254780948

254780948

DNA repair protein RecO

GeneID in NCBI database:8209970Locus tag:CLIBASIA_04235
Protein GI in NCBI database:254780948Protein Accession:YP_003065361.1
Gene range:+(942603, 943325)Protein Length:240aa
Gene description:DNA repair protein RecO
COG prediction:[L] Recombinational DNA repair protein (RecF pathway)
KEGG prediction:recO; DNA repair protein RecO; K03584 DNA repair protein RecO (recombination protein O)
SEED prediction:DNA recombination and repair protein RecO
Pathway involved in KEGG:Homologous recombination [PATH:las03440]
Subsystem involved in SEED:DNA repair, bacterial RecFOR pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI
ccccccEEEEEEcccccHHHHHHHccccccEEEEEEEccccccHHHHcccccEEEEEEEEEcccccccEEEEEHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccEEEEccccccccccccEEEEHHHccEEcHHHcccHHHHHHcccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHc
ccccccEEEEEEcccccccEEEEEEccccccEEEEEEccccccccccccccccEEEEEEEEcccccccEEEcHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHcccccccccEEEEcccccccEcHHccccHHHHcccccHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHc
MYWQDDAIILGVRSYGEKNIILEVMTRQYgrhlgfvrngqshrmqpilqagnLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSivplfrflperepclELYDMLNIFLnchkipsvIGKIFVQIELMLLKNigfgldltKCVVTGVTQdllwvspksggavcrsvglpyaekmlVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI
mywqddaiILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI
MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI
MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI
MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI
*YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI
MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI
MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target240 DNA repair protein RecO [Candidatus Liberibacter asiati
315122361240 DNA repair protein RecO [Candidatus Liberibacter solana 1 1e-108
227821417276 DNA repair protein RecO [Sinorhizobium fredii NGR234] L 1 5e-63
307320728259 DNA repair protein RecO [Sinorhizobium meliloti AK83] L 1 6e-63
20139557247 RecName: Full=DNA repair protein recO; AltName: Full=Re 1 8e-63
150395917249 DNA repair protein RecO [Sinorhizobium medicae WSM419] 1 8e-63
195970186259 DNA repair protein RecO [Sinorhizobium meliloti 1021] L 1 1e-62
325292418254 DNA repair protein RecO [Agrobacterium sp. H13-3] Lengt 1 3e-62
209548606256 DNA repair protein RecO [Rhizobium leguminosarum bv. tr 1 7e-62
15888381254 DNA repair protein RecO [Agrobacterium tumefaciens str. 1 1e-61
116251281256 DNA repair protein RecO [Rhizobium leguminosarum bv. vi 1 2e-61
>gi|315122361|ref|YP_004062850.1| DNA repair protein RecO [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 240 Back     alignment and organism information
 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 182/240 (75%), Positives = 217/240 (90%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+WQDDAI+LGVRSYGEKNIILEVMTR YGRHLGFVR GQS R+QP+LQ GNLVRVNWRS
Sbjct: 1   MHWQDDAIVLGVRSYGEKNIILEVMTRHYGRHLGFVRYGQSRRIQPVLQVGNLVRVNWRS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL Q+LGEFR E++E  C+KLLSS++ LYGLQS++P+FRFLPER+PC +LYD+LN+F+N 
Sbjct: 61  RLEQDLGEFRLEIIEYRCSKLLSSAISLYGLQSMIPIFRFLPERDPCPDLYDLLNLFINS 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           HKI S++GKIF+QIEL+LLKNIGFGL++TKCVVTGV+ DL WVSPKSGGA+C S+GLPYA
Sbjct: 121 HKISSILGKIFIQIELILLKNIGFGLEITKCVVTGVSHDLSWVSPKSGGAICHSLGLPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
            KMLVLP FLWKE+Q IDADSL++AF+LT YFL+KYA QHNIIHC+ LR NFL KL+EL+
Sbjct: 181 SKMLVLPLFLWKEQQNIDADSLRNAFRLTGYFLDKYAFQHNIIHCNSLRINFLNKLIELL 240


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821417|ref|YP_002825387.1| DNA repair protein RecO [Sinorhizobium fredii NGR234] Length = 276 Back     alignment and organism information
>gi|307320728|ref|ZP_07600140.1| DNA repair protein RecO [Sinorhizobium meliloti AK83] Length = 259 Back     alignment and organism information
>gi|20139557|sp|Q92KH5|RECO_RHIME RecName: Full=DNA repair protein recO; AltName: Full=Recombination protein O Length = 247 Back     alignment and organism information
>gi|150395917|ref|YP_001326384.1| DNA repair protein RecO [Sinorhizobium medicae WSM419] Length = 249 Back     alignment and organism information
>gi|195970186|ref|NP_385194.3| DNA repair protein RecO [Sinorhizobium meliloti 1021] Length = 259 Back     alignment and organism information
>gi|325292418|ref|YP_004278282.1| DNA repair protein RecO [Agrobacterium sp. H13-3] Length = 254 Back     alignment and organism information
>gi|209548606|ref|YP_002280523.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 256 Back     alignment and organism information
>gi|15888381|ref|NP_354062.1| DNA repair protein RecO [Agrobacterium tumefaciens str. C58] Length = 254 Back     alignment and organism information
>gi|116251281|ref|YP_767119.1| DNA repair protein RecO [Rhizobium leguminosarum bv. viciae 3841] Length = 256 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target240 DNA repair protein RecO [Candidatus Liberibacter asiati
PRK00085247 PRK00085, recO, DNA repair protein RecO; Reviewed 7e-41
TIGR00613241 TIGR00613, reco, DNA repair protein RecO 1e-20
COG1381251 COG1381, RecO, Recombinational DNA repair protein (RecF 1e-30
pfam02565156 pfam02565, RecO_C, Recombination protein O C terminal 1e-11
pfam1196780 pfam11967, RecO_N, Recombination protein O N terminal 2e-11
>gnl|CDD|178852 PRK00085, recO, DNA repair protein RecO; Reviewed Back     alignment and domain information
>gnl|CDD|161959 TIGR00613, reco, DNA repair protein RecO Back     alignment and domain information
>gnl|CDD|31571 COG1381, RecO, Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|145610 pfam02565, RecO_C, Recombination protein O C terminal Back     alignment and domain information
>gnl|CDD|152402 pfam11967, RecO_N, Recombination protein O N terminal Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 240 DNA repair protein RecO [Candidatus Liberibacter asiati
PRK00085235 recO DNA repair protein RecO; Reviewed 100.0
TIGR00613250 reco DNA repair protein RecO; InterPro: IPR003717 The d 100.0
COG1381251 RecO Recombinational DNA repair protein (RecF pathway) 100.0
pfam1196780 RecO_N Recombination protein O N terminal. Recombinatio 99.67
pfam02565156 RecO_C Recombination protein O C terminal. Recombinatio 99.6
PRK13908204 putative recombination protein RecO; Provisional 97.62
COG5347 319 GTPase-activating protein that regulates ARFs (ADP-ribo 93.18
>PRK00085 recO DNA repair protein RecO; Reviewed Back     alignment and domain information
>TIGR00613 reco DNA repair protein RecO; InterPro: IPR003717 The damage avoidance-tolerance pathway(s) requires functional recA, recF, recO, and recR genes, suggesting the mechanism to be daughter strand gap repair Back     alignment and domain information
>COG1381 RecO Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam11967 RecO_N Recombination protein O N terminal Back     alignment and domain information
>pfam02565 RecO_C Recombination protein O C terminal Back     alignment and domain information
>PRK13908 putative recombination protein RecO; Provisional Back     alignment and domain information
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target240 DNA repair protein RecO [Candidatus Liberibacter asiati
3q8d_A242 E. Coli Reco Complex With Ssb C-Temrinus Length = 2 1e-25
1u5k_A244 Recombinational Repair Protein Reco Length = 244 6e-07
gi|332138214|pdb|3Q8D|A Chain A, E. Coli Reco Complex With Ssb C-Temrinus Length = 242 Back     alignment and structure
 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +     +         + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


gi|56554135|pdb|1U5K|A Chain A, Recombinational Repair Protein Reco Length = 244 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target240 DNA repair protein RecO [Candidatus Liberibacter asiati
1u5k_A244 Hypothetical protein; OBD-fold, Zn-binding, recombinati 7e-18
>1u5k_A Hypothetical protein; OBD-fold, Zn-binding, recombination,replication; 2.00A {Deinococcus radiodurans R1} SCOP: b.40.4.13 g.45.1.2 PDB: 1w3s_A 2v1c_C Length = 244 Back     alignment and structure
 Score = 86.0 bits (212), Expect = 7e-18
 Identities = 34/221 (15%), Positives = 65/221 (29%), Gaps = 10/221 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
                 I++  R     +II+ ++T Q G+     R G    +   L   + V V     
Sbjct: 5   TANRSGIVIRRRVTPAGDIIVTLLTPQ-GKLKAIARGGVKGPLSSSLNLFHHVGVQVYQG 63

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
              +L   +  VLE     L     + +             E E   + +D+    L   
Sbjct: 64  PHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGV 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR-------- 173
                   + + +   LL   G      +C   G   D     P  G  +C         
Sbjct: 124 AHQPDPEWVALVMSYKLLGLAGVIPQTARCARCG-APDPEHPDPLGGQLLCSKCAALPPY 182

Query: 174 SVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN 214
              +    +  V  +     EQ + +    + ++  + F+ 
Sbjct: 183 PPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVT 223


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target240 DNA repair protein RecO [Candidatus Liberibacter asiati
1u5k_A244 Hypothetical protein; OBD-fold, Zn-binding, recombinati 100.0
>1u5k_A Hypothetical protein; OBD-fold, Zn-binding, recombination,replication; 2.00A {Deinococcus radiodurans R1} SCOP: b.40.4.13 g.45.1.2 PDB: 1w3s_A 2v1c_C Back     alignment and structure
Probab=100.00  E-value=3.9e-37  Score=245.02  Aligned_cols=213  Identities=15%  Similarity=0.150  Sum_probs=170.6

Q ss_pred             CEEEEEEEEEECCCCCHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCHHHHHCCCCHHH
Q ss_conf             50001699830358802447542272128699999667675532000344314799821577765431012210142221
Q gi|254780948|r    2 YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKL   81 (240)
Q Consensus         2 ~~~d~giVL~~~~~~E~~~Iv~~~T~~~G~~~~i~rG~~~~k~~~~lq~~~~~~~~~~~k~~~~l~~~~~e~~~~~~~~~   81 (240)
                      .|+++||||++++|||+|+||++||++ |+++++|||+||+|.++.+||++.+++.|..+....+...+...+.++.+..
T Consensus         5 ~~~~egiVL~~~~~~E~d~iv~l~T~~-G~i~~~akG~rksk~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~   83 (244)
T 1u5k_A            5 TANRSGIVIRRRVTPAGDIIVTLLTPQ-GKLKAIARGGVKGPLSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTL   83 (244)
T ss_dssp             EEEEEEEEEEEEECTTSCEEEEEEETT-EEEEEEETTCTTSTTTTTSCTTCEEEEEEECCCC-CCEEEEEEEEEECCGGG
T ss_pred             CCCCCEEEEECEECCCCCEEEEEECCC-CCEEEEECCCCCCCCCCCCCCCCCCCHHHEECCCCCEEEEEEECCCCHHHHH
T ss_conf             457727999642438746899999788-8189998067678876643776310022122278872788740224444554


Q ss_pred             CCCCHHHHHHHHHHHH-HHHHCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCCCC
Q ss_conf             0440589999999999-996213566767899999999961223430137999999999983767661221023555662
Q gi|254780948|r   82 LSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDL  160 (240)
Q Consensus        82 ~~~~~~l~~~~~~~~l-~~~l~e~e~~~~lf~~l~~~L~~l~~~~~~~~~~~~fEl~LL~~lGf~p~L~~C~~cg~~~~l  160 (240)
                       .|..++.++.+++++ .+++++++|++.+|+++..+|+.++....+...++.||+++|+.+||+|++++|++||..+ .
T Consensus        84 -~d~~~~~~a~~i~El~~~~~~~~~~~~~lf~ll~~~L~~l~~~~~~~~~~~~F~lklL~~~G~~p~l~~C~~cg~~~-~  161 (244)
T 1u5k_A           84 -AEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPD-P  161 (244)
T ss_dssp             -GSHHHHHHHHHHHHHHHHHSCTTCCCHHHHHHHHHHHHHHHHSSCHHHHHHHHHHHHHTTSSSCCCCSBCTTTCCBS-C
T ss_pred             -CCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHCCCCCC-C
T ss_conf             -28999999999999999975037973899999999999971689839999999999999706385320030389968-7


Q ss_pred             EEEEECCCCHHHHCCCCCCCC--HHHHHHHHHHCC------CCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             244301210011102475320--000123455225------678998999999989999998565
Q gi|254780948|r  161 LWVSPKSGGAVCRSVGLPYAE--KMLVLPSFLWKE------EQTIDADSLKSAFQLTDYFLNKYA  217 (240)
Q Consensus       161 ~~~s~~~g~av~~~~~~~~~~--kll~lp~fL~~~------~~~~~~~~i~~~l~lt~~fL~k~~  217 (240)
                      .++++..||.||..|+....-  ..+.+-..+...      ....+..+..+.+++...|+..|+
T Consensus       162 ~~f~~~~Gg~vC~~c~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~l~~~l~~yl~~Hl  226 (244)
T 1u5k_A          162 EHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQV  226 (244)
T ss_dssp             CEECTTTSSEECTTTCSSCCCCHHHHHHHHHTTTSCHHHHHHSCCCGGGHHHHHHHHHHHHHHHS
T ss_pred             CCEEHHCCEEECCCCCCCCCCCHHHHHHHHHHHHCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             50546209777767767898999999999999806987774155999999999999999999996




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 240 DNA repair protein RecO [Candidatus Liberibacter asiati
d1u5ka2157 g.45.1.2 (A:81-237) Recombinational repair protein RecO 6e-08
d1u5ka179 b.40.4.13 (A:2-80) Recombinational repair protein RecO, 3e-05
>d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Length = 157 Back     information, alignment and structure

class: Small proteins
fold: ArfGap/RecO-like zinc finger
superfamily: ArfGap/RecO-like zinc finger
family: RecO C-terminal domain-like
domain: Recombinational repair protein RecO, C-terminal domain
species: Deinococcus radiodurans [TaxId: 1299]
 Score = 51.6 bits (123), Expect = 6e-08
 Identities = 17/127 (13%), Positives = 34/127 (26%), Gaps = 15/127 (11%)

Query: 99  RFLPEREPCLELYDML---NIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
               E E   + +D+       +     P  +  +       LL   G      +C   G
Sbjct: 21  ALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVM---SYKLLGLAGVIPQTARCARCG 77

Query: 156 VTQDLLWVSPKSGGAVCRSVGLPYA--------EKMLVLPSFLWKEEQTIDADSLKSAFQ 207
              D     P  G  +C                 +  V  +     EQ + +    + ++
Sbjct: 78  -APDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWR 136

Query: 208 LTDYFLN 214
             + F+ 
Sbjct: 137 ALEKFVT 143


>d1u5ka1 b.40.4.13 (A:2-80) Recombinational repair protein RecO, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Length = 79 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target240 DNA repair protein RecO [Candidatus Liberibacter asiati
d1u5ka2157 Recombinational repair protein RecO, C-terminal domain 99.63
d1u5ka179 Recombinational repair protein RecO, N-terminal domain 99.6
>d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Small proteins
fold: ArfGap/RecO-like zinc finger
superfamily: ArfGap/RecO-like zinc finger
family: RecO C-terminal domain-like
domain: Recombinational repair protein RecO, C-terminal domain
species: Deinococcus radiodurans [TaxId: 1299]
Probab=99.63  E-value=1.5e-15  Score=111.78  Aligned_cols=134  Identities=12%  Similarity=0.096  Sum_probs=96.8

Q ss_pred             CCCHHHHHHHHHHHHH-HHHCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCCCCE
Q ss_conf             4405899999999999-962135667678999999999612234301379999999999837676612210235556622
Q gi|254780948|r   83 SSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLL  161 (240)
Q Consensus        83 ~~~~~l~~~~~~~~l~-~~l~e~e~~~~lf~~l~~~L~~l~~~~~~~~~~~~fEl~LL~~lGf~p~L~~C~~cg~~~~l~  161 (240)
                      .|..++++++++++++ ++++|++|++.+|+++..+|..++...+.....+.||+++|+.+||+|+++.|+.||..++ .
T Consensus         4 ~D~~r~~~A~~l~El~~~~~~e~~~~~~lf~ll~~~L~~L~~~~~~~~~~~~f~l~ll~~~G~~P~l~~C~~cg~~~~-~   82 (157)
T d1u5ka2           4 AEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDP-E   82 (157)
T ss_dssp             GSHHHHHHHHHHHHHHHHHSCTTCCCHHHHHHHHHHHHHHHHSSCHHHHHHHHHHHHHTTSSSCCCCSBCTTTCCBSC-C
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHCCCCCCC-C
T ss_conf             029999999999999999823689719999999999999880576159999999999998388877466703899787-7


Q ss_pred             EEEECCCCHHHHCCCCCCCCH--HHHHHHHHHC------CCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             443012100111024753200--0012345522------5678998999999989999998565
Q gi|254780948|r  162 WVSPKSGGAVCRSVGLPYAEK--MLVLPSFLWK------EEQTIDADSLKSAFQLTDYFLNKYA  217 (240)
Q Consensus       162 ~~s~~~g~av~~~~~~~~~~k--ll~lp~fL~~------~~~~~~~~~i~~~l~lt~~fL~k~~  217 (240)
                      ++++..||++|..|+......  ....-..+..      .....+..+..+..++...|+.-|+
T Consensus        83 ~f~~~~Gg~~C~~c~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~r~~l~~~L~~y~~~Hl  146 (157)
T d1u5ka2          83 HPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQV  146 (157)
T ss_dssp             EECTTTSSEECTTTCSSCCCCHHHHHHHHHTTTSCHHHHHHSCCCGGGHHHHHHHHHHHHHHHS
T ss_pred             CCCCCCCEEECCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             5101679257887787677760388999987115766665102899999999999999999998



>d1u5ka1 b.40.4.13 (A:2-80) Recombinational repair protein RecO, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 240 DNA repair protein RecO [Candidatus Liberibacter a
1u5k_A_83-244162 (A:83-244) Hypothetical protein; OBD-fold, Zn-bind 2e-11
1u5k_A_1-8282 (A:1-82) Hypothetical protein; OBD-fold, Zn-bindin 2e-11
>1u5k_A (A:83-244) Hypothetical protein; OBD-fold, Zn-binding, recombination,replication; 2.00A {Deinococcus radiodurans R1}Length = 162 Back     alignment and structure
 Score = 63.8 bits (155), Expect = 2e-11
 Identities = 17/128 (13%), Positives = 34/128 (26%), Gaps = 9/128 (7%)

Query: 97  LFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                 E E   + +D+    L           + + +   LL   G      +C   G 
Sbjct: 17  ADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCG- 75

Query: 157 TQDLLWVSPKSGGAVCRSVGLP--------YAEKMLVLPSFLWKEEQTIDADSLKSAFQL 208
             D     P  G  +C                 +  V  +     EQ + +    + ++ 
Sbjct: 76  APDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRA 135

Query: 209 TDYFLNKY 216
            + F+   
Sbjct: 136 LEKFVTVQ 143


>1u5k_A (A:1-82) Hypothetical protein; OBD-fold, Zn-binding, recombination,replication; 2.00A {Deinococcus radiodurans R1}Length = 82 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target240 DNA repair protein RecO [Candidatus Liberibacter asiati
1u5k_A_83-244162 Hypothetical protein; OBD-fold, Zn-binding, recomb 99.73
1u5k_A_1-8282 Hypothetical protein; OBD-fold, Zn-binding, recomb 99.62
>1u5k_A (A:83-244) Hypothetical protein; OBD-fold, Zn-binding, recombination,replication; 2.00A {Deinococcus radiodurans R1} Back     alignment and structure
Probab=99.73  E-value=2.6e-17  Score=124.87  Aligned_cols=142  Identities=13%  Similarity=0.120  Sum_probs=112.8

Q ss_pred             CCCHHHHHHHHHHHHH-HHHCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCCCCE
Q ss_conf             4405899999999999-962135667678999999999612234301379999999999837676612210235556622
Q gi|254780948|r   83 SSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLL  161 (240)
Q Consensus        83 ~~~~~l~~~~~~~~l~-~~l~e~e~~~~lf~~l~~~L~~l~~~~~~~~~~~~fEl~LL~~lGf~p~L~~C~~cg~~~~l~  161 (240)
                      +|..++++++++++++ +.+++++|++.+|+++..+|+.+++..++....+.||+++|+.+||+|++++|+.||.. +..
T Consensus         2 ~D~~~~~~a~~~~El~~~~~~~~~~~~~lf~ll~~~L~~l~~~~~~~~~~~~f~lklL~~~G~~p~l~~C~~cg~~-~~~   80 (162)
T 1u5k_A            2 AEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAP-DPE   80 (162)
T ss_dssp             GSHHHHHHHHHHHHHHHHHSCTTCCCHHHHHHHHHHHHHHHHSSCHHHHHHHHHHHHHTTSSSCCCCSBCTTTCCB-SCC
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHCCCC-CCC
T ss_conf             2288999999999999987303784799999999999997358844889999999999977489475667504788-876


Q ss_pred             EEEECCCCHHHHCCCCCCC--CHHHHHHHHHHCC------CCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHH
Q ss_conf             4430121001110247532--0000123455225------6789989999999899999985656628999998799
Q gi|254780948|r  162 WVSPKSGGAVCRSVGLPYA--EKMLVLPSFLWKE------EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRE  230 (240)
Q Consensus       162 ~~s~~~g~av~~~~~~~~~--~kll~lp~fL~~~------~~~~~~~~i~~~l~lt~~fL~k~~l~~~~~~~P~sR~  230 (240)
                      +||+++||.||..++....  ...+.+-..+...      ....+.....+..+++..+++.|+     ...++||.
T Consensus        81 ~fs~~~gg~vc~~c~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~l~~il~~~~~~~l-----g~~lkS~~  152 (162)
T 1u5k_A           81 HPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQV-----GGVHSWRQ  152 (162)
T ss_dssp             EECTTTSSEECTTTCSSCCCCHHHHHHHHHTTTSCHHHHHHSCCCGGGHHHHHHHHHHHHHHHS-----CSCCGGGG
T ss_pred             CCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCHHHHHCCCCCHHHHHHHHHHHHHHHHHHH-----CCCCCHHH
T ss_conf             0032139045467655688899999999999826998874057999999999999999999996-----88750677



>1u5k_A (A:1-82) Hypothetical protein; OBD-fold, Zn-binding, recombination,replication; 2.00A {Deinococcus radiodurans R1} Back     alignment and structure