254780949

254780949

tyrosyl-tRNA synthetase

GeneID in NCBI database:8209971Locus tag:CLIBASIA_04240
Protein GI in NCBI database:254780949Protein Accession:YP_003065362.1
Gene range:-(943428, 944684)Protein Length:418aa
Gene description:tyrosyl-tRNA synthetase
COG prediction:[J] Tyrosyl-tRNA synthetase
KEGG prediction:tyrS; tyrosyl-tRNA synthetase (EC:6.1.1.1); K01866 tyrosyl-tRNA synthetase [EC:6.1.1.1]
SEED prediction:Tyrosyl-tRNA synthetase (EC 6.1.1.1), cluster 1
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Tyr
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MPAFKSDFLSILSERGFIHQISNPRELDILCSQGVVTAYIGYDLTASSLHAGHLTQLMLLFWLQKTGHKPISLMGGGTSIIGDPSFRDESRRMMRSQEIQENIEKIKGIFSSFIKYGTGKTDALMLNNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQAYDFVELAKNYDCRLQMGGSDQWGNIICGIDLGERLKTPKLFALTSPLLTTASGTKMGKTLSGAIWLNKEMTSPYNFWQYWRNIDDADVVSFAKRLTTLPMSEIDRMAKLQGKEINEAKKIIATEITTMVHGREEAEKAATAAMECFDMSIHSQHMPTISISKDEVSRGMGLLTLIVKAGFATSTNEARRHLKSNAIKINNSIISNEKLQIKLQDFDSTGNIKLSFGKKNHIICHLCG
cccHHHHHHHHHHHccHHHHHccHHHHHHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHccccHHHHHHHHHHcccHHHHHcHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHccccEEEEEEcEEEccccccccccccccEEcccccccHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccEEEcccccccccccHHHHHHHccccccHHHHHHHHHcccEEEccEEcccccccccHHHHccccEEEEEEccEEEEEEEEEc
ccccHHHHHHHHHHccccccEccHHHHHHHHHHcccEEEEEEcccccccEHHHHHHHHHHHHHHHcccEEEEEEcccHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEcHHHHHHcccHHHHHHHccccccHcHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcEEEEEEEHHHHHHHHHHHHHHHHHccccEEEEEEcccEcccccEccEccccEcEcccccccHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHcccccccccHHHccccccHHHHHHHcccccccHHHHHHHccccEEEcccEEcccccEEccHHcccccEEEEEcccEEEEEEEEEc
MPAFKSDFLSILSErgfihqisnpreLDILCSQGVVTAYIGYDltasslhaghLTQLMLLFWLQktghkpislmgggtsiigdpsfrdeSRRMMRSQEIQENIEKIKGIFSSFikygtgktdaLMLNNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQAYDFVELAKNYdcrlqmggsdqwgniicgidlgerlktpklfaltspllttasgtkmGKTLSGAIWLnkemtspynfwqywrniddaDVVSFAKRLTTLPMSEIDRMAKLQGKEINEAKKIIATEITTMVHGREEAEKAATAAMEcfdmsihsqhmptisiskdevSRGMGLLTLIVKAGFATSTNEARRHLKSNAIKINNSIISNEKLQIKLqdfdstgniklsfgkknhiichlcg
MPAFKSDFLSILSERGFIHQISNPRELDILCSQGVVTAYIGYDLTASSLHAGHLTQLMLLFWLQKTGHKpislmgggtsiigdpsFRDESRRMMRSQEIQENIEKIKGIFSSFIKYGTGKTDALMLNNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQAYDFVELAKNYDCRLQMGGSDQWGNIICGIDLGERLKTPKLFALTSpllttasgtkmGKTLSGAIWLNKEMTSPYNFWQYWRNIDDADVVSFAKRLTTLPMSEIDRMAKLQGKEINEAKKIIATEITTMVHGREEAEKAATAAMECFDMSIHSQHMPTISISKDEVSRGMGLLTLIVKAGFATSTNEARRHLKSNAIKINNSIISNEKLQIKLQDFDSTGNiklsfgkknhiichlcg
MPAFKSDFLSILSERGFIHQISNPRELDILCSQGVVTAYIGYDLTASSLHAGHLTQLMLLFWLQKTGHKPISLMGGGTSIIGDPSFRDESRRMMRSQEIQENIEKIKGIFSSFIKYGTGKTDALMLNNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQAYDFVELAKNYDCRLQMGGSDQWGNIICGIDLGERLKTPKLFALTSPLLTTASGTKMGKTLSGAIWLNKEMTSPYNFWQYWRNIDDADVVSFAKRLTTLPMSEIDRMAKLQGKEINEAKKIIATEITTMVHGReeaekaataameCFDMSIHSQHMPTISISKDEVSRGMGLLTLIVKAGFATSTNEARRHLksnaikinnsiisnekLQIKLQDFDSTGNIKLSFGKKNHIICHLCG
****KSDFLSILSERGFIHQISNPRELDILCSQGVVTAYIGYDLTASSLHAGHLTQLMLLFWLQKTGHKPISLMGGGTSIIGDPSFRDESRRMMRSQEIQENIEKIKGIFSSFIKYGTGKTDALMLNNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQAYDFVELAKNYDCRLQMGGSDQWGNIICGIDLGERLKTPKLFALTSPLLTTASGTKMGKTLSGAIWLNKEMTSPYNFWQYWRNIDDADVVSFAKRLTTLPMSEIDR*AK******NEAKKIIATEITTMVHGREEAEKAATAAMECFDMSIHSQHMPTISISKDEVSRGMGLLTLIVKAGFA*********LKSNAIKINNSIISNEKLQIKLQDFDSTGNIKLSFGKKNHIICHLCG
MPAFKSDFLSILSERGFIHQISNPRELDILCSQGVVTAYIGYDLTASSLHAGHLTQLMLLFWLQKTGHKPISLMGGGTSIIGDPSFRDESRRMMRSQEIQENIEKIKGIFSSFIKYGTGKTDALMLNNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQAYDFVELAKNYDCRLQMGGSDQWGNIICGIDLGERLKTPKLFALTSPLLTTASGTKMGKTLSGAIWLNKEMTSPYNFWQYWRNIDDADVVSFAKRLTTLPMSEIDRMAKLQGKEINEAKKIIATEITTMVHGREEAEKAATAAMECFDMSIHSQHMPTISISKDEVSRGMGLLTLIVKAGFATSTNEARRHLKSNAIKINNSIISNEKLQIKLQDFDSTGNIKLSFGKKNHIICHLCG
***FKSDFLSILSERGFIHQISNPRELDILCSQGVVTAYIGYDLTASSLHAGHLTQLMLLFWLQKTGHKPISLMGGGTSIIGDPSFRDESRRMMRSQEIQENIEKIKGIFSSFIKYGTGKTDALMLNNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQAYDFVELAKNYDCRLQMGGSDQWGNIICGIDLGERLKTPKLFALTSPLLTTASGTKMGKTLSGAIWLNKEMTSPYNFWQYWRNIDDADVVSFAKRLTTLPMSEIDRMAKLQGKEINEAKKIIATEITTMVHGREEAEKAATAAMECFDMSIHSQHMPTISISKDEVSRGMGLLTLIVKAGFATSTNEARRHLKSNAIKINNSIISNEKLQIKLQDFDSTGNIKLSFGKKNHIICHLCG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAFKSDFLSILSERGFIHQISNPRELDILCSQGVVTAYIGYDLTASSLHAGHLTQLMLLFWLQKTGHKPISLMGGGTSIIGDPSFRDESRRMMRSQEIQENIEKIKGIFSSFIKYGTGKTDALMLNNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQAYDFVELAKNYDCRLQMGGSDQWGNIICGIDLGERLKTPKLFALTSPLLTTASGTKMGKTLSGAIWLNKEMTSPYNFWQYWRNIDDADVVSFAKRLTTLPMSEIDRMAKLQGKEINEAKKIIATEITTMVHGREEAEKAATAAMECFDMSIHSQHMPTISISKDEVSRGMGLLTLIVKAGFATSTNEARRHLKSNAIKINNSIISNEKLQIKLQDFDSTGNIKLSFGKKNHIICHLCG
MPAFKSDFLSILSERGFIHQISNPRELDILCSQGVVTAYIGYDLTASSLHAGHLTQLMLLFWLQKTGHKPISLMGGGTSIIGDPSFRDESRRMMRSQEIQENIEKIKGIFSSFIKYGTGKTDALMLNNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQAYDFVELAKNYDCRLQMGGSDQWGNIICGIDLGERLKTPKLFALTSPLLTTASGTKMGKTLSGAIWLNKEMTSPYNFWQYWRNIDDADVVSFAKRLTTLPMSEIDRMAKLQGKEINEAKKIIATEITTMVHGREEAEKAATAAMECFDMSIHSQHMPTISISKDEVSRGMGLLTLIVKAGFATSTNEARRHLKSNAIKINNSIISNEKLQIKLQDFDSTGNIKLSFGKKNHIICHLCG
MPAFKSDFLSILSERGFIHQISNPRELDILCSQGVVTAYIGYDLTASSLHAGHLTQLMLLFWLQKTGHKPISLMGGGTSIIGDPSFRDESRRMMRSQEIQENIEKIKGIFSSFIKYGTGKTDALMLNNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQAYDFVELAKNYDCRLQMGGSDQWGNIICGIDLGERLKTPKLFALTSPLLTTASGTKMGKTLSGAIWLNKEMTSPYNFWQYWRNIDDADVVSFAKRLTTLPMSEIDRMAKLQGKEINEAKKIIATEITTMVHGREEAEKAATAAMECFDMSIHSQHMPTISISKDEVSRGMGLLTLIVKAGFATSTNEARRHLKSNAIKINNSIISNEKLQIKLQDFDSTGNIKLSFGKKNHIICHLCG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target418 tyrosyl-tRNA synthetase [Candidatus Liberibacter asiati
315122362418 tyrosyl-tRNA synthetase [Candidatus Liberibacter solana 1 0.0
49474204417 tyrosyl-tRNA synthetase [Bartonella quintana str. Toulo 1 1e-150
49475630417 tyrosyl-tRNA synthetase [Bartonella henselae str. Houst 1 1e-150
319404228417 Tyrosyl-tRNA synthetase [Bartonella rochalimae ATCC BAA 1 1e-149
319407238417 Tyrosyl-tRNA synthetase [Bartonella sp. 1-1C] Length = 1 1e-149
241204833418 tyrosyl-tRNA synthetase [Rhizobium leguminosarum bv. tr 1 1e-148
163868345417 tyrosyl-tRNA synthetase [Bartonella tribocorum CIP 1054 1 1e-148
240850610417 tyrosyl-tRNA synthetase [Bartonella grahamii as4aup] Le 1 1e-148
153009590417 tyrosyl-tRNA synthetase [Ochrobactrum anthropi ATCC 491 1 1e-148
209549500418 tyrosyl-tRNA synthetase [Rhizobium leguminosarum bv. tr 1 1e-148
>gi|315122362|ref|YP_004062851.1| tyrosyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 418 Back     alignment and organism information
 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/417 (79%), Positives = 380/417 (91%)

Query: 1   MPAFKSDFLSILSERGFIHQISNPRELDILCSQGVVTAYIGYDLTASSLHAGHLTQLMLL 60
           M  FKSDFL+ILSERGFIHQISNP+ELD LC    +TAYIGYD TASSLH GHLTQLM+L
Sbjct: 1   MSVFKSDFLNILSERGFIHQISNPQELDKLCYNSTITAYIGYDPTASSLHVGHLTQLMML 60

Query: 61  FWLQKTGHKPISLMGGGTSIIGDPSFRDESRRMMRSQEIQENIEKIKGIFSSFIKYGTGK 120
           FWLQKTGH+PISLMGGGT +IGDPSF  E+RRM+  QEIQ+NI+ IK IFS+FI+YGTGK
Sbjct: 61  FWLQKTGHRPISLMGGGTGMIGDPSFISEARRMIGVQEIQKNIKSIKDIFSAFIRYGTGK 120

Query: 121 TDALMLNNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQ 180
            DALMLNN+ WL  IKYID LRE+GS FSVNRMLSF+SVRSRL+REQSLSFLEFNYMILQ
Sbjct: 121 NDALMLNNDAWLSPIKYIDFLREVGSCFSVNRMLSFDSVRSRLQREQSLSFLEFNYMILQ 180

Query: 181 AYDFVELAKNYDCRLQMGGSDQWGNIICGIDLGERLKTPKLFALTSPLLTTASGTKMGKT 240
           AYDFVEL+KNYDCRLQMGGSDQWGN+ICGI+LG RLKTP+LFALTSPLLTT+SG KMGKT
Sbjct: 181 AYDFVELSKNYDCRLQMGGSDQWGNMICGIELGGRLKTPQLFALTSPLLTTSSGAKMGKT 240

Query: 241 LSGAIWLNKEMTSPYNFWQYWRNIDDADVVSFAKRLTTLPMSEIDRMAKLQGKEINEAKK 300
            +GAIWLNKEMTSPY+FWQYWRNIDDADVV+FAKRLTTLP+SEI R+ KLQ KE+NEAKK
Sbjct: 241 AAGAIWLNKEMTSPYDFWQYWRNIDDADVVNFAKRLTTLPISEIHRIEKLQEKELNEAKK 300

Query: 301 IIATEITTMVHGREEAEKAATAAMECFDMSIHSQHMPTISISKDEVSRGMGLLTLIVKAG 360
           IIATEITTMVHG+ EAEKAATAAMECFDM+++S++MPTISISK E+++G+G+LTLIVKAG
Sbjct: 301 IIATEITTMVHGKAEAEKAATAAMECFDMNMYSENMPTISISKAEINQGIGILTLIVKAG 360

Query: 361 FATSTNEARRHLKSNAIKINNSIISNEKLQIKLQDFDSTGNIKLSFGKKNHIICHLC 417
           FA ST+EARRH++SNAIK+N+++ISNEK  I+L+DFDS G IKLSFGKK HIIC +C
Sbjct: 361 FAVSTSEARRHIQSNAIKVNDNVISNEKAHIELKDFDSAGVIKLSFGKKRHIICQVC 417



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|49474204|ref|YP_032246.1| tyrosyl-tRNA synthetase [Bartonella quintana str. Toulouse] Length = 417 Back     alignment and organism information
>gi|49475630|ref|YP_033671.1| tyrosyl-tRNA synthetase [Bartonella henselae str. Houston-1] Length = 417 Back     alignment and organism information
>gi|319404228|emb|CBI77821.1| Tyrosyl-tRNA synthetase [Bartonella rochalimae ATCC BAA-1498] Length = 417 Back     alignment and organism information
>gi|319407238|emb|CBI80877.1| Tyrosyl-tRNA synthetase [Bartonella sp. 1-1C] Length = 417 Back     alignment and organism information
>gi|241204833|ref|YP_002975929.1| tyrosyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 418 Back     alignment and organism information
>gi|163868345|ref|YP_001609554.1| tyrosyl-tRNA synthetase [Bartonella tribocorum CIP 105476] Length = 417 Back     alignment and organism information
>gi|240850610|ref|YP_002972010.1| tyrosyl-tRNA synthetase [Bartonella grahamii as4aup] Length = 417 Back     alignment and organism information
>gi|153009590|ref|YP_001370805.1| tyrosyl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188] Length = 417 Back     alignment and organism information
>gi|209549500|ref|YP_002281417.1| tyrosyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 418 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target418 tyrosyl-tRNA synthetase [Candidatus Liberibacter asiati
PRK05912408 PRK05912, PRK05912, tyrosyl-tRNA synthetase; Validated 1e-151
PRK13354410 PRK13354, PRK13354, tyrosyl-tRNA synthetase; Provisiona 1e-126
TIGR00234377 TIGR00234, tyrS, tyrosyl-tRNA synthetase 2e-84
KOG2623467 KOG2623, KOG2623, KOG2623, Tyrosyl-tRNA synthetase [Tra 2e-81
COG0162401 COG0162, TyrS, Tyrosyl-tRNA synthetase [Translation, ri 1e-112
cd00805269 cd00805, TyrRS_core, catalytic core domain of tyrosinyl 6e-82
cd00395273 cd00395, Tyr_Trp_RS_core, catalytic core domain of tyro 4e-61
pfam00579291 pfam00579, tRNA-synt_1b, tRNA synthetases class I (W an 1e-60
cd00802143 cd00802, class_I_aaRS_core, catalytic core domain of cl 2e-07
cd0016570 cd00165, S4, S4/Hsp/ tRNA synthetase RNA-binding domain 9e-04
pfam0147948 pfam01479, S4, S4 domain 0.002
smart0036360 smart00363, S4, S4 RNA-binding domain 0.004
>gnl|CDD|180311 PRK05912, PRK05912, tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|183993 PRK13354, PRK13354, tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|161781 TIGR00234, tyrS, tyrosyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|37834 KOG2623, KOG2623, KOG2623, Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30511 COG0162, TyrS, Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173902 cd00805, TyrRS_core, catalytic core domain of tyrosinyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173893 cd00395, Tyr_Trp_RS_core, catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|144245 pfam00579, tRNA-synt_1b, tRNA synthetases class I (W and Y) Back     alignment and domain information
>gnl|CDD|173901 cd00802, class_I_aaRS_core, catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|29105 cd00165, S4, S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site; Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized functional similarity between these three protein classes Back     alignment and domain information
>gnl|CDD|144902 pfam01479, S4, S4 domain Back     alignment and domain information
>gnl|CDD|128657 smart00363, S4, S4 RNA-binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 418 tyrosyl-tRNA synthetase [Candidatus Liberibacter asiati
PRK05912402 tyrosyl-tRNA synthetase; Validated 100.0
PRK13354405 tyrosyl-tRNA synthetase; Provisional 100.0
KOG2623467 consensus 100.0
COG0162401 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal st 100.0
TIGR00234422 tyrS tyrosyl-tRNA synthetase; InterPro: IPR002307 The a 100.0
cd00805268 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic 100.0
pfam00579291 tRNA-synt_1b tRNA synthetases class I (W and Y). 100.0
cd00395274 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Trypt 100.0
PRK08560333 tyrosyl-tRNA synthetase; Validated 100.0
cd00806282 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalyt 100.0
PTZ00126399 tyrosyl-tRNA synthetase; Provisional 99.97
PRK12282333 tryptophanyl-tRNA synthetase II; Reviewed 99.9
PRK12285369 tryptophanyl-tRNA synthetase; Reviewed 99.89
PRK00927325 tryptophanyl-tRNA synthetase; Reviewed 99.88
COG0180314 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosom 99.85
PRK12283398 tryptophanyl-tRNA synthetase; Reviewed 99.84
PRK12556328 tryptophanyl-tRNA synthetase; Provisional 99.84
KOG2144360 consensus 99.82
PRK12284436 tryptophanyl-tRNA synthetase; Reviewed 99.82
TIGR00233366 trpS tryptophanyl-tRNA synthetase; InterPro: IPR002306 99.77
KOG2713347 consensus 99.47
KOG2145397 consensus 99.11
cd00802142 class_I_aaRS_core Class I amino acyl-tRNA synthetase (a 99.8
PRK00750513 lysK lysyl-tRNA synthetase; Reviewed 98.13
cd00674354 LysRS_core_class_I This is the catalytic core domain of 97.97
pfam01921355 tRNA-synt_1f tRNA synthetases class I (K). This family 97.73
cd02156147 nt_trans nt_trans (nucleotidyl transferase) This superf 96.96
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, ribo 96.63
cd00808239 GluRS_core Descriminating Glutamyl-tRNA synthetase (Glu 94.58
cd00668334 Ile_Leu_Val_MetRS_core This is the catalytic core domai 98.61
TIGR00392938 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The 97.45
cd00817363 ValRS_core This is the catalytic core domain of valine 97.43
PRK00260460 cysS cysteinyl-tRNA synthetase; Validated 96.71
cd00812376 LeuRS_core This is the catalytic core domain of leucyl 96.69
cd00818339 IleRS_core This is the catalytic core domain of isoleuc 96.09
PRK11893512 methionyl-tRNA synthetase; Reviewed 92.38
TIGR03447411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deo 91.05
pfam09334388 tRNA-synt_1g tRNA synthetases class I (M). This family 98.26
cd00814319 MetRS_core This is the catalytic core domain of methion 97.96
pfam01406301 tRNA-synt_1e tRNA synthetases class I (C) catalytic dom 97.78
PRK12267 644 methionyl-tRNA synthetase; Reviewed 97.29
pfam00133 606 tRNA-synt_1 tRNA synthetases class I (I, L, M and V). O 97.0
PRK11893 512 methionyl-tRNA synthetase; Reviewed 96.14
PRK12268 558 methionyl-tRNA synthetase; Reviewed 93.19
PRK12418384 cysteinyl-tRNA synthetase; Provisional 90.42
pfam0147948 S4 S4 domain. The S4 domain is a small domain consistin 98.04
smart0036360 S4 S4 RNA-binding domain. 97.78
cd0016570 S4 S4/Hsp/ tRNA synthetase RNA-binding domain; The doma 97.69
PRK10839 231 16S rRNA pseudouridylate synthase A; Provisional 97.2
COG0522205 RpsD Ribosomal protein S4 and related proteins [Transla 96.89
COG1187 248 RsuA 16S rRNA uridine-516 pseudouridylate synthase and 96.56
TIGR00478 240 tly hemolysin A; InterPro: IPR004538 Hemolysins are exo 96.55
TIGR03069257 PS_II_S4 photosystem II S4 domain protein. Members of t 96.39
COG1189 245 Predicted rRNA methylase [Translation, ribosomal struct 96.3
PRK04313 237 30S ribosomal protein S4e; Validated 95.92
PRK12565197 30S ribosomal protein S4; Provisional 95.42
PTZ00223 273 40S ribosomal protein S4; Provisional 95.37
PTZ00118 262 40S ribosomal protein S4; Provisional 95.07
PRK05327201 rpsD 30S ribosomal protein S4; Validated 94.7
CHL00113201 rps4 ribosomal protein S4; Reviewed 94.68
COG2302257 Uncharacterized conserved protein, contains S4-like dom 94.59
TIGR0298860 YaaA_near_RecF S4 domain protein YaaA; InterPro: IPR014 94.38
COG1188100 Ribosome-associated heat shock protein implicated in th 94.15
PRK1150770 hypothetical protein; Provisional 94.0
COG250173 S4-like RNA binding protein [Replication, recombination 93.49
PRK10348133 ribosome-associated heat shock protein Hsp15; Provision 92.43
KOG4655181 consensus 92.29
TIGR00422 970 valS valyl-tRNA synthetase; InterPro: IPR002303 The ami 97.23
PRK13804 966 ileS isoleucyl-tRNA synthetase; Provisional 97.21
PRK12451562 arginyl-tRNA synthetase; Reviewed 96.88
PRK05743 910 ileS isoleucyl-tRNA synthetase; Reviewed 96.83
PRK13208809 valS valyl-tRNA synthetase; Reviewed 96.59
COG0060 933 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal 96.51
PRK06039 1042 ileS isoleucyl-tRNA synthetase; Reviewed 96.27
PRK12300 888 leuS leucyl-tRNA synthetase; Reviewed 94.6
PRK12268558 methionyl-tRNA synthetase; Reviewed 92.61
KOG0433 937 consensus 90.83
PRK04051177 rps4p 30S ribosomal protein S4; Validated 97.22
PTZ00155188 40S ribosomal protein S9; Provisional 96.37
cd00672213 CysRS_core This is the catalytic core domain of cystein 96.98
cd00418223 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-t 96.61
PRK10475290 23S rRNA pseudouridine synthase F; Provisional 96.27
PRK10700291 23S rRNA pseudouridylate synthase B; Provisional 95.16
TIGR01018170 rpsD_arch ribosomal protein S4; InterPro: IPR005710 Rib 95.88
TIGR01017217 rpsD_bact ribosomal protein S4; InterPro: IPR005709 Rib 95.41
PRK05729 877 valS valyl-tRNA synthetase; Reviewed 95.18
COG0525 877 ValS Valyl-tRNA synthetase [Translation, ribosomal stru 95.09
PRK11180325 rluD 23S rRNA pseudouridine synthase D; Provisional 93.06
PRK11025317 23S rRNA pseudouridylate synthase C; Provisional 91.67
>PRK05912 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK13354 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2623 consensus Back     alignment and domain information
>COG0162 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00234 tyrS tyrosyl-tRNA synthetase; InterPro: IPR002307 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00805 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic core domain Back     alignment and domain information
>pfam00579 tRNA-synt_1b tRNA synthetases class I (W and Y) Back     alignment and domain information
>cd00395 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Tryptophanyl-tRNA synthetase (TrpRS) catalytic core domain Back     alignment and domain information
>PRK08560 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00806 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalytic core domain Back     alignment and domain information
>PTZ00126 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed Back     alignment and domain information
>PRK12285 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00927 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12283 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12556 tryptophanyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2144 consensus Back     alignment and domain information
>PRK12284 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00233 trpS tryptophanyl-tRNA synthetase; InterPro: IPR002306 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2713 consensus Back     alignment and domain information
>KOG2145 consensus Back     alignment and domain information
>cd00802 class_I_aaRS_core Class I amino acyl-tRNA synthetase (aaRS) catalytic core domain Back     alignment and domain information
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00674 LysRS_core_class_I This is the catalytic core domain of lysyl tRNA synthetase (LysRS) Back     alignment and domain information
>pfam01921 tRNA-synt_1f tRNA synthetases class I (K) Back     alignment and domain information
>cd02156 nt_trans nt_trans (nucleotidyl transferase) This superfamily includes the class I amino-acyl tRNA synthetases, pantothenate synthetase (PanC), ATP sulfurylase, and the cytidylyltransferases, all of which have a conserved dinucleotide-binding domain Back     alignment and domain information
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00808 GluRS_core Descriminating Glutamyl-tRNA synthetase (GluRS) catalytic core domain Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core This is the catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00817 ValRS_core This is the catalytic core domain of valine amino-acyl tRNA synthetases (ValRS) Back     alignment and domain information
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00812 LeuRS_core This is the catalytic core domain of leucyl tRNA synthetase (LeuRS) Back     alignment and domain information
>cd00818 IleRS_core This is the catalytic core domain of isoleucine amino-acyl tRNA synthetases (IleRS) Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>pfam09334 tRNA-synt_1g tRNA synthetases class I (M) Back     alignment and domain information
>cd00814 MetRS_core This is the catalytic core domain of methionine tRNA synthetase (MetRS) Back     alignment and domain information
>pfam01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>pfam00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12418 cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>pfam01479 S4 S4 domain Back     alignment and domain information
>smart00363 S4 S4 RNA-binding domain Back     alignment and domain information
>cd00165 S4 S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site; Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized functional similarity between these three protein classes Back     alignment and domain information
>PRK10839 16S rRNA pseudouridylate synthase A; Provisional Back     alignment and domain information
>COG0522 RpsD Ribosomal protein S4 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1187 RsuA 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00478 tly hemolysin A; InterPro: IPR004538 Hemolysins are exotoxins that attack blood cell membranes and cause cell rupture Back     alignment and domain information
>TIGR03069 PS_II_S4 photosystem II S4 domain protein Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04313 30S ribosomal protein S4e; Validated Back     alignment and domain information
>PRK12565 30S ribosomal protein S4; Provisional Back     alignment and domain information
>PTZ00223 40S ribosomal protein S4; Provisional Back     alignment and domain information
>PTZ00118 40S ribosomal protein S4; Provisional Back     alignment and domain information
>PRK05327 rpsD 30S ribosomal protein S4; Validated Back     alignment and domain information
>CHL00113 rps4 ribosomal protein S4; Reviewed Back     alignment and domain information
>COG2302 Uncharacterized conserved protein, contains S4-like domain [Function unknown] Back     alignment and domain information
>TIGR02988 YaaA_near_RecF S4 domain protein YaaA; InterPro: IPR014330 This small protein has a single S4 domain (IPR002942 from INTERPRO); it is also found in bacterial S4 ribosomal proteins, some pseudouridine synthases and tyrosyl-tRNA synthetases Back     alignment and domain information
>COG1188 Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11507 hypothetical protein; Provisional Back     alignment and domain information
>COG2501 S4-like RNA binding protein [Replication, recombination, and repair] Back     alignment and domain information
>PRK10348 ribosome-associated heat shock protein Hsp15; Provisional Back     alignment and domain information
>KOG4655 consensus Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12451 arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0433 consensus Back     alignment and domain information
>PRK04051 rps4p 30S ribosomal protein S4; Validated Back     alignment and domain information
>PTZ00155 40S ribosomal protein S9; Provisional Back     alignment and domain information
>cd00672 CysRS_core This is the catalytic core domain of cysteinyl tRNA synthetase (CysRS) Back     alignment and domain information
>cd00418 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain Back     alignment and domain information
>PRK10475 23S rRNA pseudouridine synthase F; Provisional Back     alignment and domain information
>PRK10700 23S rRNA pseudouridylate synthase B; Provisional Back     alignment and domain information
>TIGR01018 rpsD_arch ribosomal protein S4; InterPro: IPR005710 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR01017 rpsD_bact ribosomal protein S4; InterPro: IPR005709 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11180 rluD 23S rRNA pseudouridine synthase D; Provisional Back     alignment and domain information
>PRK11025 23S rRNA pseudouridylate synthase C; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target418 tyrosyl-tRNA synthetase [Candidatus Liberibacter asiati
2ts1_A419 Structure Of Tyrosyl-TRNA SYNTHETASE REFINED AT 2.3 1e-105
1jii_A420 Crystal Structure Of S. Aureus Tyrrs In Complex Wit 1e-99
2jan_A432 Tyrosyl-Trna Synthetase From Mycobacterium Tubercul 5e-95
1h3f_A432 Tyrosyl-Trna Synthetase From Thermus Thermophilus C 7e-76
1x8x_A322 Tyrosyl T-Rna Synthetase From E.Coli Complexed With 4e-82
1vbm_A318 Crystal Structure Of The Escherichia Coli Tyrosyl-T 1e-81
1wq4_A321 Escherichia Coli Tyrosyl-Trna Synthetase Mutant Com 9e-80
1wq3_A322 Escherichia Coli Tyrosyl-Trna Synthetase Mutant Com 9e-80
1vbn_A318 Escherichia Coli Tyrosyl-Trna Synthetase Mutant Com 3e-79
1tyc_A319 Structural Analysis Of A Series Of Mutants Of Tyros 4e-79
4ts1_A319 Crystal Structure Of A Deletion Mutant Of A Tyrosyl 8e-79
1tya_E319 Structural Analysis Of A Series Of Mutants Of Tyros 2e-78
1tyb_E319 Structural Analysis Of A Series Of Mutants Of Tyros 2e-78
1tyd_E319 Structure Of Tyrosyl-Trna Synthetase Refined At 2.3 2e-78
1y42_X392 Crystal Structure Of A C-Terminally Truncated Cyt-1 2e-55
2pid_A356 Crystal Structure Of Human Mitochondrial Tyrosyl-Tr 5e-53
1j1u_A306 Crystal Structure Of Archaeal Tyrosyl-Trna Syntheta 3e-23
2zp1_A314 Structual Basis Of Iodo-Tyrosine Recognition By Eng 2e-22
3qe4_A312 An Evolved Aminoacyl-Trna Synthetase With Atypical 4e-22
1zh6_A314 Crystal Structure Of P-Acetylphenylalanine-Trna Syn 4e-21
3n2y_A314 Crystal Structure Of Tyrosyl-Trna Synthetase Comple 9e-21
2ag6_A314 Crystal Structure Of P-Bromo-L-Phenylalanine-Trna S 1e-20
1zh0_A314 Crystal Structure Of L-3-(2-Napthyl)alanine-Trna Sy 1e-20
1u7x_A312 Crystal Structure Of A Mutant M. Jannashii Tyrosyl- 2e-20
2hgz_A306 Crystal Structure Of A P-Benzoyl-L-Phenylalanyl-Trn 2e-20
3d6u_A314 Crystal Structure Of 4-(Trifluoromethyldiazirinyl) 5e-20
2pxh_A314 Crystal Structure Of A Bipyridylalanyl-Trna Synthet 2e-19
2cyc_A375 Crystal Structure Of Tyrosyl-Trna Synthetase Comple 1e-09
2cyb_A323 Crystal Structure Of Tyrosyl-Trna Synthetase Comple 4e-24
1n3l_A372 Crystal Structure Of A Human Aminoacyl-Trna Synthet 1e-06
2dlc_X394 Crystal Structure Of The Ternary Complex Of Yeast T 7e-06
2quh_A477 Crystal Structures Of Human Tryptophanyl-Trna Synth 9e-05
1ulh_A390 A Short Peptide Insertion Crucial For Angiostatic A 2e-04
2quj_B384 Crystal Structures Of Human Tryptophanyl-Trna Synth 2e-04
2ake_A384 Structure Of Human Tryptophanyl-Trna Synthetase In 2e-04
1o5t_A378 Crystal Structure Of The Aminoacylation Catalytic F 2e-04
2j5b_A348 Structure Of The Tyrosyl Trna Synthetase From Acant 5e-04
2g36_A340 Crystal Structure Of Tryptophanyl-Trna Synthetase ( 8e-04
2cya_A364 Crystal Structure Of Tyrosyl-Trna Synthetase From A 2e-18
3a04_A372 Crystal Structure Of Tryptophanyl-Trna Synthetase F 0.003
1jh3_A107 Solution Structure Of Tyrosyl-Trna Synthetase C-Ter 3e-18
2ktl_A164 Structure Of C-Terminal Domain From Mttyrrs Of A. N 1e-04
3foc_A451 Tryptophanyl-Trna Synthetase From Giardia Lamblia L 5e-05
3p0j_A 690 Leishmania Major Tyrosyl-Trna Synthetase In Complex 5e-04
gi|157836396|pdb|2TS1|A Chain A, Structure Of Tyrosyl-TRNA SYNTHETASE REFINED AT 2.3 Angstroms Resolution. Interaction Of The Enzyme With The Tyrosyl Adenylate Intermediate Length = 419 Back     alignment and structure 
 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 153/418 (36%), Positives = 227/418 (54%), Gaps = 11/418 (2%)

Query: 7   DFLSILSERGFIHQISNPRELDILCSQGVVTAYIGYDLTASSLHAGHLTQLMLLFWLQKT 66
           D L+ L  RG ++Q ++   L  L ++  VT Y G+D TA SLH GHL  ++ +   Q+ 
Sbjct: 2   DLLAELQWRGLVNQTTDEDGLRKLLNEERVTLYCGFDPTADSLHIGHLATILTMRRFQQA 61

Query: 67  GHKPISLMGGGTSIIGDPSFRDESRRMMRSQEIQENIEKIKGIFSSFIKYGTGKTDALML 126
           GH+PI+L+GG T +IGDPS +   R +   + ++    +IK     F+ +      A + 
Sbjct: 62  GHRPIALVGGATGLIGDPSGKKSERTLNAKETVEAWSARIKEQLGRFLDFEADGNPAKIK 121

Query: 127 NNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQAYDFVE 186
           NN  W+  +  I  LR++G  FSVN M++ ESV+SR+  E  +SF EF+YM+LQAYDF+ 
Sbjct: 122 NNYDWIGPLDVITFLRDVGKHFSVNYMMAKESVQSRI--ETGISFTEFSYMMLQAYDFLR 179

Query: 187 LAKNYDCRLQMGGSDQWGNIICGIDLGERLKTPK-LFALTSPLLTTASGTKMGKTLSGAI 245
           L +   CRLQ+GGSDQWGNI  G++L  + K     F LT PL+T A GTK GKT SG I
Sbjct: 180 LYETEGCRLQIGGSDQWGNITAGLELIRKTKGEARAFGLTIPLVTKADGTKFGKTESGTI 239

Query: 246 WLNKEMTSPYNFWQYWRNIDDADVVSFAKRLTTLPMSEID--RMAKLQGKEINEAKKIIA 303
           WL+KE TSPY F+Q+W N DD DV+ + K  T L   EI+       +  E   A+K +A
Sbjct: 240 WLDKEKTSPYEFYQFWINTDDRDVIRYLKYFTFLSKEEIEALEQELREAPEKRAAQKTLA 299

Query: 304 TEITTMVHGREEAEKAATAAMECFDMSIHSQHMPTISISKDEVSR------GMGLLTLIV 357
            E+T +VHG E   +A   +   F   I +     I     +V         + L+ L+V
Sbjct: 300 EEVTKLVHGEEALRQAIRISEALFSGDIANLTAAEIEQGFKDVPSFVHEGGDVPLVELLV 359

Query: 358 KAGFATSTNEARRHLKSNAIKINNSIISNEKLQIKLQDFDSTGNIKLSFGKKNHIICH 415
            AG + S  +AR  +++ AI +N   + +    +  +         +  GKK + +  
Sbjct: 360 SAGISPSKRQAREDIQNGAIYVNGERLQDVGAILTAEHRLEGRFTVIRRGKKKYYLIR 417
gi|16975033|pdb|1JII|A Chain A, Crystal Structure Of S. Aureus Tyrrs In Complex With Sb- 219383 Length = 420 Back     alignment and structure
>gi|167013192|pdb|2JAN|A Chain A, Tyrosyl-Trna Synthetase From Mycobacterium Tuberculosis In Unliganded State Length = 432 Back     alignment and structure
gi|24158659|pdb|1H3F|A Chain A, Tyrosyl-Trna Synthetase From Thermus Thermophilus Complexed With Tyrosinol Length = 432 Back     alignment and structure
>gi|60593980|pdb|1X8X|A Chain A, Tyrosyl T-Rna Synthetase From E.Coli Complexed With Tyrosine Length = 322 Back     alignment and structure
>gi|60593714|pdb|1VBM|A Chain A, Crystal Structure Of The Escherichia Coli Tyrosyl-Trna Synthetase Complexed With Tyr-Ams Length = 318 Back     alignment and structure
>gi|60593917|pdb|1WQ4|A Chain A, Escherichia Coli Tyrosyl-Trna Synthetase Mutant Complexed With L-Tyrosine Length = 321 Back     alignment and structure
>gi|60593916|pdb|1WQ3|A Chain A, Escherichia Coli Tyrosyl-Trna Synthetase Mutant Comlexed With 3-Iodo-L-Tyrosine Length = 322 Back     alignment and structure
>gi|60593716|pdb|1VBN|A Chain A, Escherichia Coli Tyrosyl-Trna Synthetase Mutant Complexed With Tyr-Ams Length = 318 Back     alignment and structure
>gi|157834045|pdb|1TYC|A Chain A, Structural Analysis Of A Series Of Mutants Of Tyrosyl-Trna Synthetase: Enhancement Of Catalysis By Hydrophobic Interactions Length = 319 Back     alignment and structure
>gi|231099|pdb|4TS1|A Chain A, Crystal Structure Of A Deletion Mutant Of A Tyrosyl-TRNA Synthetase Complexed With Tyrosine Length = 319 Back     alignment and structure
>gi|494688|pdb|1TYA|E Chain E, Structural Analysis Of A Series Of Mutants Of Tyrosyl-Trna Synthetase: Enhancement Of Catalysis By Hydrophobic Interactions Length = 319 Back     alignment and structure
>gi|494690|pdb|1TYB|E Chain E, Structural Analysis Of A Series Of Mutants Of Tyrosyl-Trna Synthetase: Enhancement Of Catalysis By Hydrophobic Interactions Length = 319 Back     alignment and structure
>gi|494693|pdb|1TYD|E Chain E, Structure Of Tyrosyl-Trna Synthetase Refined At 2.3 Angstroms Resolution. Interaction Of The Enzyme With The Tyrosyl Adenylate Intermediate Length = 319 Back     alignment and structure
>gi|61680508|pdb|1Y42|X Chain X, Crystal Structure Of A C-Terminally Truncated Cyt-18 Protein Length = 392 Back     alignment and structure
>gi|159795079|pdb|2PID|A Chain A, Crystal Structure Of Human Mitochondrial Tyrosyl-Trna Synthetase In Complex With An Adenylate Analog Length = 356 Back     alignment and structure
gi|31615439|pdb|1J1U|A Chain A, Crystal Structure Of Archaeal Tyrosyl-Trna Synthetase Complexed With Trna(Tyr) And L-Tyrosine Length = 306 Back     alignment and structure
>gi|223673858|pdb|2ZP1|A Chain A, Structual Basis Of Iodo-Tyrosine Recognition By Engineered Archeal Tyrosyl-Trna Synthetase Length = 314 Back     alignment and structure
>gi|323463147|pdb|3QE4|A Chain A, An Evolved Aminoacyl-Trna Synthetase With Atypical Polysubstrate Specificity Length = 312 Back     alignment and structure
>gi|93278582|pdb|1ZH6|A Chain A, Crystal Structure Of P-Acetylphenylalanine-Trna Synthetase In Complex With P-Acetylphenylalanine Length = 314 Back     alignment and structure
>gi|310942792|pdb|3N2Y|A Chain A, Crystal Structure Of Tyrosyl-Trna Synthetase Complexed With P-(2- Tetrazolyl)-Phenylalanine Length = 314 Back     alignment and structure
>gi|93278672|pdb|2AG6|A Chain A, Crystal Structure Of P-Bromo-L-Phenylalanine-Trna Sythetase In Complex With P-Bromo-L-Phenylalanine Length = 314 Back     alignment and structure
>gi|93278581|pdb|1ZH0|A Chain A, Crystal Structure Of L-3-(2-Napthyl)alanine-Trna Synthetasein Complex With L-3-(2-Napthyl)alanine Length = 314 Back     alignment and structure
>gi|67463836|pdb|1U7X|A Chain A, Crystal Structure Of A Mutant M. Jannashii Tyrosyl-Trna Synthetase Specific For O-Methyl-Tyrosine Length = 312 Back     alignment and structure
>gi|149241961|pdb|2HGZ|A Chain A, Crystal Structure Of A P-Benzoyl-L-Phenylalanyl-Trna Synthetase Length = 306 Back     alignment and structure
>gi|189096270|pdb|3D6U|A Chain A, Crystal Structure Of 4-(Trifluoromethyldiazirinyl) Phenylalanyl-Trna Synthetase Length = 314 Back     alignment and structure
>gi|167013270|pdb|2PXH|A Chain A, Crystal Structure Of A Bipyridylalanyl-Trna Synthetase Length = 314 Back     alignment and structure
gi|83754906|pdb|2CYC|A Chain A, Crystal Structure Of Tyrosyl-Trna Synthetase Complexed With L-Tyrosine From Pyrococcus Horikoshii Length = 375 Back     alignment and structure
gi|83754904|pdb|2CYB|A Chain A, Crystal Structure Of Tyrosyl-Trna Synthetase Complexed With L-Tyrosine From Archaeoglobus Fulgidus Length = 323 Back     alignment and structure
>gi|27065983|pdb|1N3L|A Chain A, Crystal Structure Of A Human Aminoacyl-Trna Synthetase Cytokine Length = 372 Back     alignment and structure
gi|149241068|pdb|2DLC|X Chain X, Crystal Structure Of The Ternary Complex Of Yeast Tyrosyl- Trna Synthetase Length = 394 Back     alignment and structure
>gi|186972755|pdb|2QUH|A Chain A, Crystal Structures Of Human Tryptophanyl-Trna Synthetase In Complex With Trp Length = 477 Back     alignment and structure
>gi|42543730|pdb|1ULH|A Chain A, A Short Peptide Insertion Crucial For Angiostatic Activity Of Human Tryptophanyl-Trna Synthetase Length = 390 Back     alignment and structure
>gi|112489952|pdb|2AKE|A Chain A, Structure Of Human Tryptophanyl-Trna Synthetase In Complex With Trna(Trp) Length = 384 Back     alignment and structure
>gi|50513261|pdb|1O5T|A Chain A, Crystal Structure Of The Aminoacylation Catalytic Fragment Of Human Tryptophanyl-Trna Synthetase Length = 378 Back     alignment and structure
>gi|158428905|pdb|2J5B|A Chain A, Structure Of The Tyrosyl Trna Synthetase From Acanthamoeba Polyphaga Mimivirus Complexed With Tyrosynol Length = 348 Back     alignment and structure
>gi|93279847|pdb|2G36|A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase (Ec 6.1.1.2) (Tryptophan-Trna Ligase)(Trprs) (Tm0492) From Thermotoga Maritima At 2.50 A Resolution Length = 340 Back     alignment and structure
gi|83754903|pdb|2CYA|A Chain A, Crystal Structure Of Tyrosyl-Trna Synthetase From Aeropyrum Pernix Length = 364 Back     alignment and structure
gi|290789897|pdb|3A04|A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase From Hyperthermophilic Archaeon, Aeropyrum Pernix K1 Length = 372 Back     alignment and structure
>gi|20150424|pdb|1JH3|A Chain A, Solution Structure Of Tyrosyl-Trna Synthetase C-Terminal Domain Length = 107 Back     alignment and structure
>gi|332138049|pdb|2KTL|A Chain A, Structure Of C-Terminal Domain From Mttyrrs Of A. Nidulans Length = 164 Back     alignment and structure
>gi|220702585|pdb|3FOC|A Chain A, Tryptophanyl-Trna Synthetase From Giardia Lamblia Length = 451 Back     alignment and structure
>gi|326634434|pdb|3P0J|A Chain A, Leishmania Major Tyrosyl-Trna Synthetase In Complex With Tyrosinol, Triclinic Crystal Form 1 Length = 690 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target418 tyrosyl-tRNA synthetase [Candidatus Liberibacter asiati
1jil_A420 Tyrrs, tyrosyl-tRNA synthetase, tyrosyl-transfer; trunc 1e-108
2ts1_A419 Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Ge 5e-88
2jan_A432 Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacy 3e-82
1h3f_A432 Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthet 4e-76
1y42_X392 Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA li 3e-79
2yxn_A322 Tyrosyl-tRNA synthetase; tRNA synthetases class I, stru 7e-74
2pid_A356 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, pro 4e-71
2zp1_A314 Tyrosyl-tRNA synthetase; tRNA synthetases class I, liga 2e-37
2j5b_A348 Tyrosyl-tRNA synthetase; tyrosynol, ligase; HET: TYB; 2 3e-14
2cyb_A323 Tyrosyl-tRNA synthetase; rossmann-fold, structural geno 1e-12
1n3l_A372 Tyrosyl-tRNA synthetase; rossmann fold AS catalytic dom 2e-29
2cyc_A375 Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylatio 1e-26
2cya_A364 Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structu 2e-18
2dlc_X394 Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase/tRN 2e-23
3i05_A395 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-bind 2e-20
1r6u_A437 Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, 1e-19
1r6t_A477 Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, 9e-19
3hv0_A393 Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, 1e-16
2ip1_A432 Tryptophanyl-tRNA synthetase; rossmann fold, structural 7e-12
3hzr_A386 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structur 3e-10
3jxe_A392 Tryptophanyl-tRNA synthetase; adenosine triphosphate, r 4e-05
3foc_A451 Tryptophanyl-tRNA synthetase; structural genomics, giar 1e-05
2g36_A340 Tryptophanyl-tRNA synthetase; TM0492, structural genomi 4e-05
>1jil_A Tyrrs, tyrosyl-tRNA synthetase, tyrosyl-transfer; truncation, structure based inhibitor design, ligase; HET: 485; 2.20A {Staphylococcus aureus} SCOP: c.26.1.1 PDB: 1jij_A* 1jii_A* 1jik_A* Length = 420 Back     alignment and structure
 Score =  387 bits (994), Expect = e-108
 Identities = 145/418 (34%), Positives = 223/418 (53%), Gaps = 12/418 (2%)

Query: 5   KSDFLSILSERGFIHQISNPRELDILCSQGVVTAYIGYDLTASSLHAGHLTQLMLLFWLQ 64
            +  +  L  RG I+Q ++ + ++ L ++  VT Y G D TA SLH GHL   + L   Q
Sbjct: 2   TNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQ 61

Query: 65  KTGHKPISLMGGGTSIIGDPSFRDESRRMMRSQEIQENIEKIKGIFSSFIKYGTGKTDAL 124
           + GH+PI L+GGGT +IGDPS + E R +   +++ +NIE I     +  ++GT    A+
Sbjct: 62  EHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHG-AV 120

Query: 125 MLNNETWLCSIKYIDLLREIGSFFSVNRMLSFESVRSRLKREQSLSFLEFNYMILQAYDF 184
           ++NN  WL  I  I  LR+ G    VN ML  +S++SRL+    +S+ EF Y ILQA DF
Sbjct: 121 LVNNRDWLGQISLISFLRDYGKHVGVNYMLGKDSIQSRLE--HGISYTEFTYTILQAIDF 178

Query: 185 VELAKNYDCRLQMGGSDQWGNIICGIDL-GERLKTPKLFALTSPLLTTASGTKMGKTLSG 243
             L +  +C++Q+GGSDQWGNI  GI+L          + LT PL+T + G K GK+ SG
Sbjct: 179 GHLNRELNCKIQVGGSDQWGNITSGIELMRRMYGQTDAYGLTIPLVTKSDGKKFGKSESG 238

Query: 244 AIWLNKEMTSPYNFWQYWRNIDDADVVSFAKRLTTLPMSEIDRMA--KLQGKEINEAKKI 301
           A+WL+ E TSPY F+Q+W N  D DV+ F K  T L   EIDR+   K +   + EA+K 
Sbjct: 239 AVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQSKNEAPHLREAQKT 298

Query: 302 IATEITTMVHGREEAEKAATAAMECFDMSIHSQHMPTISISKDEV------SRGMGLLTL 355
           +A E+T  +HG +    A   +   F   + S     +     +V      +    ++ +
Sbjct: 299 LAEEVTKFIHGEDALNDAIRISQALFSGDLKSLSAKELKDGFKDVPQVTLSNDTTNIVEV 358

Query: 356 IVKAGFATSTNEARRHLKSNAIKINNSIISNEKLQIKLQDFDSTGNIKLSFGKKNHII 413
           +++ G + S  +AR  + + AI IN     +    +  +D        +  GKK + +
Sbjct: 359 LIETGISPSKRQAREDVNNGAIYINGERQQDVNYALAPEDKIDGEFTIIRRGKKKYFM 416
>2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 3ts1_A* 1tyd_E* 1tya_E* 1tyc_A 1tyb_E* 4ts1_A* 1jh3_A Length = 419 Back     alignment and structure
>2jan_A Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacyl-tRNA synthetase, tyrrs, ligase, tyrosine, RNA-binding, ATP-binding; 2.9A {Mycobacterium tuberculosis} Length = 432 Back     alignment and structure
>1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYB; 2.0A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A* Length = 432 Back     alignment and structure
>1y42_X Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA ligase, group I intron; HET: TYR; 1.95A {Neurospora crassa} PDB: 2rkj_A Length = 392 Back     alignment and structure
>2yxn_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, structural genomics, NPPSFA; HET: AZY; 1.80A {Escherichia coli str} PDB: 1wq3_A* 1wq4_A* 1x8x_A* 1vbn_A* 1vbm_A* Length = 322 Back     alignment and structure
>2pid_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, protein-substrate complex, ATP- binding, ligase, mitochondrion, nucleotide-binding; HET: YSA; 2.20A {Homo sapiens} Length = 356 Back     alignment and structure
>2zp1_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding; HET: IYR; 1.70A {Methanocaldococcus jannaschii} PDB: 1zh6_A* 1j1u_A* 1u7d_A 2q1g_A* 2pxh_A* 1zh0_A* 2q1i_A* 2ag6_A* 3d6u_A* 3d6v_A* 1u7x_A 2hgz_A* Length = 314 Back     alignment and structure
>2j5b_A Tyrosyl-tRNA synthetase; tyrosynol, ligase; HET: TYB; 2.2A {Mimivirus} Length = 348 Back     alignment and structure
>2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus} Length = 323 Back     alignment and structure
>1n3l_A Tyrosyl-tRNA synthetase; rossmann fold AS catalytic domain, unique anticodon recognition domain, dimer, ligase; 1.18A {Homo sapiens} SCOP: c.26.1.1 PDB: 1q11_A* Length = 372 Back     alignment and structure
>2cyc_A Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylation, structural genomics, NPPSFA; HET: TYR; 2.20A {Pyrococcus horikoshii OT3} Length = 375 Back     alignment and structure
>2cya_A Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.20A {Aeropyrum pernix} Length = 364 Back     alignment and structure
>2dlc_X Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase/tRNA complex; HET: 2MG OMG M2G PSU 6IA 5MC 5MU 1MA YMP; 2.40A {Saccharomyces cerevisiae} Length = 394 Back     alignment and structure
>3i05_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding, protein biosynthesis; 2.80A {Trypanosoma brucei} Length = 395 Back     alignment and structure
>1r6u_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytic domain, anticodon recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.00A {Homo sapiens} SCOP: c.26.1.1 PDB: 1ulh_A 2dr2_A* 2ake_A* 1o5t_A Length = 437 Back     alignment and structure
>1r6t_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytical domain, anticodon recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.10A {Homo sapiens} SCOP: a.16.1.3 c.26.1.1 PDB: 2azx_A* 2quh_A* 2qui_A* 2quj_A* 2quk_A Length = 477 Back     alignment and structure
>3hv0_A Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding; HET: TRP; 2.42A {Cryptosporidium parvum iowa II} Length = 393 Back     alignment and structure
>2ip1_A Tryptophanyl-tRNA synthetase; rossmann fold, structural genomics, PSI-2, protein structure initiative; HET: PG4; 1.80A {Saccharomyces cerevisiae} Length = 432 Back     alignment and structure
>3hzr_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structural genomics, medical structural genomics of pathogenic protozoa, MSGPP; 3.00A {Entamoeba histolytica} Length = 386 Back     alignment and structure
>3jxe_A Tryptophanyl-tRNA synthetase; adenosine triphosphate, rossmann fold, crystallography, X-RAY, P. horikoshii, aminoacyl-tRNA synthetase; HET: TYM; 3.00A {Pyrococcus horikoshii} Length = 392 Back     alignment and structure
>3foc_A Tryptophanyl-tRNA synthetase; structural genomics, giardiasis, aminoacyl-tRNA synthetase, ligase; 2.09A {Giardia lamblia atcc 50803} Length = 451 Back     alignment and structure
>2g36_A Tryptophanyl-tRNA synthetase; TM0492, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: TRP; 2.50A {Thermotoga maritima} Length = 340 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target418 tyrosyl-tRNA synthetase [Candidatus Liberibacter asiati
2ts1_A419 Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Ge 100.0
1jil_A420 Tyrrs, tyrosyl-tRNA synthetase, tyrosyl-transfer; trunc 100.0
2jan_A432 Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacy 100.0
1h3f_A432 Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthet 100.0
1y42_X392 Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA li 100.0
2yxn_A322 Tyrosyl-tRNA synthetase; tRNA synthetases class I, stru 100.0
2pid_A356 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, pro 100.0
2zp1_A314 Tyrosyl-tRNA synthetase; tRNA synthetases class I, liga 100.0
2cyb_A323 Tyrosyl-tRNA synthetase; rossmann-fold, structural geno 100.0
1n3l_A372 Tyrosyl-tRNA synthetase; rossmann fold AS catalytic dom 100.0
2dlc_X394 Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase/tRN 100.0
3hv0_A393 Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, 100.0
2cya_A364 Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structu 100.0
1r6u_A437 Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, 100.0
1r6t_A477 Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, 100.0
3i05_A395 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-bind 100.0
2cyc_A375 Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylatio 100.0
2j5b_A348 Tyrosyl-tRNA synthetase; ligase, protein biosynthesis, 100.0
2ip1_A432 Tryptophanyl-tRNA synthetase; rossmann fold, structural 100.0
3hzr_A386 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structur 100.0
3jxe_A392 Tryptophanyl-tRNA synthetase; adenosine triphosphate, r 100.0
3foc_A451 Tryptophanyl-tRNA synthetase; structural genomics, giar 100.0
3n9i_A346 Tryptophanyl-tRNA synthetase; tryptophan-tRNA ligase, c 99.91
2g36_A340 Tryptophanyl-tRNA synthetase; TM0492, structural genomi 100.0
2el7_A337 Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase 100.0
3m5w_A322 Tryptophanyl-tRNA synthetase; alpha-beta structure, csg 100.0
1yi8_B351 Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A { 99.97
2yy5_A348 Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synthetas 99.93
1i6k_A328 TRPRS, tryptophanyl-tRNA synthetase; class I tRNA synth 99.92
2csx_A 497 Methionyl-tRNA synthetase; ligase, riken structural gen 98.59
3h99_A 560 Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRN 98.4
2d5b_A 500 Methionyl-tRNA synthetase; rossmann fold, class 1A AARS 97.97
3c8z_A414 Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fo 97.0
3kfl_A 564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA syn 96.48
1rqg_A 722 Methionyl-tRNA synthetase; translation, dimerization, l 93.59
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two indivi 90.32
1irx_A523 Lysyl-tRNA synthetase; beta sandwitch, zinc-binding str 98.41
1ffy_A 917 Isoleucyl-tRNA synthetase; protein-RNA complex, metal I 97.48
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, ross 97.27
1wz2_A 967 Leucyl-tRNA synthetase; ligase, riken structural genomi 97.13
1ile_A821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthe 96.81
3fnr_A464 Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, s 95.15
1nzj_A298 Hypothetical protein YADB; Zn cluster, glutamyl T-RNA s 90.82
2cfo_A