254780947

254780947

transcription-repair coupling factor

GeneID in NCBI database:8209969Locus tag:CLIBASIA_04230
Protein GI in NCBI database:254780947Protein Accession:YP_003065360.1
Gene range:+(938109, 941672)Protein Length:1187aa
Gene description:transcription-repair coupling factor
COG prediction:[L] [K] Transcription-repair coupling factor (superfamily II helicase)
KEGG prediction:mdf; transcription-repair coupling factor; K03723 transcription-repair coupling factor (superfamily II helicase) [EC:3.6.1.-]
SEED prediction:Transcription-repair coupling factor
Pathway involved in KEGG:Nucleotide excision repair [PATH:las03420]
Subsystem involved in SEED:Cell division-ribosomal stress proteins cluster;
DNA-replication;
Transcription factors bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------119
MIFGSDIERISEKYCKKITLSPVIDGTEGFILAEIARLGLSLVYICSDERILINLKKILTLVVPDIRVIIFPAWDCLPYDRVSPSPYVVTRRLSCISNLVSFNSSKETIIVLTTVSAVMCRSVNIMSIKDYKLSIQSKDQIDMAKVIEKLETNGFQRVNAVYKVGEYAVRGGILDVYEPTKKYPVRLDFFGNTIDSLRLFDSSTQRTIREISIFEINTLSEVMLTSQNISRFRENYLANFGTTTQEDPLYVAISQGRRYPGMEHWLPFFYQSMETIFPYLSEFCIITDPLVKETARKRSQLIQDYYEARLQYSSDKKQYSVYKPIAPEKLYLNYQQFDALIQTTHKLVQMTAFNQQETAHNRVVHLNAFPGKSWVPSAVQKIESQDNWESGGRFDKFLSHVAQQAQKGIKTIISASSQGALQHLIHLIESHGFKKIKKINTLTEINSLLKEEIAAVILPINQGFETKHMILVTETDLLGKKIARRVVRKKNVHAQSFFDSSNIEEGAIIVHAEHGIGRFVRLYSIEVSGTFHDCLELHYADNAKLFVPVENIDLISRYSTEITTVTLDKLGGSAWKTRKANLKKRLEDLAQKLVDIAAKRAIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICGDVGFGKTEIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQTKEAALHKKSITEGQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEALKETHTGVHVLTLSATPIPRTLQLAITGVRELSLISMPPINRIACRTSISIFDPLVVRETLMREYYRGGQSFYVCPRLSDLEKCYTFLQSEVPELKIAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIVESGLDLPKANTMIVQRADMFGLAQLYQLRGRVGRSKIASFALFLLPENRPLTAAAQKRLRILQSLNTLGAGFQLASYDLDIRGTGNLLGEEQSGHIREIGFELYQKMLEETVASIKGQKDLVESDWSPQVLIEASVMIPESYVSDINLRLSLYRRLGNITDHADISHFKEEMVDRFGPLPIEVIHLLKVVFLKLLCRIANIDKMDIGLKGIIIQFRHKTFSNPEALLQYIAQQKGKIIIRPDQNLVFDCLLPTINQRFFEAKRIITHLINMTNPEIQTPDSGDLSLKVKSL
cccHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccccEEEcccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEcHHHHHcccccHHHHHHcEEEEEccccccHHHHHHHHHHcccEEccccccccEEEEEccEEEEEcccccccEEEEccccEEEEEEEEEcccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHcccccHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccHHHHHHHHccccEEEEEccccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHcccccccccccHHHHHHcccccEEEEEccHHHccccccEEEEEHHHHHcHHHHHHHHHHHHHHHHHcccHHHcccccEEEEEccccEEEEEEEEEEccccccEEEEEEEcccccccccHHHHHcccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHccccccEEEEcHHHHHHHHHcccccEEEEEcHHHccHHHHHHHHHccccccEEEccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHcccccEEEEccHHHcccccccccEEEEEcccccccHHHHHHHcccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccHHHcccHHHHcHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccEEEEccccEEEEEEcccccccHHHHHHHHHHcccEEEEccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcc
cccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEHHHHHHccccHHHHHHcEEEEcccccccHHHHHHHHHHccccccccccccccEcccccHHEccccccccccEEEcccccccEEEEccHHHccccccHcHEEccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccccccHHHHccccccccHHHHHHcccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHccccHHHHHHHHHccccEEEEEccccccccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHccccccEcccHHHHHHHcccccEEEEEEEcHcccccccEEEEEcHHHHHHHHHHHHHHHccccHHHHHHHHHccccccEEEEcccccEEccEEEEEcccccHHEEEEEEccccEEEEEHHHHHHHHHcccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHHcccEEEEEEcHHHHcccccEccccEEEEEccccccccHHHHHHHHHccccEEEEcccccHHHHHHHHHcHcHccEEccccccccEEEEEEccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEccccccccHcEEEEHHHHHHHHHHHHHHHccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEccccHEcccHHHcccccccHHHHHcHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccEEEEcccccEEEEEcccccccHHHHHHHHHHcccEEEEccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcc
MIFGSDIERISEKYCkkitlspvidgteGFILAEIARLGLSLVYICSDERILINLKKILTLVVPDIRVIifpawdclpydrvspspyvVTRRLSCISNLvsfnsskeTIIVLTTVSAVMCRSVNIMSIKDYKLSIQSKDQIDMAKVIEKLETNGFQRVNAVYKVGEYAVrggildvyeptkkypvrldffgntidslrlfdsstqRTIREISIFEINTLSEVMLTSQNISRFRENYlanfgtttqedplyvaisqgrrypgmehwlpFFYQSMETIFPYLSEFCIITDPLVKETARKRSQLIQDYYEARLQyssdkkqysvykpiapeklylNYQQFDALIQTTHKLVQMTAFNQQETAHNRVVHlnafpgkswvpsAVQKIEsqdnwesggrfdKFLSHVAQQAQKGIKTIISASSQGALQHLIHLIESHGFKKIKKINTLTEINSLLKEEIAAVIlpinqgfetkHMILVTETDLLGKKIARRVVRkknvhaqsffdssnieegAIIVHAEHGIGRFVRLYSIEVSGTFHDclelhyadnaklfvpvenidlisrystEITTVTLdklggsawKTRKANLKKRLEDLAQKLVDIAAKRaihsvpplmvsqDLYSQFIKrfphvetedQEKAIDAVIQDLssgrlmdrlicgdvgfgKTEIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQTKEAALHKKSITEGQVDIVIGThallnpkitfanlgliiideeqhfgvKHKEAlkethtgvhvltlsatpiprTLQLAITGVrelslismppinriacrtsisifdpLVVRETLMREyyrggqsfyvcprlsdlEKCYTFLQSEVPELKIAMAhgqmspknlEDKMNAFYEGQYDVLLSTSIVesgldlpkantMIVQRADMFGLAQLYQLRGRVGRSKIASFALfllpenrplTAAAQKRLRILQSLNTlgagfqlasydldirgtgnllgeeqsghIREIGFELYQKMLEETVASIKgqkdlvesdwspqvlieasvmipesyvsdINLRLSLYRRLgnitdhadishfkeemvdrfgplpIEVIHLLKVVFLKLLCRIANIDKMDIGLKGIIIQFrhktfsnpEALLQYIAQQKgkiiirpdqnlvfdcllPTINQRFFEAKRIITHLInmtnpeiqtpdsgdlslkvksl
mifgsdieRISEKyckkitlspvidgtEGFILAEIARLGLSLVYICSDERILINLKKILTLVVPDIRVIIfpawdclpydrVSPSPYVVTRRLSCISNlvsfnssketiIVLTTVSAVMCRSVNIMSIKDYKLSIQSKDQIDMAKVIEKLetngfqrvnAVYKVGEYAVRGGILDVYEPTKKYPVRLDFFGNTIDSlrlfdsstqrtIREISIFEINTLSEVMLTSQNISRFRENYLANfgtttqedplyVAISQGRRYPGMEHWLPFFYQSMETIFPYLSEFCIITDPLVKETARKRSQLIQDYYEArlqyssdkkqysVYKPIAPEKLYLNYQQFDALIQTTHKLVQMTAFNQQETAHNRVVHLNAFPGKSWVPSAVQKIESQDNWESGGRFDKFLSHVAQQAQKGIKTIISASSQGALQHLIHLIESHGFKKIKKINTLTEINSLLKEEIAAVILPINQGFETKHMILVTETDLLGKKIARRVVRKknvhaqsffdssnieEGAIIVHAEHGIGRFVRLYSIEVSGTFHDCLELHYADNAKLFVPVENIDLISRYSTEittvtldklggsawKTRKANLKKRLEDLAQKLVDIAAKRAIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICGDVGFGKTEIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQTKEAALhkksitegqVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEALKETHTGVHVLtlsatpiprTLQLAITGVRELSLISMppinriacrtsisifdpLVVRETLMREYYRGGQSFYVCPRLSDLEKCYTFLQSEVPELKIAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIVESGLDLPKANTMIVQRADMFGLAQLYQLRGRVGRSKIASFALFLLPENRPLTAAAQKRLRILQSLNTLGAGFQLASYDLDIRGTGNLLGEEQSGHIREIGFELYQKMLEETVASIKgqkdlvesdwSPQVLIEASVMIPESYVSDINLRLSLYRRLGNITDHADISHFKEEMVDRFGPLPIEVIHLLKVVFLKLLCRIANIDKMDIGLKGIIIQFRHKTFSNPEALLQYIAQQKGKIIIRPDQNLVFDCLLPTINQRFFEAKRIITHLINmtnpeiqtpdsgdlslkvksl
MIFGSDIERISEKYCKKITLSPVIDGTEGFILAEIARLGLSLVYICSDERILINLKKILTLVVPDIRVIIFPAWDCLPYDRVSPSPYVVTRRLSCISNLVSFNSSKETIIVLTTVSAVMCRSVNIMSIKDYKLSIQSKDQIDMAKVIEKLETNGFQRVNAVYKVGEYAVRGGILDVYEPTKKYPVRLDFFGNTIDSLRLFDSSTQRTIREISIFEINTLSEVMLTSQNISRFRENYLANFGTTTQEDPLYVAISQGRRYPGMEHWLPFFYQSMETIFPYLSEFCIITDPLVKETARKRSQLIQDYYEARLQYSSDKKQYSVYKPIAPEKLYLNYQQFDALIQTTHKLVQMTAFNQQETAHNRVVHLNAFPGKSWVPSAVQKIESQDNWESGGRFDKFLSHVAQQAQKGIKTIISASSQGALQHLIHLIESHGFKKIKKINTLTEINSLLKEEIAAVILPINQGFETKHMILVTETDLLGKKIARRVVRKKNVHAQSFFDSSNIEEGAIIVHAEHGIGRFVRLYSIEVSGTFHDCLELHYADNAKLFVPVENIDLISRYSTEITTVTLDKLGGSAWKTRKANLKKRLEDLAQKLVDIAAKRAIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICGDVGFGKTEIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQTKEAALHKKSITEGQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEALKETHTGVHVLTLSATPIPRTLQLAITGVRELSLISMPPINRIACRTSISIFDPLVVRETLMREYYRGGQSFYVCPRLSDLEKCYTFLQSEVPELKIAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIVESGLDLPKANTMIVQRADMFGLAQLYQLRGRVGRSKIASFALFLLPENRPLTAAAQKRLRILQSLNTLGAGFQLASYDLDIRGTGNLLGEEQSGHIREIGFELYQKMLEETVASIKGQKDLVESDWSPQVLIEASVMIPESYVSDINLRLSLYRRLGNITDHADISHFKEEMVDRFGPLPIEVIHLLKVVFLKLLCRIANIDKMDIGLKGIIIQFRHKTFSNPEALLQYIAQQKGKIIIRPDQNLVFDCLLPTINQRFFEAKRIITHLINMTNPEIQTPDSGDLSLKVKSL
*******ERISEKYCKKITLSPVIDGTEGFILAEIARLGLSLVYICSDERILINLKKILTLVVPDIRVIIFPAWDCLPYDRVSPSPYVVTRRLSCISNLVSFNSSKETIIVLTTVSAVMCRSVNIMSIKDYKLSIQSKDQIDMAKVIEKLETNGFQRVNAVYKVGEYAVRGGILDVYEPTKKYPVRLDFFGNTIDSLRLFDSSTQRTIREISIFEINTLSEVMLTSQNISRFRENYLANFGTTTQEDPLYVAISQGRRYPGMEHWLPFFYQSMETIFPYLSEFCIITDPLVKETARKRSQLIQDYYEARLQYS*********KPIAPEKLYLNYQQFDALIQTTHKLVQMT**************LNAFPGKSWVP*************SGGRFDKFLSHVAQQAQKGIKTIISASSQGALQHLIHLIESHGFKKIKKINTLTEINSLLKEEIAAVILPINQGFETKHMILVTETDL***********************SNIEEGAIIVHAEHGIGRFVRLYSIEVSGTFHDCLELHYADNAKLFVPVENIDLISRYST*****TLDKLGGSAWKTRKANLKKRLEDLAQKLVDIAAKRAIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICGDVGFGKTEIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFV***********ITEGQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEALKETHTGVHVLTLSATPIPRTLQLAITGVRELSLISMPPINRIACRTSISIFDPLVVRETLMREYYRGGQSFYVCPRLSDLEKCYTFLQSEVPELKIAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIVESGLDLPKANTMIVQRADMFGLAQLYQLRGRVGRSKIASFALFLLPENRP****AQKRLRILQSLNTLGAGFQLASYDLDIRGTGNLLGEEQSGHIREIGFELYQKMLEETV****************QVLIEASVMIPESYVSDINLRLSLYRRLGNITDHADISHFKEEMVDRFGPLPIEVIHLLKVVFLKLLCRIANIDKMDIGLKGIIIQFRHKTFSNPEALLQYIAQQKG*IIIRPDQNLVFDCLLPTINQRFFEAKRIITHLINMT************SLKVKS*
MIFGSDIERISEKYCKKITLSPVIDGTEGFILAEIARLGLSLVYICSDERILINLKKILTLVVPDIRVIIFPAWDCLPYDRVSPSPYVVTRRLSCISNLVSFNSSKETIIVLTTVSAVMCRSVNIMSIKDYKLSIQSKDQIDMAKVIEKLETNGFQRVNAVYKVGEYAVRGGILDVYEPTKKYPVRLDFFGNTIDSLRLFDSSTQRTIREISIFEINTLSEVMLTSQNISRFRENYLANFGTTTQEDPLYVAISQGRRYPGMEHWLPFFYQSMETIFPYLSEFCIITDPLVKETARKRSQLIQDYYEARLQYSSDKKQYSVYKPIAPEKLYLNYQQFDALIQTTHKLVQMTAFNQQETAHNRVVHLNAFPGKSWVPSAVQKIESQDNWESGGRFDKFLSHVAQQAQKGIKTIISASSQGALQHLIHLIESHGFKKIKKINTLTEINSLLKEEIAAVILPINQGFETKHMILVTETDLLGKKIARRVVRKKNVHAQSFFDSSNIEEGAIIVHAEHGIGRFVRLYSIEVSGTFHDCLELHYADNAKLFVPVENIDLISRYSTEITTVTLDKLGGSAWKTRKANLKKRLEDLAQKLVDIAAKRAIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICGDVGFGKTEIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQTKEAALHKKSITEGQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEALKETHTGVHVLTLSATPIPRTLQLAITGVRELSLISMPPINRIACRTSISIFDPLVVRETLMREYYRGGQSFYVCPRLSDLEKCYTFLQSEVPELKIAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIVESGLDLPKANTMIVQRADMFGLAQLYQLRGRVGRSKIASFALFLLPENRPLTAAAQKRLRILQSLNTLGAGFQLASYDLDIRGTGNLLGEEQSGHIREIGFELYQKMLEETVASIKGQKDLVESDWSPQVLIEASVMIPESYVSDINLRLSLYRRLGNITDHADISHFKEEMVDRFGPLPIEVIHLLKVVFLKLLCRIANIDKMDIGLKGIIIQFRHKTFSNPEALLQYIAQQKGKIIIRPDQNLVFDCLLPTINQRFFEAKRIITHLINMTNPEIQTPDSGDLSLKVKSL
*****DIE*******KKITLSPVIDGTEGFILAEIARLGLSLVYICSDERILINLKKILTLVVPDIRVIIFPAWDCLPYDRVSPSPYVVTRRLSCISNLVSFNSSKETIIVLTTVSAVMCRSVNIMSIKDYKLSIQSKDQIDMAKVIEKLETNGFQRVNAVYKVGEYAVRGGILDVYEPTKKYPVRLDFFGNTIDSLRLFDSSTQRTIREISIFEINTLSEVMLTSQNISRFRENYLANFGTTTQEDPLYVAISQGRRYPGMEHWLPFFYQSMETIFPYLSEFCIITDPLVKETARKRSQLIQDYYEARLQYSSDKKQYSVYKPIAPEKLYLNYQQFDALIQTTHKLVQMTAFNQQETAHNRVVHLNAFPGKSWVPSAVQKIESQDNWESGGRFDKFLSHVAQQAQKGIKTIISASSQGALQHLIHLIESHGFKKIKKINTLTEINSLLKEEIAAVILPINQGFETKHMILVTETDLLGKKIARRVVRKKNVHAQSFFDSSNIEEGAIIVHAEHGIGRFVRLYSIEVSGTFHDCLELHYADNAKLFVPVENIDLISRYSTEITTVTLDKLGGSAWKTRKANLKKRLEDLAQKLVDIAAKRAIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICGDVGFGKTEIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQTKEAALHKKSITEGQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEALKETHTGVHVLTLSATPIPRTLQLAITGVRELSLISMPPINRIACRTSISIFDPLVVRETLMREYYRGGQSFYVCPRLSDLEKCYTFLQSEVPELKIAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIVESGLDLPKANTMIVQRADMFGLAQLYQLRGRVGRSKIASFALFLLPENRPLTAAAQKRLRILQSLNTLGAGFQLASYDLDIRGTGNLLGEEQSGHIREIGFELYQKMLEETVASIKGQKDLVESDWSPQVLIEASVMIPESYVSDINLRLSLYRRLGNITDHADISHFKEEMVDRFGPLPIEVIHLLKVVFLKLLCRIANIDKMDIGLKGIIIQFRHKTFSNPEALLQYIAQQKGKIIIRPDQNLVFDCLLPTINQRFFEAKRIITHLINMTNPEIQTPDSGDLSLKVKS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFGSDIERISEKYCKKITLSPVIDGTEGFILAEIARLGLSLVYICSDERILINLKKILTLVVPDIRVIIFPAWDCLPYDRVSPSPYVVTRRLSCISNLVSFNSSKETIIVLTTVSAVMCRSVNIMSIKDYKLSIQSKDQIDMAKVIEKLETNGFQRVNAVYKVGEYAVRGGILDVYEPTKKYPVRLDFFGNTIDSLRLFDSSTQRTIREISIFEINTLSEVMLTSQNISRFRENYLANFGTTTQEDPLYVAISQGRRYPGMEHWLPFFYQSMETIFPYLSEFCIITDPLVKETARKRSQLIQDYYEARLQYSSDKKQYSVYKPIAPEKLYLNYQQFDALIQTTHKLVQMTAFNQQETAHNRVVHLNAFPGKSWVPSAVQKIESQDNWESGGRFDKFLSHVAQQAQKGIKTIISASSQGALQHLIHLIESHGFKKIKKINTLTEINSLLKEEIAAVILPINQGFETKHMILVTETDLLGKKIARRVVRKKNVHAQSFFDSSNIEEGAIIVHAEHGIGRFVRLYSIEVSGTFHDCLELHYADNAKLFVPVENIDLISRYSTEITTVTLDKLGGSAWKTRxxxxxxxxxxxxxxxxxxxxxRAIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICGDVGFGKTEIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQTKEAALHKKSITEGQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEALKETHTGVHVLTLSATPIPRTLQLAITGVRELSLISMPPINRIACRTSISIFDPLVVRETLMREYYRGGQSFYVCPRLSDLEKCYTFLQSEVPELKIAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIVESGLDLPKANTMIVQRADMFGLAQLYQLRGRVGRSKIASFALFLLPENRPLTAAAQKRLRILQSLNTLGAGFQLASYDLDIRGTGNLLGEEQSGHIREIGFELYQKMLEETVASIKGQKDLVESDWSPQVLIEASVMIPESYVSDINLRLSLYRRLGNITDHADISHFKEEMVDRFGPLPIEVIHLLKVVFLKLLCRIANIDKMDIGLKGIIIQFRHKTFSNPEALLQYIAQQKGKIIIRPDQNLVFDCLLPTINQRFFEAKRIITHLINMTNPEIQTPDSGDLSLKVKSL
MIFGSDIERISEKYCKKITLSPVIDGTEGFILAEIARLGLSLVYICSDERILINLKKILTLVVPDIRVIIFPAWDCLPYDRVSPSPYVVTRRLSCISNLVSFNSSKETIIVLTTVSAVMCRSVNIMSIKDYKLSIQSKDQIDMAKVIEKLETNGFQRVNAVYKVGEYAVRGGILDVYEPTKKYPVRLDFFGNTIDSLRLFDSSTQRTIREISIFEINTLSEVMLTSQNISRFRENYLANFGTTTQEDPLYVAISQGRRYPGMEHWLPFFYQSMETIFPYLSEFCIITDPLVKETARKRSQLIQDYYEARLQYSSDKKQYSVYKPIAPEKLYLNYQQFDALIQTTHKLVQMTAFNQQETAHNRVVHLNAFPGKSWVPSAVQKIESQDNWESGGRFDKFLSHVAQQAQKGIKTIISASSQGALQHLIHLIESHGFKKIKKINTLTEINSLLKEEIAAVILPINQGFETKHMILVTETDLLGKKIARRVVRKKNVHAQSFFDSSNIEEGAIIVHAEHGIGRFVRLYSIEVSGTFHDCLELHYADNAKLFVPVENIDLISRYSTEITTVTLDKLGGSAWKTRKANLKKRLEDLAQKLVDIAAKRAIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICGDVGFGKTEIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQTKEAALHKKSITEGQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEALKETHTGVHVLTLSATPIPRTLQLAITGVRELSLISMPPINRIACRTSISIFDPLVVRETLMREYYRGGQSFYVCPRLSDLEKCYTFLQSEVPELKIAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIVESGLDLPKANTMIVQRADMFGLAQLYQLRGRVGRSKIASFALFLLPENRPLTAAAQKRLRILQSLNTLGAGFQLASYDLDIRGTGNLLGEEQSGHIREIGFELYQKMLEETVASIKGQKDLVESDWSPQVLIEASVMIPESYVSDINLRLSLYRRLGNITDHADISHFKEEMVDRFGPLPIEVIHLLKVVFLKLLCRIANIDKMDIGLKGIIIQFRHKTFSNPEALLQYIAQQKGKIIIRPDQNLVFDCLLPTINQRFFEAKRIITHLINMTNPEIQTPDSGDLSLKVKSL
MIFGSDIERISEKYCKKITLSPVIDGTEGFILAEIARLGLSLVYICSDERILINLKKILTLVVPDIRVIIFPAWDCLPYDRVSPSPYVVTRRLSCISNLVSFNSSKETIIVLTTVSAVMCRSVNIMSIKDYKLSIQSKDQIDMAKVIEKLETNGFQRVNAVYKVGEYAVRGGILDVYEPTKKYPVRLDFFGNTIDSLRLFDSSTQRTIREISIFEINTLSEVMLTSQNISRFRENYLANFGTTTQEDPLYVAISQGRRYPGMEHWLPFFYQSMETIFPYLSEFCIITDPLVKETARKRSQLIQDYYEARLQYSSDKKQYSVYKPIAPEKLYLNYQQFDALIQTTHKLVQMTAFNQQETAHNRVVHLNAFPGKSWVPSAVQKIESQDNWESGGRFDKFLSHVAQQAQKGIKTIISASSQGALQHLIHLIESHGFKKIKKINTLTEINSLLKEEIAAVILPINQGFETKHMILVTETDLLGKKIARRVVRKKNVHAQSFFDSSNIEEGAIIVHAEHGIGRFVRLYSIEVSGTFHDCLELHYADNAKLFVPVENIDLISRYSTEITTVTLDKLGGSAWKTRKANLKKRLEDLAQKLVDIAAKRAIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICGDVGFGKTEIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQTKEAALHKKSITEGQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEALKETHTGVHVLTLSATPIPRTLQLAITGVRELSLISMPPINRIACRTSISIFDPLVVRETLMREYYRGGQSFYVCPRLSDLEKCYTFLQSEVPELKIAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIVESGLDLPKANTMIVQRADMFGLAQLYQLRGRVGRSKIASFALFLLPENRPLTAAAQKRLRILQSLNTLGAGFQLASYDLDIRGTGNLLGEEQSGHIREIGFELYQKMLEETVASIKGQKDLVESDWSPQVLIEASVMIPESYVSDINLRLSLYRRLGNITDHADISHFKEEMVDRFGPLPIEVIHLLKVVFLKLLCRIANIDKMDIGLKGIIIQFRHKTFSNPEALLQYIAQQKGKIIIRPDQNLVFDCLLPTINQRFFEAKRIITHLINMTNPEIQTPDSGDLSLKVKSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target1187 transcription-repair coupling factor [Candidatus Liberi
254780945700 ATP-dependent DNA helicase RecG [Candidatus Liberi 3e-56
254780619731 primosome assembly protein PriA [Candidatus Liberi 2e-07
254780601573 ATP-dependent RNA helicase protein [Candidatus Lib 0.004
>gi|254780945|ref|YP_003065358.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Back     alignment
 Score =  212 bits (540), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 137/395 (34%), Positives = 214/395 (54%), Gaps = 19/395 (4%)

Query: 607 PLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICGDVGFGKTEIALRA 666
           P+ V   +  + ++  P   T+ QE AI  ++QD+S    M R++ GDVG GKT +AL A
Sbjct: 254 PINVEGKIAQKILRNIPFSPTKSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIA 313

Query: 667 AFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQTKEAALHKKSITE 726
              AV  G Q  ++AP  +L +QH+    +  Q   + +  I+  +         + I  
Sbjct: 314 MAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAH 373

Query: 727 GQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEALKETHTGVHVLTLSATPIPR 786
           GQ  I+IGTHAL    I +  L L+I+DE+  FGV+ +  L +  T  HVL ++ATPIPR
Sbjct: 374 GQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATAPHVLLMTATPIPR 433

Query: 787 TLQLAITGVRELSLISMPPINRIACRTSISIFDPL-VVRETLMREYYRGGQSFYVCPRLS 845
           TL L   G  ++S I+  P  R   +T I   + +  V E L      G +++++CP++ 
Sbjct: 434 TLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRIDEVIERLKVVLSEGKKAYWICPQIE 493

Query: 846 DLEKCYTFLQSEVPELK---------IAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIV 896
             EK  +  +S V             IA+ HG+MS  + E  M++F  G   +L++T+++
Sbjct: 494 --EKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVI 551

Query: 897 ESGLDLPKANTMIVQRADMFGLAQLYQLRGRVGRS-KIASFALFLLPENRPLTAAAQKRL 955
           E G+D+  A+ +I++ A+ FGLAQL+QLRGRVGR  +I+S  L   P   PL+  +  RL
Sbjct: 552 EVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILLYHP---PLSKNSYTRL 608

Query: 956 RILQSLNTLGAGFQLASYDLDIRGTGNLLGEEQSG 990
            +L++      GF +A  DL  R  G +LG +QSG
Sbjct: 609 SVLKNTED---GFLIAEEDLKQRKEGEILGIKQSG 640

>gi|254780619|ref|YP_003065032.1| primosome assembly protein PriA [Candidatus Liberibacter asiaticus str. psy62] Length = 731 Back     alignment
 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 98/234 (41%), Gaps = 20/234 (8%)

Query: 540 ADNAKLFVPVENIDLISRYSTEITTVTLDKL-GGSAWKTRKANLKKRLEDLAQKLVDI-- 596
           ++  K+   ++   +  R +T      LDK+  G  W+ R      R   ++  ++D   
Sbjct: 115 SETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDL---IRASQVSSHVIDGLK 171

Query: 597 ---AAKRAIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICG 653
                K+    + P++ S +LY         +  ++Q+  ++ V+   + G  +  LI G
Sbjct: 172 AQGVIKQIFEVISPVVDSPNLYFSL-----PILDKNQQDVVEQVVPLCTKGFAVS-LISG 225

Query: 654 DVGFGKTEIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQ 713
             G GKTE+ L      +  G QV ++ P   L       F +R   F V+ A     + 
Sbjct: 226 VTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKR---FGVKPAEWHSSLS 282

Query: 714 TKEAALHKKSITEGQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEAL 767
           T       + +  G + +++G  + L   + F  LGLI+IDEE     K +E +
Sbjct: 283 TSMREKIWRQVARGAISVIVGVRSALF--LPFKKLGLIVIDEEHDISYKQEEGI 334

>gi|254780601|ref|YP_003065014.1| ATP-dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 573 Back     alignment
 Score = 35.8 bits (81), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 67/328 (20%), Positives = 133/328 (40%), Gaps = 40/328 (12%)

Query: 645 RLMDRLICGDVGFGKT---EIALRAAFIAVMNGLQVA------VIAPTTLLVRQHFRLFS 695
           R  D L+    G GKT    +AL +  +A  +    A       IAPT  L  Q  R   
Sbjct: 36  REKDVLVSAQTGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELE 95

Query: 696 ERFQGFSVRIASISRFVQTKEAALHK-KSITEGQVDIVIGTHALL-----NPKITFANLG 749
             +    V +A     V     ++H+ +   +    IV+GT   L        +  ++L 
Sbjct: 96  WLYAKTGVVVA-----VCIGGVSVHRERRDLQNGAHIVVGTPGRLCDHIRGKGLNISHLK 150

Query: 750 LIIIDE-EQHFGVKHKEA----LKETHTGVHVLTLSATPIPRTLQLAITGVRELSLISMP 804
            +++DE ++   +  ++     L  +     +L  SAT  P    LA    ++   +++ 
Sbjct: 151 AVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIA 210

Query: 805 PINR-------IACRTSISIFDPLVVRETLMREYYRGGQSFYVCPRLSDLEKCYTFLQSE 857
             NR        A   ++S  D  +V   ++R Y+    +   C   + + +    L   
Sbjct: 211 SENRQHSDIDYRAVLVALSDRDNAIV--NILR-YHGAKNAIVFCSTRASVSRFTKVLAEH 267

Query: 858 VPELKIAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIVESGLDLPKANTMIVQRADMFG 917
           +   ++    G++S +   + +    +G+  V ++T +   G+DLP  +  +V  A++  
Sbjct: 268 L--FQVVALSGELSQQERSNALQMMRDGRARVCIATDVAARGIDLP--DLELVIHAELSS 323

Query: 918 LAQ-LYQLRGRVGRSKIASFALFLLPEN 944
             + L    GR GR+     ++F++P+N
Sbjct: 324 NPENLLHRSGRTGRAGRKGMSVFVIPQN 351

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target1187 transcription-repair coupling factor [Candidatus Liberi
3151223601185 transcription-repair coupling factor [Candidatus Liberi 1 0.0
3252931641165 transcription-repair coupling factor [Agrobacterium sp. 1 0.0
158890821165 transcription-repair coupling factor [Agrobacterium tum 1 0.0
3073087951169 transcription-repair coupling factor [Sinorhizobium mel 1 0.0
159654041171 transcription-repair coupling factor (TRCF) protein [Si 1 0.0
2278220231170 putative transcription-repair coupling factor [Sinorhiz 1 0.0
1503966131171 transcription-repair coupling factor [Sinorhizobium med 1 0.0
2412046391166 transcription-repair coupling factor [Rhizobium legumin 1 0.0
863577141167 transcription-repair coupling factor (TRCF) protein [Rh 1 0.0
1162521381166 transcription-repair coupling factor [Rhizobium legumin 1 0.0
>gi|315122360|ref|YP_004062849.1| transcription-repair coupling factor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 1185 Back     alignment and organism information
 Score = 1974 bits (5115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 957/1186 (80%), Positives = 1068/1186 (90%), Gaps = 2/1186 (0%)

Query: 1    MIFGSDIERISEKYCKKITLSPVIDGTEGFILAEIARLGLSLVYICSDERILINLKKILT 60
            MIFG  I +I+EK CKKITLS V  GTE F+LAEIAR GLSLVYI SDER L+N+KK L 
Sbjct: 1    MIFGDYINKINEKPCKKITLSQVFPGTEPFVLAEIARSGLSLVYIGSDERALVNIKKTLA 60

Query: 61   LVVPDIRVIIFPAWDCLPYDRVSPSPYVVTRRLSCISNLVSFNSSKETIIVLTTVSAVMC 120
             +VPDI VIIFPAWDCLPYDR+S SP VVT RL+C S+L+S N SK+T I+LTTVSAVMC
Sbjct: 61   FIVPDIDVIIFPAWDCLPYDRISASPRVVTDRLACFSHLISCNPSKKTSIILTTVSAVMC 120

Query: 121  RSVNIMSIKDYKLSIQSKDQIDMAKVIEKLETNGFQRVNAVYKVGEYAVRGGILDVYEPT 180
            RSVN MSIKD K SIQSKDQI MAKVIEKLE NGFQRVN VYKVGEYAVRGGILDVY P+
Sbjct: 121  RSVNFMSIKDCKFSIQSKDQISMAKVIEKLEKNGFQRVNTVYKVGEYAVRGGILDVYGPS 180

Query: 181  KKYPVRLDFFGNTIDSLRLFDSSTQRTIREISIFEINTLSEVMLTSQNISRFRENYLANF 240
            +KYPVRLDFFG+TI+SLRLFD ++QRTIREIS F INTLSEV+LTS+NIS FR+NYL NF
Sbjct: 181  EKYPVRLDFFGDTIESLRLFDYASQRTIREISTFTINTLSEVVLTSENISLFRKNYLLNF 240

Query: 241  GTTTQEDPLYVAISQGRRYPGMEHWLPFFYQSMETIFPYLSEFCIITDPLVKETARKRSQ 300
            G  TQ+D LYV +SQG RYPGMEHWLPFFYQ METIF YL++FCI+TD  VK+TA KRSQ
Sbjct: 241  GAATQKDLLYVTVSQGNRYPGMEHWLPFFYQKMETIFSYLADFCIVTDSAVKDTAHKRSQ 300

Query: 301  LIQDYYEARLQYSSDKKQYSVYKPIAPEKLYLNYQQFDALIQTTHKLVQMTAFNQQETAH 360
            LIQDYYEAR Q+SSDKK YS+YKPI PEKLYL YQQF+A++++++KL+QMT F+QQET+H
Sbjct: 301  LIQDYYEARCQHSSDKKNYSIYKPILPEKLYLTYQQFEAMLESSNKLIQMTPFSQQETSH 360

Query: 361  NRVVHLNAFPGKSWVPSAVQKIESQDNWESGGRFDKFLSHVAQQAQKGIKTIISASSQGA 420
            + VV LN  PGKSWVPSAVQKIESQ+NWES  RFD+FLS+VAQQ QKG K  I+ASS+GA
Sbjct: 361  SCVVCLNVRPGKSWVPSAVQKIESQENWESMNRFDRFLSYVAQQFQKGKKAFIAASSKGA 420

Query: 421  LQHLIHLIESHGFKKIKKINTLTEINSLLKEEIAAVILPINQGFETKHMILVTETDLLGK 480
            LQHLIHL+ES G  KIKKI+   EI+SL KEEIAA +LPI+QGFET +MILVTE DLLGK
Sbjct: 421  LQHLIHLMESDGLNKIKKIDCFNEIHSLAKEEIAAAVLPIDQGFETGNMILVTEKDLLGK 480

Query: 481  KIARRVVRKKNVHAQSFFDSSNIEEGAIIVHAEHGIGRFVRLYSIEVSGTFHDCLELHYA 540
            +I RR VRK ++ A SFF+SSNIEEG+IIVHAEHGIGRF+RL SIEVSGT HDCLELHYA
Sbjct: 481  RIIRRTVRKSSL-ANSFFESSNIEEGSIIVHAEHGIGRFIRLSSIEVSGTSHDCLELHYA 539

Query: 541  DNAKLFVPVENIDLISRYSTEITTVTLDKLGGSAWKTRKANLKKRLEDLAQKLVDIAAKR 600
            DNAKLFVPVENIDLIS+YSTE  T+ LDKLGGS+W++RK+NLKKRLEDLAQKLVDIAAKR
Sbjct: 540  DNAKLFVPVENIDLISQYSTENETIMLDKLGGSSWQSRKSNLKKRLEDLAQKLVDIAAKR 599

Query: 601  AIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICGDVGFGKT 660
             IH+VP L VSQDLYSQF+K+FPHVETEDQEKA+DAVIQD +SG LMDRLICGDVGFGKT
Sbjct: 600  LIHNVPALTVSQDLYSQFVKKFPHVETEDQEKAVDAVIQDFTSGHLMDRLICGDVGFGKT 659

Query: 661  EIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQTKEAALH 720
            EIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQ F VRI S+SRFV+ KE ALH
Sbjct: 660  EIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQDFPVRIVSVSRFVKPKEVALH 719

Query: 721  KKSITEGQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEALKETHTGVHVLTLS 780
            KK+I EGQVDIVIGTHALL+PKITF+NLGLII+DEEQHFGVKHKEALKETHTGVHVLTLS
Sbjct: 720  KKAIAEGQVDIVIGTHALLDPKITFSNLGLIIVDEEQHFGVKHKEALKETHTGVHVLTLS 779

Query: 781  ATPIPRTLQLAITGVRELSLISMPPINRIACRTSISIFDPLVVRETLMREYYRGGQSFYV 840
            ATPIPRTLQLAITGVRELSLISMPPINRIACRTSISIFDPL++RETLMREYYRGGQSFYV
Sbjct: 780  ATPIPRTLQLAITGVRELSLISMPPINRIACRTSISIFDPLLIRETLMREYYRGGQSFYV 839

Query: 841  CPRLSDLEKCYTFLQSEVPELKIAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIVESGL 900
            CPRL DL+KCY FLQSEVPELK+AMAHGQMSPKNLE+ MN FYE +YD+LLSTSIVESGL
Sbjct: 840  CPRLLDLDKCYDFLQSEVPELKVAMAHGQMSPKNLEETMNGFYERKYDILLSTSIVESGL 899

Query: 901  DLPKANTMIVQRADMFGLAQLYQLRGRVGRSKIASFALFLLPENRPLTAAAQKRLRILQS 960
            DLP ANT+I+QRADMFGLAQLYQLRGRVGRSKI+SFALFLLPEN+PLT++AQKRLRILQS
Sbjct: 900  DLPNANTIIIQRADMFGLAQLYQLRGRVGRSKISSFALFLLPENKPLTSSAQKRLRILQS 959

Query: 961  LNTLGAGFQLASYDLDIRGTGNLLGEEQSGHIREIGFELYQKMLEETVASIKGQKDLVES 1020
            LNTLGAGFQLAS+DLDIRGTGNLLGEEQSGHI+E+GFELYQKML ETVASIKG+++LV+S
Sbjct: 960  LNTLGAGFQLASHDLDIRGTGNLLGEEQSGHIKEVGFELYQKMLGETVASIKGKRELVDS 1019

Query: 1021 DWSPQVLIEASVMIPESYVSDINLRLSLYRRLGNITDHADISHFKEEMVDRFGPLPIEVI 1080
            DWSPQ++IEASVMIP+SYVSD+NLRLSLYRRLGNITDH DI+ FKEEMVDRFG LPIEV+
Sbjct: 1020 DWSPQIMIEASVMIPDSYVSDVNLRLSLYRRLGNITDHTDINRFKEEMVDRFGSLPIEVV 1079

Query: 1081 HLLKVVFLKLLCRIANIDKMDIGLKGIIIQFRHKTFSNPEALLQYIAQQKGKIIIRPDQN 1140
            HLLKV+FLKLLCRIANI+KMDIG KGII+QFR+K F NPE LLQYI QQKGKIIIRPDQ+
Sbjct: 1080 HLLKVLFLKLLCRIANIEKMDIGPKGIIVQFRNKKFHNPEKLLQYIMQQKGKIIIRPDQS 1139

Query: 1141 LVFDCLLPTINQRFFEAKRIITHLINMTNPEIQTPDSGD-LSLKVK 1185
            L FDCLLPTIN+RF EAK I++ LI + + +IQ  D  D  SLKVK
Sbjct: 1140 LFFDCLLPTINKRFIEAKHILSQLIKLIDVDIQKCDKNDSASLKVK 1185


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293164|ref|YP_004279028.1| transcription-repair coupling factor [Agrobacterium sp. H13-3] Length = 1165 Back     alignment and organism information
>gi|15889082|ref|NP_354763.1| transcription-repair coupling factor [Agrobacterium tumefaciens str. C58] Length = 1165 Back     alignment and organism information
>gi|307308795|ref|ZP_07588491.1| transcription-repair coupling factor [Sinorhizobium meliloti BL225C] Length = 1169 Back     alignment and organism information
>gi|15965404|ref|NP_385757.1| transcription-repair coupling factor (TRCF) protein [Sinorhizobium meliloti 1021] Length = 1171 Back     alignment and organism information
>gi|227822023|ref|YP_002825994.1| putative transcription-repair coupling factor [Sinorhizobium fredii NGR234] Length = 1170 Back     alignment and organism information
>gi|150396613|ref|YP_001327080.1| transcription-repair coupling factor [Sinorhizobium medicae WSM419] Length = 1171 Back     alignment and organism information
>gi|241204639|ref|YP_002975735.1| transcription-repair coupling factor [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 1166 Back     alignment and organism information
>gi|86357714|ref|YP_469606.1| transcription-repair coupling factor (TRCF) protein [Rhizobium etli CFN 42] Length = 1167 Back     alignment and organism information
>gi|116252138|ref|YP_767976.1| transcription-repair coupling factor [Rhizobium leguminosarum bv. viciae 3841] Length = 1166 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1187 transcription-repair coupling factor [Candidatus Liberi
TIGR00580926 TIGR00580, mfd, transcription-repair coupling factor (m 0.0
PRK106891147 PRK10689, PRK10689, transcription-repair coupling facto 0.0
PRK10917681 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Pr 2e-93
COG1200677 COG1200, RecG, RecG-like helicase [DNA replication, rec 6e-90
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 2e-89
pfam03461101 pfam03461, TRCF, TRCF domain 2e-24
pfam00270167 pfam00270, DEAD, DEAD/DEAH box helicase 1e-23
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-19
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-13
TIGR00595505 TIGR00595, priA, primosomal protein N' 3e-06
cd00268203 cd00268, DEADc, DEAD-box helicases 0.003
pfam0255998 pfam02559, CarD_TRCF, CarD-like/TRCF domain 1e-23
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase require 8e-16
COG1198730 COG1198, PriA, Primosomal protein N' (replication facto 5e-14
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicases [DN 3e-09
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily II [ 1e-07
COG1205 851 COG1205, COG1205, Distinct helicase family with a uniqu 1e-06
KOG0335482 KOG0335, KOG0335, KOG0335, ATP-dependent RNA helicase [ 6e-04
COG1203733 COG1203, COG1203, Predicted helicases [General function 8e-04
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal domain 2e-14
TIGR00595505 TIGR00595, priA, primosomal protein N' 8e-05
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replication, r 0.002
KOG0344593 KOG0344, KOG0344, KOG0344, ATP-dependent RNA helicase [ 4e-14
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-terminal do 6e-12
smart0049082 smart00490, HELICc, helicase superfamily c-terminal dom 4e-11
PRK05580679 PRK05580, PRK05580, primosome assembly protein PriA; Va 4e-09
COG1110 1187 COG1110, COG1110, Reverse gyrase [DNA replication, reco 9e-04
PRK09401 1176 PRK09401, PRK09401, reverse gyrase; Reviewed 0.001
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 0.002
COG0556663 COG0556, UvrB, Helicase subunit of the DNA excision rep 1e-07
PRK05298652 PRK05298, PRK05298, excinuclease ABC subunit B; Provisi 1e-07
TIGR00631655 TIGR00631, uvrb, excinuclease ABC, B subunit 8e-07
KOG0330476 KOG0330, KOG0330, KOG0330, ATP-dependent RNA helicase [ 2e-06
COG4581 1041 COG4581, COG4581, Superfamily II RNA helicase [DNA repl 1e-05
KOG0951 1674 KOG0951, KOG0951, KOG0951, RNA helicase BRR2, DEAD-box 5e-05
TIGR01587358 TIGR01587, cas3_core, CRISPR-associated helicase Cas3 2e-04
KOG0345567 KOG0345, KOG0345, KOG0345, ATP-dependent RNA helicase [ 7e-04
COG1204 766 COG1204, COG1204, Superfamily II helicase [General func 0.003
KOG0348708 KOG0348, KOG0348, KOG0348, ATP-dependent RNA helicase [ 4e-04
KOG0338691 KOG0338, KOG0338, KOG0338, ATP-dependent RNA helicase [ 4e-04
KOG0343758 KOG0343, KOG0343, KOG0343, RNA Helicase [RNA processing 0.003
COG11971139 COG1197, Mfd, Transcription-repair coupling factor (sup 0.0
>gnl|CDD|161938 TIGR00580, mfd, transcription-repair coupling factor (mfd) Back     alignment and domain information
>gnl|CDD|182649 PRK10689, PRK10689, transcription-repair coupling factor; Provisional Back     alignment and domain information
>gnl|CDD|182836 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>gnl|CDD|31393 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|161975 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|146217 pfam03461, TRCF, TRCF domain Back     alignment and domain information
>gnl|CDD|144015 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|28927 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|161946 TIGR00595, priA, primosomal protein N' Back     alignment and domain information
>gnl|CDD|28928 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|145606 pfam02559, CarD_TRCF, CarD-like/TRCF domain Back     alignment and domain information
>gnl|CDD|33855 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31391 COG1198, PriA, Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|30859 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31261 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31398 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|35556 KOG0335, KOG0335, KOG0335, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31396 COG1203, COG1203, Predicted helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|28960 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|161946 TIGR00595, priA, primosomal protein N' Back     alignment and domain information
>gnl|CDD|31308 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35565 KOG0344, KOG0344, KOG0344, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|144016 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|128766 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|180144 PRK05580, PRK05580, primosome assembly protein PriA; Validated Back     alignment and domain information
>gnl|CDD|31307 COG1110, COG1110, Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|181823 PRK09401, PRK09401, reverse gyrase; Reviewed Back     alignment and domain information
>gnl|CDD|184313 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|30902 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|180000 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional Back     alignment and domain information
>gnl|CDD|161969 TIGR00631, uvrb, excinuclease ABC, B subunit Back     alignment and domain information
>gnl|CDD|35551 KOG0330, KOG0330, KOG0330, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|34219 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|36169 KOG0951, KOG0951, KOG0951, RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|162437 TIGR01587, cas3_core, CRISPR-associated helicase Cas3 Back     alignment and domain information
>gnl|CDD|35566 KOG0345, KOG0345, KOG0345, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31397 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|35569 KOG0348, KOG0348, KOG0348, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35559 KOG0338, KOG0338, KOG0338, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35564 KOG0343, KOG0343, KOG0343, RNA Helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31390 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 1187 transcription-repair coupling factor [Candidatus Liberi
PRK106891148 transcription-repair coupling factor; Provisional 100.0
COG11971139 Mfd Transcription-repair coupling factor (superfamily I 100.0
TIGR00580997 mfd transcription-repair coupling factor; InterPro: IPR 100.0
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 100.0
COG1200677 RecG RecG-like helicase [DNA replication, recombination 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 99.89
PRK01172674 ski2-like helicase; Provisional 99.86
TIGR00631667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 100.0
PRK05298657 excinuclease ABC subunit B; Provisional 100.0
COG0556663 UvrB Helicase subunit of the DNA excision repair comple 100.0
KOG0344593 consensus 100.0
PRK05580699 primosome assembly protein PriA; Validated 100.0
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 99.94
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 99.91
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 99.9
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 99.9
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.89
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 99.89
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 99.88
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 99.86
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 99.78
KOG0331519 consensus 99.57
KOG0338691 consensus 99.21
KOG0335482 consensus 99.2
KOG0328400 consensus 99.14
KOG0340442 consensus 99.08
KOG0339731 consensus 99.06
KOG0327397 consensus 99.02
KOG0334997 consensus 98.67
TIGR00614497 recQ_fam ATP-dependent DNA helicase, RecQ family; Inter 98.63
KOG0336629 consensus 98.52
KOG0947 1248 consensus 98.24
COG0610962 Type I site-specific restriction-modification system, R 96.8
KOG0948 1041 consensus 96.28
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 99.96
PRK13766764 Hef nuclease; Provisional 99.87
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.84
PRK02362736 ski2-like helicase; Provisional 99.83
PRK13767 878 ATP-dependent helicase; Provisional 99.82
PRK00254717 ski2-like helicase; Provisional 99.79
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 99.72
COG1204 766 Superfamily II helicase [General function prediction on 99.62
COG1202830 Superfamily II helicase, archaea-specific [General func 99.62
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, reco 99.59
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 99.53
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 99.53
KOG0350620 consensus 99.44
COG1205 851 Distinct helicase family with a unique C-terminal domai 99.4
KOG0345567 consensus 99.38
KOG0333673 consensus 99.21
KOG0951 1674 consensus 99.16
KOG0342543 consensus 99.12
KOG0351 941 consensus 98.98
KOG0348708 consensus 98.96
PRK114481126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 98.91
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 98.82
KOG0352641 consensus 98.44
KOG0346569 consensus 98.32
COG4096875 HsdR Type I site-specific restriction-modification syst 98.03
KOG0341610 consensus 97.97
KOG0353695 consensus 97.81
KOG0922674 consensus 95.27
KOG0923902 consensus 90.69
pfam0255998 CarD_TRCF CarD-like/TRCF domain. CarD is a Myxococcus x 99.91
pfam03461101 TRCF TRCF domain. 99.89
PTZ00110602 helicase; Provisional 99.88
PRK09694878 hypothetical protein; Provisional 99.38
KOG0330476 consensus 99.35
KOG0343758 consensus 98.98
KOG1123776 consensus 94.37
TIGR00595524 priA primosomal protein N'; InterPro: IPR005259 All pro 99.84
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recombinati 99.76
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 99.49
TIGR01587424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 99.11
KOG0326459 consensus 99.02
KOG0332477 consensus 98.83
KOG0347731 consensus 98.72
KOG0344593 consensus 98.5
KOG0349725 consensus 97.29
KOG0329387 consensus 96.67
KOG0925699 consensus 95.51
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 99.78
smart00487201 DEXDc DEAD-like helicases superfamily. 99.72
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 99.63
pfam04851103 ResIII Type III restriction enzyme, res subunit. 99.17
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 99.14
pfam00176295 SNF2_N SNF2 family N-terminal domain. This domain is fo 98.37
KOG0387 923 consensus 97.47
COG1200677 RecG RecG-like helicase [DNA replication, recombination 96.68
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family [Tra 96.52
KOG0386 1157 consensus 91.88
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 99.7
KOG0354746 consensus 99.63
smart0049082 HELICc helicase superfamily c-terminal domain. 99.14
pfam0027178 Helicase_C Helicase conserved C-terminal domain. The Pr 99.13
KOG09491330 consensus 90.69
KOG0952 1230 consensus 99.41
KOG0950 1008 consensus 97.55
KOG03921549 consensus 95.77
KOG0385 971 consensus 95.5
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.38
KOG0920924 consensus 97.43
KOG09241042 consensus 93.83
PRK094011176 reverse gyrase; Reviewed 99.35
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.34
COG11101187 Reverse gyrase [DNA replication, recombination, and rep 99.16
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 97.38
PRK13766764 Hef nuclease; Provisional 96.17
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 95.98
smart00487201 DEXDc DEAD-like helicases superfamily. 95.54
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 95.39
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 95.2
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 94.92
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 94.89
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 94.25
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 94.1
TIGR00595524 priA primosomal protein N'; InterPro: IPR005259 All pro 93.37
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 93.13
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 92.93
pfam00004131 AAA ATPase family associated with various cellular acti 90.02
PRK04914 955 ATP-dependent helicase HepA; Validated 99.24
KOG4284 980 consensus 98.85
PRK111311295 ATP-dependent RNA helicase HrpA; Provisional 98.78
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 96.34
PRK02362736 ski2-like helicase; Provisional 95.91
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 94.44
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 94.12
PRK00254717 ski2-like helicase; Provisional 92.45
pfam06745231 KaiC KaiC. This family represents a conserved region wi 90.29
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 98.7
KOG0337529 consensus 98.18
PRK05298657 excinuclease ABC subunit B; Provisional 98.08
PRK09506839 mrcB penicillin-binding protein 1b; Reviewed 97.99
TIGR02071742 PBP_1b penicillin-binding protein 1B; InterPro: IPR0118 97.57
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 91.97
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 97.97
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 97.59
PRK08074932 bifunctional ATP-dependent DNA helicase/DNA polymerase 97.95
COG0556663 UvrB Helicase subunit of the DNA excision repair comple 97.6
PRK12901 1111 secA preprotein translocase subunit SecA; Reviewed 95.32
PRK12899969 secA preprotein translocase subunit SecA; Reviewed 92.98
COG4889 1518 Predicted helicase [General function prediction only] 97.55
PRK094011176 reverse gyrase; Reviewed 97.14
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 97.44
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 94.34
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polymerase 93.38
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.41
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 92.34
COG11101187 Reverse gyrase [DNA replication, recombination, and rep 97.29
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 91.43
TIGR01389607 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR0062 97.04
PRK05580699 primosome assembly protein PriA; Validated 96.77
PTZ00110602 helicase; Provisional 95.57
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 95.0
pfam07517381 SecA_DEAD SecA DEAD-like domain. SecA protein binds to 96.62
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.38
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 95.19
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 96.51
PRK13107908 preprotein translocase subunit SecA; Reviewed 94.79
COG1329166 Transcriptional regulators, similar to M. xanthus CarD 96.42
TIGR02621975 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-sub 92.54
PRK08116262 hypothetical protein; Validated 96.41
PRK07952242 DNA replication protein DnaC; Validated 93.04
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 92.99
PRK08939306 primosomal protein DnaI; Reviewed 92.16
PRK12904833 preprotein translocase subunit SecA; Reviewed 96.31
PRK12903885 secA preprotein translocase subunit SecA; Reviewed 95.82
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 96.2
PRK12898673 secA preprotein translocase subunit SecA; Reviewed 96.15
PRK12900983 secA preprotein translocase subunit SecA; Reviewed 95.23
PRK12906823 secA preprotein translocase subunit SecA; Reviewed 96.06
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 95.8
PRK09200799 preprotein translocase subunit SecA; Reviewed 95.76
PRK12326775 preprotein translocase subunit SecA; Reviewed 95.41
PRK12902946 secA preprotein translocase subunit SecA; Reviewed 95.19
CHL00122891 secA preprotein translocase subunit SecA; Validated 95.92
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 95.83
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.76
cd01124187 KaiC KaiC is a circadian clock protein primarily found 92.16
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 95.72
TIGR01970 858 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IP 95.43
smart00382148 AAA ATPases associated with a variety of cellular activ 95.42
PRK06526254 transposase; Provisional 91.08
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 90.79
PRK12377248 putative replication protein; Provisional 95.18
COG1484254 DnaC DNA replication protein [DNA replication, recombin 93.8
KOG0953700 consensus 94.86
KOG0389941 consensus 94.45
smart0049082 HELICc helicase superfamily c-terminal domain. 94.37
pfam0027178 Helicase_C Helicase conserved C-terminal domain. The Pr 93.78
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 93.5
CHL00195491 ycf46 Ycf46; Provisional 90.95
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 90.77
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, RNA h 92.99
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 92.95
KOG1205282 consensus 91.46
PRK06067241 flagellar accessory protein FlaH; Validated 90.87
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor; InterPro: IPR004576 All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transcribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG; InterPro: IPR004609 The ATP-dependent DNA helicase RecG 3 Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 All proteins in this family for which functions are known are DNA helicases that function in the nucleotide excision repair and are endonucleases that make the 3' incision next to DNA damage Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0344 consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0331 consensus Back     alignment and domain information
>KOG0338 consensus Back     alignment and domain information
>KOG0335 consensus Back     alignment and domain information
>KOG0328 consensus Back     alignment and domain information
>KOG0340 consensus Back     alignment and domain information
>KOG0339 consensus Back     alignment and domain information
>KOG0327 consensus Back     alignment and domain information
>KOG0334 consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family; InterPro: IPR004589 The ATP-dependent DNA helicase RecQ (3 Back     alignment and domain information
>KOG0336 consensus Back     alignment and domain information
>KOG0947 consensus Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0948 consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0350 consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0345 consensus Back     alignment and domain information
>KOG0333 consensus Back     alignment and domain information
>KOG0951 consensus Back     alignment and domain information
>KOG0342 consensus Back     alignment and domain information
>KOG0351 consensus Back     alignment and domain information
>KOG0348 consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0352 consensus Back     alignment and domain information
>KOG0346 consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0341 consensus Back     alignment and domain information
>KOG0353 consensus Back     alignment and domain information
>KOG0922 consensus Back     alignment and domain information
>KOG0923 consensus Back     alignment and domain information
>pfam02559 CarD_TRCF CarD-like/TRCF domain Back     alignment and domain information
>pfam03461 TRCF TRCF domain Back     alignment and domain information