254780946

254780946

hypothetical protein CLIBASIA_04225

GeneID in NCBI database:8209968Locus tag:CLIBASIA_04225
Protein GI in NCBI database:254780946Protein Accession:YP_003065359.1
Gene range:+(937816, 938112)Protein Length:98aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:hypothetical protein; K09159 hypothetical protein
SEED prediction:YgfY
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHcc
cccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHccccccHHccHHHHHHHHHHHHHcHHHHHHccccc
mkknmnlqcRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFkwftgmekppeylrtpiFKKIYDYYSNNLDRKNMLGSLQ
mkknmnlqcrkIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGmekppeylrtpiFKKIYDYYSNNLDRKNMLGSLQ
MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ
******L*CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDYYSN************
MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ
*KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRK*M*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ
MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ
MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target98 hypothetical protein CLIBASIA_04225 [Candidatus Liberib
31512235975 hypothetical protein CKC_03055 [Candidatus Liberibacter 1 4e-26
163760201107 hypothetical protein HPDFL43_08064 [Hoeflea phototrophi 1 9e-15
222085972104 hypothetical protein Arad_2362 [Agrobacterium radiobact 1 8e-14
159184914103 hypothetical protein Atu1779 [Agrobacterium tumefaciens 1 1e-13
15424818198 hypothetical protein Xaut_4261 [Xanthobacter autotrophi 1 2e-13
15842284498 hypothetical protein AZC_1220 [Azorhizobium caulinodans 1 2e-13
18858386198 hypothetical protein Mpop_4675 [Methylobacterium populi 1 2e-13
325293165103 hypothetical protein AGROH133_06781 [Agrobacterium sp. 1 3e-13
190891738127 hypothetical protein RHECIAT_CH0002144 [Rhizobium etli 1 9e-13
241204638101 hypothetical protein Rleg_1913 [Rhizobium leguminosarum 1 9e-13
>gi|315122359|ref|YP_004062848.1| hypothetical protein CKC_03055 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 75 Back     alignment and organism information
 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%)

Query: 24 MDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDY 83
          MD ILGSFVD FIL+LS +EL MLESIIEEDDSNLFKWFTG+EK PE+L TPIFKKI DY
Sbjct: 1  MDFILGSFVDQFILDLSPIELDMLESIIEEDDSNLFKWFTGIEKVPEHLCTPIFKKICDY 60

Query: 84 YSNNLDRKNMLGSLQ 98
          YS NL+ KN+LGSLQ
Sbjct: 61 YSINLNHKNILGSLQ 75


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163760201|ref|ZP_02167284.1| hypothetical protein HPDFL43_08064 [Hoeflea phototrophica DFL-43] Length = 107 Back     alignment and organism information
>gi|222085972|ref|YP_002544504.1| hypothetical protein Arad_2362 [Agrobacterium radiobacter K84] Length = 104 Back     alignment and organism information
>gi|159184914|ref|NP_354764.2| hypothetical protein Atu1779 [Agrobacterium tumefaciens str. C58] Length = 103 Back     alignment and organism information
>gi|154248181|ref|YP_001419139.1| hypothetical protein Xaut_4261 [Xanthobacter autotrophicus Py2] Length = 98 Back     alignment and organism information
>gi|158422844|ref|YP_001524136.1| hypothetical protein AZC_1220 [Azorhizobium caulinodans ORS 571] Length = 98 Back     alignment and organism information
>gi|188583861|ref|YP_001927306.1| hypothetical protein Mpop_4675 [Methylobacterium populi BJ001] Length = 98 Back     alignment and organism information
>gi|325293165|ref|YP_004279029.1| hypothetical protein AGROH133_06781 [Agrobacterium sp. H13-3] Length = 103 Back     alignment and organism information
>gi|190891738|ref|YP_001978280.1| hypothetical protein RHECIAT_CH0002144 [Rhizobium etli CIAT 652] Length = 127 Back     alignment and organism information
>gi|241204638|ref|YP_002975734.1| hypothetical protein Rleg_1913 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 101 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target98 hypothetical protein CLIBASIA_04225 [Candidatus Liberib
pfam0393751 pfam03937, Sdh5, Protein of unknown function (DUF339) 2e-13
KOG3326154 KOG3326, KOG3326, KOG3326, Uncharacterized conserved pr 1e-05
COG293894 COG2938, COG2938, Uncharacterized conserved protein [Fu 8e-14
>gnl|CDD|146523 pfam03937, Sdh5, Protein of unknown function (DUF339) Back     alignment and domain information
>gnl|CDD|38536 KOG3326, KOG3326, KOG3326, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|32761 COG2938, COG2938, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 98 hypothetical protein CLIBASIA_04225 [Candidatus Liberib
COG293894 Uncharacterized conserved protein [Function unknown] 99.92
KOG3326154 consensus 99.86
pfam0393751 Sdh5 Protein of unknown function (DUF339). This family 99.74
PRK1087872 hypothetical protein; Provisional 99.67
>COG2938 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3326 consensus Back     alignment and domain information
>pfam03937 Sdh5 Protein of unknown function (DUF339) Back     alignment and domain information
>PRK10878 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target98 hypothetical protein CLIBASIA_04225 [Candidatus Liberib
2jr5_A94 Solution Structure Of Upf0350 Protein Vc_2471. Nort 1e-15
1x6i_A91 Crystal Structure Of Ygfy From Escherichia Coli Len 1e-14
1puz_A82 Solution Nmr Structure Of Protein Nma1147 From Neis 7e-11
>gi|157835280|pdb|2JR5|A Chain A, Solution Structure Of Upf0350 Protein Vc_2471. Northeast Structural Genomics Target Vcr36 Length = 94 Back     alignment and structure
 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          Q  +I +   RRG  E+D+++  F +     L+  E     +++E DD +LF W  G  +
Sbjct: 6  QKARIKW-ACRRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMGHGR 64

Query: 68 PPEYLRTPIFKKIYDYYSNNLD 89
                  +  KI  +  + + 
Sbjct: 65 CENLGLAAMVDKIVAHNLSKVR 86


>gi|61680288|pdb|1X6I|A Chain A, Crystal Structure Of Ygfy From Escherichia Coli Length = 91 Back     alignment and structure
gi|50513319|pdb|1PUZ|A Chain A, Solution Nmr Structure Of Protein Nma1147 From Neisseria Meningitidis. Northeast Structural Genomics Consortium Target Mr19 Length = 82 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target98 hypothetical protein CLIBASIA_04225 [Candidatus Liberib
1puz_A82 Conserved hypothetical protein; NMA1147, MR19, structur 4e-15
2jr5_A94 UPF0350 protein VC_2471; structure, structural genomics 1e-14
1x6i_A91 Hypothetical protein YGFY; structural genomics, transcr 6e-14
>1puz_A Conserved hypothetical protein; NMA1147, MR19, structural genomics, PSI, protein structure initiative; NMR {Neisseria meningitidis MC58} SCOP: a.218.1.1 Length = 82 Back     alignment and structure
 Score = 74.7 bits (184), Expect = 4e-15
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G  +  
Sbjct: 10 RKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETD 68

Query: 70 EYLRTPIFKKI 80
          +    P+ +KI
Sbjct: 69 KGHLIPMLEKI 79


>2jr5_A UPF0350 protein VC_2471; structure, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Vibrio cholerae} Length = 94 Back     alignment and structure
>1x6i_A Hypothetical protein YGFY; structural genomics, transcriptional regulation, structure 2 function project, S2F, unknown function; 1.20A {Escherichia coli} PDB: 1x6j_A Length = 91 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target98 hypothetical protein CLIBASIA_04225 [Candidatus Liberib
2jr5_A94 UPF0350 protein VC_2471; structure, structural genomics 99.93
1puz_A82 Conserved hypothetical protein; NMA1147, MR19, structur 99.93
1x6i_A91 Hypothetical protein YGFY; structural genomics, transcr 99.92
>2jr5_A UPF0350 protein VC_2471; structure, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Vibrio cholerae} Back     alignment and structure
Probab=99.93  E-value=3.8e-26  Score=170.63  Aligned_cols=86  Identities=23%  Similarity=0.419  Sum_probs=81.7

Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99999999999740789999999999999820299999999999946891799999948899980675699999999998
Q gi|254780946|r    6 NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDYYS   85 (98)
Q Consensus         6 d~~~krl~~Rs~rRG~kElDllL~~F~~~~~~~l~~~el~~f~~LL~~~D~dL~~wl~~~~~~p~~~~~~ii~~I~~f~~   85 (98)
                      ..+++||+||| ||||+|||+|||+|+++++++++++++.+|+.||+++|+|||+|++|+++||+...++++++|++|..
T Consensus         4 ~~~~~RL~wrs-RRG~kElDllL~~F~~~~~~~ls~~el~~fe~LL~~eD~dL~dwl~g~~~~~d~~~~~ii~kI~~~~~   82 (94)
T 2jr5_A            4 AEQKARIKWAC-RRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMGHGRCENLGLAAMVDKIVAHNL   82 (94)
T ss_dssp             HHHHHHHHHHH-CCSSHHHHHTTTTHHHHHTTTCCHHHHHHHHHHHTSCCHHHHHHHHTCCCCSCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHH-CCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             79998999982-14459999969999999998699999999999980992999999958999998999999999999999


Q ss_pred             HHHHHHH
Q ss_conf             2277656
Q gi|254780946|r   86 NNLDRKN   92 (98)
Q Consensus        86 ~~~~~~~   92 (98)
                      +++..+.
T Consensus        83 ~k~~~~~   89 (94)
T 2jr5_A           83 SKVRLEH   89 (94)
T ss_dssp             HHHHHHC
T ss_pred             HHHHHHH
T ss_conf             8640230



>1puz_A Conserved hypothetical protein; NMA1147, MR19, structural genomics, PSI, protein structure initiative; NMR {Neisseria meningitidis MC58} SCOP: a.218.1.1 Back     alignment and structure
>1x6i_A Hypothetical protein YGFY; structural genomics, transcriptional regulation, structure 2 function project, S2F, unknown function; 1.20A {Escherichia coli} PDB: 1x6j_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 98 hypothetical protein CLIBASIA_04225 [Candidatus Liberib
d1puza_82 a.218.1.1 (A:) Hypothetical protein NMA1147 {Neisseria 2e-14
>d1puza_ a.218.1.1 (A:) Hypothetical protein NMA1147 {Neisseria meningitidis, mc58 [TaxId: 487]} Length = 82 Back     information, alignment and structure

class: All alpha proteins
fold: YgfY-like
superfamily: YgfY-like
family: YgfY-like
domain: Hypothetical protein NMA1147
species: Neisseria meningitidis, mc58 [TaxId: 487]
 Score = 71.7 bits (176), Expect = 2e-14
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G  +  
Sbjct: 10 RKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETD 68

Query: 70 EYLRTPIFKKI 80
          +    P+ +KI
Sbjct: 69 KGHLIPMLEKI 79


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target98 hypothetical protein CLIBASIA_04225 [Candidatus Liberib
d1puza_82 Hypothetical protein NMA1147 {Neisseria meningitidis, m 99.92
>d1puza_ a.218.1.1 (A:) Hypothetical protein NMA1147 {Neisseria meningitidis, mc58 [TaxId: 487]} Back     information, alignment and structure
class: All alpha proteins
fold: YgfY-like
superfamily: YgfY-like
family: YgfY-like
domain: Hypothetical protein NMA1147
species: Neisseria meningitidis, mc58 [TaxId: 487]
Probab=99.92  E-value=9.4e-26  Score=166.99  Aligned_cols=81  Identities=31%  Similarity=0.457  Sum_probs=78.1

Q ss_pred             CCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHH
Q ss_conf             98658999999999997407899999999999998202999999999999468917999999488999806756999999
Q gi|254780946|r    1 MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI   80 (98)
Q Consensus         1 M~~~ld~~~krl~~Rs~rRG~kElDllL~~F~~~~~~~l~~~el~~f~~LL~~~D~dL~~wl~~~~~~p~~~~~~ii~~I   80 (98)
                      ||..-|.++|||+||| ||||+|+|+|||+|+++++++++++++.+|+.||+++|+|||+|++|+++||+...++|+++|
T Consensus         1 m~~~~d~~~krl~~r~-rRG~kElDllL~~F~~~~~~~l~~~el~~f~~lL~~~D~dL~~wl~g~~~~p~~~~~~ii~~I   79 (82)
T d1puza_           1 MMVFDDIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETDKGHLIPMLEKI   79 (82)
T ss_dssp             CCCCCHHHHHHHHHHS-CCSCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHTSCHHHHHHHHHTCSCCSCTTHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHH-CCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             9755288998999983-035299999999999999987999999999999839859999999189999929899999998


Q ss_pred             HH
Q ss_conf             99
Q gi|254780946|r   81 YD   82 (98)
Q Consensus        81 ~~   82 (98)
                      +.
T Consensus        80 rk   81 (82)
T d1puza_          80 RR   81 (82)
T ss_dssp             HH
T ss_pred             HC
T ss_conf             71



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 98 hypothetical protein CLIBASIA_04225 [Candidatus Li
1x6i_A_91 (A:) Hypothetical protein YGFY; structural genomic 7e-18
1puz_A_82 (A:) Conserved hypothetical protein; NMA1147, MR19 7e-16
>1x6i_A (A:) Hypothetical protein YGFY; structural genomics, transcriptional regulation, structure 2 function project, S2F, unknown function; 1.20A {Escherichia coli} PDB: 1x6j_ALength = 91 Back     alignment and structure
 Score = 84.0 bits (208), Expect = 7e-18
 Identities = 21/84 (25%), Positives = 38/84 (45%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W  
Sbjct: 3  HMDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLM 62

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
             KP +     + + I       
Sbjct: 63 NHGKPADAELEMMVRLIQTRNRER 86


>1puz_A (A:) Conserved hypothetical protein; NMA1147, MR19, structural genomics, PSI, protein structure initiative; NMR {Neisseria meningitidis MC58}Length = 82 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target98 hypothetical protein CLIBASIA_04225 [Candidatus Liberib
1x6i_A_91 Hypothetical protein YGFY; structural genomics, tr 99.94
1puz_A_82 Conserved hypothetical protein; NMA1147, MR19, str 99.93
2jr5_A_33-9462 UPF0350 protein VC_2471; structure, structural gen 99.15
>1x6i_A (A:) Hypothetical protein YGFY; structural genomics, transcriptional regulation, structure 2 function project, S2F, unknown function; 1.20A {Escherichia coli} PDB: 1x6j_A Back     alignment and structure
Probab=99.94  E-value=7.5e-27  Score=175.62  Aligned_cols=87  Identities=24%  Similarity=0.386  Sum_probs=82.9

Q ss_pred             CCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             65899999999999740789999999999999820299999999999946891799999948899980675699999999
Q gi|254780946|r    3 KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYD   82 (98)
Q Consensus         3 ~~ld~~~krl~~Rs~rRG~kElDllL~~F~~~~~~~l~~~el~~f~~LL~~~D~dL~~wl~~~~~~p~~~~~~ii~~I~~   82 (98)
                      ++++.+++|++||||||||+|+|+|||+|++++++++|+++++.|+.||+++|+|||+|++|+++||+...++++++|++
T Consensus         2 e~~d~~~~r~l~~~~rRG~~ElDliL~~F~~~~~~~ls~~el~~fe~LL~~~D~dL~~wl~g~~~~p~~~~~~ii~~i~~   81 (91)
T 1x6i_A            2 SHMDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGKPADAELEMMVRLIQT   81 (91)
T ss_dssp             -CCCTTCHHHHHHHTCCSSHHHHHHHHHHHHHHGGGSCHHHHHHHHHHHTSCHHHHHHHHTTSSBCSSHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             87566679898988104619999999999999998799999999999983990999999948999999999999999999


Q ss_pred             HHHHHHH
Q ss_conf             9982277
Q gi|254780946|r   83 YYSNNLD   89 (98)
Q Consensus        83 f~~~~~~   89 (98)
                      |++++..
T Consensus        82 ~~~~~~~   88 (91)
T 1x6i_A           82 RNRERGP   88 (91)
T ss_dssp             HHHHHSC
T ss_pred             HHHCCCC
T ss_conf             7060388



>1puz_A (A:) Conserved hypothetical protein; NMA1147, MR19, structural genomics, PSI, protein structure initiative; NMR {Neisseria meningitidis MC58} Back     alignment and structure
>2jr5_A (A:33-94) UPF0350 protein VC_2471; structure, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Vibrio cholerae} Back     alignment and structure