus       111 PGDtV~i~~~~l~INg~~i~~~~~~~~~---~~~~-------------------------------~~~~~~~~~~~e~l  156 (248)
                      |||+|++.+...++|.++..........   ....                               .........+.|++
T Consensus        75 pGD~i~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  154 (247)
T d1b12a_          75 PGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETL  154 (247)
T ss_dssp             TTCEEEEETTTTEEEEETTCCSSCCCCCCCCEEECCCEEEEEEEEEECGGGSCEEEEEEECCTTCCCTTEEEEEEEEEEE
T ss_pred             CCCEEEEECCCCEEEECCCCCCCCEEECCEEECCCCCCCCCCEEEEEECCCCEECCCEEECCCCCCCCCCEEEEEEEECC
T ss_conf             88768973265147751355555044232551124347430000231016862035325414654355755830123305


Q ss_pred             CCCCCCCEEE---------CCCCCCCCCCCEEECCCCEEEEEECCCCCCCCCCCCCCCCCCHHHEEEEEEEEEEECCCCC
Q ss_conf             6785000221---------2455788745302324464999717887776445365302608882533899997437887
Q gi|254780939|r  157 SNGVLYNVLS---------QDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDT  227 (248)
Q Consensus       157 ~~~~~~~~~~---------~~~~~~~~~~~~~~VP~g~yfvlGDNRdnS~DSR~~~~G~Vp~~~IvGka~~i~~S~d~~~  227 (248)
                      ++ ..+.++.         .......++.++++||+||||||||||+||+||||  ||+||+++|+|||++||||+++..
T Consensus       155 ~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Vp~~~yfvmGDNR~nS~DSR~--wG~Vp~~~I~Gka~~i~~p~~~~~  231 (247)
T d1b12a_         155 GD-VTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRY--WGFVPEANLVGRATAIWMSFDKQE  231 (247)
T ss_dssp             TT-EEEEEEECTTCCCCGGGSCCCTTCCTTEEECCTTEEEEECSBTTSCCCHHH--HCCEEGGGEEEEEEEEEEEBC---
T ss_pred             CC-CCEEEEECCCCHHCCCCCCCCCCCCCCEEEEECCEEEEECCCCCCCCCCCC--CCCCCHHHEEEEEEEEEEECCCCC
T ss_conf             88-302677524530001200047865252089717749995478777751254--576778995899999998788876


Q ss_pred             CCCCCCCCCCCCCHHHCCCC
Q ss_conf             75435554567013342232
Q gi|254780939|r  228 PFSKVWLWIPNMRWDRLFKI  247 (248)
Q Consensus       228 ~~~~~~~~~~~iRw~R~f~~  247 (248)
                      .     .|++++||+||++.
T Consensus       232 ~-----~~~~~~r~~Rig~~  246 (247)
T d1b12a_         232 G-----EWPTGLRLSRIGGI  246 (247)
T ss_dssp             ----------CBCGGGCBCC
T ss_pred             C-----CCCCCCCCCCCCCC
T ss_conf             7-----57677641236047



>d1jhfa2 b.87.1.1 (A:73-198) LexA C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f39a_ b.87.1.1 (A:) lambda repressor C-terminal domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1umua_ b.87.1.1 (A:) UmuD' {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 248 type I signal peptidase [Candidatus Liberibacter a
1b12_A_72-99_175-21569 (A:72-99,A:175-215) Signal peptidase I; serine pro 1e-09
1b12_A_1-71_216-248104 (A:1-71,A:216-248) Signal peptidase I; serine prot 2e-09
>1b12_A (A:72-99,A:175-215) Signal peptidase I; serine proteinase, serine-dependant hydrolase, signal peptide processing, protein translocation, membrane bound proteinase; HET: 1PN; 1.95A {Escherichia coli}Length = 69 Back     alignment and structure
 Score = 58.3 bits (141), Expect = 1e-09
 Identities = 30/103 (29%), Positives = 43/103 (41%), Gaps = 35/103 (33%)

Query: 107 VIGLPGDRISLEKGIIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLS 166
            +GLPGD+++ +         PV + +                                 
Sbjct: 1   AVGLPGDKVTYD---------PVSKELTIQPGCSS------------------------G 27

Query: 167 QDFLAPSSNISEFLVPKGHYFMMGDNRDKSKDSRWVEVGFVPE 209
           Q +  P   ++ ++VP G YFMMGDNRD S DSR+   GFVPE
Sbjct: 28  QYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRY--WGFVPE 68


>1b12_A (A:1-71,A:216-248) Signal peptidase I; serine proteinase, serine-dependant hydrolase, signal peptide processing, protein translocation, membrane bound proteinase; HET: 1PN; 1.95A {Escherichia coli}Length = 104 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target248 type I signal peptidase [Candidatus Liberibacter asiati
1b12_A_1-71_216-248104 Signal peptidase I; serine proteinase, serine-depe 99.83
1b12_A_72-99_175-21569 Signal peptidase I; serine proteinase, serine-depe 99.66
2fjr_A_71-189119 Repressor protein CI; genetic switch, regulation, 97.74
1umu_A_116 UMUD'; induced mutagenesis, SOS mutagenesis, DNA r 97.67
1kca_A_109 Repressor protein CI; gene regulation, DNA-binding 96.76
2hnf_A_133 Repressor protein CI101-229DM-K192A; viral protein 96.71
3bdn_A_100-236137 Lambda repressor; repressor, allostery; HET: DNA; 96.63
1jhf_A_73-202130 LEXA repressor; LEXA SOS repressor, hydrolase; 1.8 96.52
>1b12_A (A:1-71,A:216-248) Signal peptidase I; serine proteinase, serine-dependant hydrolase, signal peptide processing, protein translocation, membrane bound proteinase; HET: 1PN; 1.95A {Escherichia coli} Back     alignment and structure
Probab=99.83  E-value=1.3e-20  Score=149.16  Aligned_cols=103  Identities=45%  Similarity=0.883  Sum_probs=85.9

Q ss_pred             HHHEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCHHHEEEEEEE
Q ss_conf             87516898998786677643369889998400587664122115422221125553347046640144200310000003
Q gi|254780939|r   30 IRTFLFQPSVIPSGSMIPTLLVGDYIIVNKFSYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIG  109 (248)
Q Consensus        30 ir~fv~~~f~Ips~SM~PTL~~GD~i~VnK~~YG~~~~~~p~~~~~~~~~i~~~~p~RGDIVVF~~P~d~~~~yVKRvIG  109 (248)
                      +++|++|+|.|||+|||+||+.||+|+|+|++||.|.|..|.+.++..      .++.+++++..+...++..|+|    
T Consensus         1 v~~~~~q~~~ipsssleksll~gd~l~vsk~~yg~~~PmTpltlPltg------Hkti~~~~~~SY~r~PqL~YvK----   70 (104)
T 1b12_A            1 VRSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETG------HPKRGDIVVFKYPEDPKLDYIK----   70 (104)
T ss_dssp             -CBCCEEEEECCSCTTTTTSCTTEEEEEEESEEEEECGGGSCEEEEEC------CCCTTCEEEEECTTCTTSEEEE----
T ss_pred             CEEEEEEEEEECCCCCHHHHHCCCEEEEEECCCCCCCCCCCCEEECCC------CCCCCCEEEEECCCCCCCCEEE----
T ss_conf             929999959917602611340699899993746866776585540145------5534635665024688642100----


Q ss_pred             ECHHHEEECCCCEEECCCCCCCCCCCCCEEECCCCCCEEEEEECCCCCCCCCCCEEECCCCCCCCCCCEEECCCCEEEEE
Q ss_conf             04234320077324535312245446400221478620122102214678500022124557887453023244649997
Q gi|254780939|r  110 LPGDRISLEKGIIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFLVPKGHYFMM  189 (248)
Q Consensus       110 lPGDtV~i~~~~l~INg~~i~~~~~~~~~~~~~~~~~~~~~~~~e~l~~~~~~~~~~~~~~~~~~~~~~~~VP~g~yfvl  189 (248)
                                                                                                      
T Consensus        71 --------------------------------------------------------------------------------   70 (104)
T 1b12_A           71 --------------------------------------------------------------------------------   70 (104)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
T ss_conf             --------------------------------------------------------------------------------


Q ss_pred             ECCCCCCCCCCCCCCCCCCHHHEEEEEEEEEEECCCCCCCCCCCCCCCCCCHHHCCCC
Q ss_conf             1788777644536530260888253389999743788775435554567013342232
Q gi|254780939|r  190 GDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMRWDRLFKI  247 (248)
Q Consensus       190 GDNRdnS~DSR~~~~G~Vp~~~IvGka~~i~~S~d~~~~~~~~~~~~~~iRw~R~f~~  247 (248)
                                          .|++|||.+||+|++.+..     +|+.++|.+|+++.
T Consensus        71 --------------------R~~~g~~~~iw~~~~~~~~-----~wp~g~~~~rig~i  103 (104)
T 1b12_A           71 --------------------RNLVGRATAIWMSFDKQEG-----EWPTGLRLSRIGGI  103 (104)
T ss_dssp             --------------------EGEEEEEEEEEEEBC-------------CBCGGGCBCC
T ss_pred             --------------------CHEEEEEEEEEEECCCCCC-----CCCCCCCCCCCCCC
T ss_conf             --------------------2948888999997888767-----57677631136037



>1b12_A (A:72-99,A:175-215) Signal peptidase I; serine proteinase, serine-dependant hydrolase, signal peptide processing, protein translocation, membrane bound proteinase; HET: 1PN; 1.95A {Escherichia coli} Back     alignment and structure
>2fjr_A (A:71-189) Repressor protein CI; genetic switch, regulation, cooperativity, transcription regulator; 1.95A {Enterobacteria phage 186} PDB: 2fkd_A Back     alignment and structure
>1umu_A (A:) UMUD'; induced mutagenesis, SOS mutagenesis, DNA repair, beta- lactamase cleavage reaction, LEXA repressor, lambda CI; 2.50A {Escherichia coli} Back     alignment and structure
>1kca_A (A:) Repressor protein CI; gene regulation, DNA-binding, lambda repressor, protein oligomerization, DNA-looping; 2.91A {Enterobacteria phage lambda} Back     alignment and structure
>2hnf_A (A:) Repressor protein CI101-229DM-K192A; viral protein; 1.80A {Escherichia coli} PDB: 2ho0_A 1f39_A Back     alignment and structure
>3bdn_A (A:100-236) Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Back     alignment and structure
>1jhf_A (A:73-202) LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} Back     alignment and structure