254780955

254780955

hypothetical protein CLIBASIA_04270

GeneID in NCBI database:8209977Locus tag:CLIBASIA_04270
Protein GI in NCBI database:254780955Protein Accession:YP_003065368.1
Gene range:-(951807, 952421)Protein Length:204aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein; K09985 hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MVSLWNFFSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEHIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKSTKKQNKNKMASVISLDNFRKK
ccHHHHHHcccEEEEEEEEHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccccccHHHHHHccccEEEEEEEEEccEEEEccEEEEEEEEcccccEEEEcHHHHHHHccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHccc
ccccccccccHHHHHHcHHHHHHccHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHccccEEEEEEEcccccEEccccEEEEEEccccccEEEEcHHHHHHccccccccEEEEcccccccHHccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHccc
MVSLWNFFSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVAsigslpgehhFYITFatnargvrisqnlrknypEKMTIVIQNQFWDLKVLDNHFevglsfsnvperlvipfnaikgfydpsvnfeleFDVHIEHIEEkleggntgkvltspdnfdknqtnsvsqdsskkkstkkQNKNKMASVISLDNFRKK
mvslwnffSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEHIEEKLEGGNTGKVLtspdnfdknqtnsvsqdsskkkstkkqnknkmasvisldnfrkk
MVSLWNFFSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEHIEEKLEGGNTGKVLTSPDNFDKNQTnsvsqdsskkkstkkqnknkMASVISLDNFRKK
**SLWNFFSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDV*******************************************************LDNFRKK
MVSLWNFFSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEHIEEKLEGGNTGKVLTSPDNFDK**********************KMASVISLDNFRKK
***LWNFFSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIE************************************************S*ISLDNFRKK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSLWNFFSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEHIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKSTKKQNKNKMASVISLDNFRKK
MVSLWNFFSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEHIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKSTKKQNKNKMASVISLDNFRKK
MVSLWNFFSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEHIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKSTKKQNKNKMASVISLDNFRKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target204 hypothetical protein CLIBASIA_04270 [Candidatus Liberib
315122503172 hypothetical protein CKC_03775 [Candidatus Liberibacter 1 9e-63
241205507171 hypothetical protein Rleg_2803 [Rhizobium leguminosarum 1 4e-54
218507824171 hypothetical protein RetlB5_09535 [Rhizobium etli Brasi 1 1e-53
116253000171 hypothetical protein RL3257 [Rhizobium leguminosarum bv 1 1e-53
86358404171 hypothetical protein RHE_CH02800 [Rhizobium etli CFN 42 1 2e-53
218463519171 hypothetical protein RetlK5_30634 [Rhizobium etli Kim 5 1 2e-53
209550126171 hypothetical protein Rleg2_2544 [Rhizobium leguminosaru 1 3e-53
190892529171 hypothetical protein RHECIAT_CH0002944 [Rhizobium etli 1 3e-53
222149085169 hypothetical protein Avi_2824 [Agrobacterium vitis S4] 1 1e-52
222086398169 hypothetical protein Arad_2936 [Agrobacterium radiobact 1 5e-52
>gi|315122503|ref|YP_004062992.1| hypothetical protein CKC_03775 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 172 Back     alignment and organism information
 Score =  243 bits (621), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 120/165 (72%), Positives = 136/165 (82%), Gaps = 1/165 (0%)

Query: 25  MNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNY 84
           MN+DHIRYDIL KEALRGLVK VL+E A+IGSLPG+HHFYITFATNARGVRISQN++K Y
Sbjct: 1   MNHDHIRYDILTKEALRGLVKTVLAETAAIGSLPGDHHFYITFATNARGVRISQNIKKIY 60

Query: 85  PEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHI 144
           PEK+TIVIQNQFWDLKV DNHFEVGLSFSNVPE L IPFNAI+GFYDPSVNFELEFDVH+
Sbjct: 61  PEKITIVIQNQFWDLKVFDNHFEVGLSFSNVPELLSIPFNAIQGFYDPSVNFELEFDVHL 120

Query: 145 EHIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKSTKKQNK 189
              EE+LE    G+VL  P+NF+K+Q+    +        KKQ K
Sbjct: 121 YDAEEELE-NKKGEVLGLPENFNKDQSPDSLEKLPTDNKEKKQKK 164


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241205507|ref|YP_002976603.1| hypothetical protein Rleg_2803 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 171 Back     alignment and organism information
>gi|218507824|ref|ZP_03505702.1| hypothetical protein RetlB5_09535 [Rhizobium etli Brasil 5] Length = 171 Back     alignment and organism information
>gi|116253000|ref|YP_768838.1| hypothetical protein RL3257 [Rhizobium leguminosarum bv. viciae 3841] Length = 171 Back     alignment and organism information
>gi|86358404|ref|YP_470296.1| hypothetical protein RHE_CH02800 [Rhizobium etli CFN 42] Length = 171 Back     alignment and organism information
>gi|218463519|ref|ZP_03503610.1| hypothetical protein RetlK5_30634 [Rhizobium etli Kim 5] Length = 171 Back     alignment and organism information
>gi|209550126|ref|YP_002282043.1| hypothetical protein Rleg2_2544 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 171 Back     alignment and organism information
>gi|190892529|ref|YP_001979071.1| hypothetical protein RHECIAT_CH0002944 [Rhizobium etli CIAT 652] Length = 171 Back     alignment and organism information
>gi|222149085|ref|YP_002550042.1| hypothetical protein Avi_2824 [Agrobacterium vitis S4] Length = 169 Back     alignment and organism information
>gi|222086398|ref|YP_002544932.1| hypothetical protein Arad_2936 [Agrobacterium radiobacter K84] Length = 169 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target204 hypothetical protein CLIBASIA_04270 [Candidatus Liberib
pfam04386152 pfam04386, SspB, Stringent starvation protein B 5e-44
COG3814157 COG3814, COG3814, Uncharacterized protein conserved in 7e-47
>gnl|CDD|146826 pfam04386, SspB, Stringent starvation protein B Back     alignment and domain information
>gnl|CDD|33607 COG3814, COG3814, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 204 hypothetical protein CLIBASIA_04270 [Candidatus Liberib
pfam07031153 consensus 100.0
COG3814157 Uncharacterized protein conserved in bacteria [Function 100.0
pfam04386152 SspB Stringent starvation protein B. Escherichia coli s 100.0
PRK11798140 ClpXP protease specificity-enhancing factor; Provisiona 98.01
COG2969155 SspB Stringent starvation protein B [General function p 95.85
>pfam07031 consensus Back     alignment and domain information
>COG3814 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam04386 SspB Stringent starvation protein B Back     alignment and domain information
>PRK11798 ClpXP protease specificity-enhancing factor; Provisional Back     alignment and domain information
>COG2969 SspB Stringent starvation protein B [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target204 hypothetical protein CLIBASIA_04270 [Candidatus Liberib
2nys_A176 X-Ray Crystal Structure Of Protein Agr_c_3712 From 1e-53
2qas_A157 Crystal Structure Of Caulobacter Crescentus Sspb Or 4e-40
2qaz_A128 Structure Of C. Crescentus Sspb Ortholog Length = 1 9e-40
>gi|119390693|pdb|2NYS|A Chain A, X-Ray Crystal Structure Of Protein Agr_c_3712 From Agrobacterium Tumefaciens. Northeast Structural Genomics Consortium Target Atr88. Length = 176 Back     alignment and structure
 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 96/178 (53%), Positives = 122/178 (68%), Gaps = 13/178 (7%)

Query: 27  YDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPE 86
            DHIRYDILA++ALRG+++ VL EVA+ G LPG+HHF+ITF T A GVRISQ+L+  Y E
Sbjct: 3   QDHIRYDILAQDALRGVIRKVLGEVAATGRLPGDHHFFITFLTGAPGVRISQHLKSKYAE 62

Query: 87  KMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEH 146
           + TIVIQ+QFWD KV +  FE+GLSFS+ PE+LVIP+NAI+GFYDPSVNFELEFDV +  
Sbjct: 63  QXTIVIQHQFWDXKVTETGFEIGLSFSDTPEKLVIPYNAIRGFYDPSVNFELEFDVPLAK 122

Query: 147 IEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKSTKKQNKNKMASVISLDNFRKK 204
            EE  E   T   ++              +     ++ K   + K  SV+SLD FRKK
Sbjct: 123 EEEXEEAEITAYPVS-------------HEAKPASETPKSGEEKKEGSVVSLDAFRKK 167


>gi|158429805|pdb|2QAZ|A Chain A, Structure Of C. Crescentus Sspb Ortholog Length = 128 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target204 hypothetical protein CLIBASIA_04270 [Candidatus Liberib
2nys_A176 AGR_C_3712P; SSPB, stringent starvation protein B, NESG 6e-48
2qas_A157 SSPB, hypothetical protein; SSPB, adaptor, CLPX, unknow 2e-45
1ou9_A129 Stringent starvation protein B homolog; SSRA peptide-bi 2e-14
>2nys_A AGR_C_3712P; SSPB, stringent starvation protein B, NESG, ATR88, structural genomics, PSI-2, protein structure initiative; 2.70A {Agrobacterium tumefaciens str} SCOP: b.136.1.2 Length = 176 Back     alignment and structure
 Score =  185 bits (471), Expect = 6e-48
 Identities = 96/180 (53%), Positives = 123/180 (68%), Gaps = 13/180 (7%)

Query: 25  MNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNY 84
           M  DHIRYDILA++ALRG+++ VL EVA+ G LPG+HHF+ITF T A GVRISQ+L+  Y
Sbjct: 1   MGQDHIRYDILAQDALRGVIRKVLGEVAATGRLPGDHHFFITFLTGAPGVRISQHLKSKY 60

Query: 85  PEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHI 144
            E+MTIVIQ+QFWD+KV +  FE+GLSFS+ PE+LVIP+NAI+GFYDPSVNFELEFDV +
Sbjct: 61  AEQMTIVIQHQFWDMKVTETGFEIGLSFSDTPEKLVIPYNAIRGFYDPSVNFELEFDVPL 120

Query: 145 EHIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKSTKKQNKNKMASVISLDNFRKK 204
              EE              +  +        +     ++ K   + K  SV+SLD FRKK
Sbjct: 121 AKEEE-------------MEEAEITAYPVSHEAKPASETPKSGEEKKEGSVVSLDAFRKK 167


>1ou9_A Stringent starvation protein B homolog; SSRA peptide-binding protein, homodimer, transport protein; 1.80A {Haemophilus influenzae} SCOP: b.136.1.1 PDB: 1oul_A 1zsz_C Length = 129 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target204 hypothetical protein CLIBASIA_04270 [Candidatus Liberib
2nys_A176 AGR_C_3712P; SSPB, stringent starvation protein B, NESG 100.0
2qas_A157 SSPB, hypothetical protein; SSPB, adaptor, CLPX, unknow 100.0
1yfn_A118 Stringent starvation protein B; protein-peptide complex 98.44
1ou8_A111 Stringent starvation protein B homolog; peptide-binding 98.43
1ou9_A129 Stringent starvation protein B homolog; SSRA peptide-bi 98.32
>2nys_A AGR_C_3712P; SSPB, stringent starvation protein B, NESG, ATR88, structural genomics, PSI-2, protein structure initiative; 2.70A {Agrobacterium tumefaciens str} SCOP: b.136.1.2 Back     alignment and structure
Probab=100.00  E-value=0  Score=430.82  Aligned_cols=167  Identities=59%  Similarity=0.958  Sum_probs=140.7

Q ss_pred             CHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCHHHHHHCCCEEEEEEEEEECCEEECCC
Q ss_conf             02210498999999999999999999997089998746999984588887759899963975379984311218076454
Q gi|254780955|r   25 MNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDN  104 (204)
Q Consensus        25 M~~Dli~Y~~l~~~Alr~Vvr~~L~~v~~~g~LpG~hHfyItF~T~~~gV~ip~~L~~~yP~emTIVlQhqf~dL~V~~~  104 (204)
                      |++|+|+|++|+++|||||||++|+.|+++|+|||+|||||||+|++|||+||+||+++||+|||||||||||||.|+++
T Consensus         1 m~~d~i~Y~~l~~~alr~vvr~~L~~v~~~G~lpg~hHfYItf~t~~pGV~vP~~l~~~yp~emtiVlq~qf~dL~V~~d   80 (176)
T 2nys_A            1 MGQDHIRYDILAQDALRGVIRKVLGEVAATGRLPGDHHFFITFLTGAPGVRISQHLKSKYAEQMTIVIQHQFWDMKVTET   80 (176)
T ss_dssp             --CCSSCHHHHHHHHHHHHHHHHHHHHHHHSSCCTTCCEEEEEESSSTTCBCCHHHHHHSSSEEEEEESSSCEEEEECSS
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCHHHHHCCCCCEEEECHHHHCCEEEECC
T ss_conf             98450479999999999999999999998297998866999997699995889999862984148964555359088546


Q ss_pred             EEEEEEEECCEEEEEEEEHHHHEEEECCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             79999984987668998442420230677530356034676654334445654444456556643344444445556655
Q gi|254780955|r  105 HFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEHIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKST  184 (204)
Q Consensus       105 ~FsV~LsF~g~~e~L~IPf~AIt~F~DPSV~FgLqF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  184 (204)
                      +|||+|||||+|++|+|||+||++|+||||+|||+|+.....+.+..+.....             ...........++.
T Consensus        81 ~fsf~lrF~Gvp~~l~IP~~AI~af~dpevgfGL~F~~~~~~~~~~~~~~~~~-------------~~~~~~~~~~~~~~  147 (176)
T 2nys_A           81 GFEIGLSFSDTPEKLVIPYNAIRGFYDPSVNFELEFDVPLAKEEEMEEAEITA-------------YPVSHEAKPASETP  147 (176)
T ss_dssp             EEEEEEEETTEEEEEEEEGGGEEEEEEGGGTEEEECCCC-----------------------------------------
T ss_pred             EEEEEEEECCEEEEEEEEHHHEEEEECCCCCCCEECCCCCCCCCCCCCCCCCC-------------CCCCCCCCCCCCCC
T ss_conf             58999998996079998757801656767786223288665444445566667-------------77764456777788


Q ss_pred             CCCCCCCCCCEEEEEECCCC
Q ss_conf             56665677728983100269
Q gi|254780955|r  185 KKQNKNKMASVISLDNFRKK  204 (204)
Q Consensus       185 ~~~~~~~~aeVVSLD~FRKK  204 (204)
                      ++..++++++|||||+||||
T Consensus       148 ~~~~~k~~~~VVsld~frkK  167 (176)
T 2nys_A          148 KSGEEKKEGSVVSLDAFRKK  167 (176)
T ss_dssp             --------------------
T ss_pred             CCCCCCCCCCEEEECCCCCC
T ss_conf             88777888988970310268



>1yfn_A Stringent starvation protein B; protein-peptide complex, SSPB, RSEA, protein binding; 1.80A {Escherichia coli} SCOP: b.136.1.1 PDB: 1ox9_A 1ox8_A Back     alignment and structure
>1ou8_A Stringent starvation protein B homolog; peptide-binding pocket, protein-peptide complex, homodimer, transport protein; 1.60A {Haemophilus influenzae} SCOP: b.136.1.1 PDB: 1zsz_A 1twb_A 1zsz_B Back     alignment and structure
>1ou9_A Stringent starvation protein B homolog; SSRA peptide-binding protein, homodimer, transport protein; 1.80A {Haemophilus influenzae} SCOP: b.136.1.1 PDB: 1oul_A 1zsz_C Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 204 hypothetical protein CLIBASIA_04270 [Candidatus Liberib
d2nysa1117 b.136.1.2 (A:3-119) Uncharacterized protein AGR_C_3712p 7e-48
>d2nysa1 b.136.1.2 (A:3-119) Uncharacterized protein AGR_C_3712p {Agrobacterium tumefaciens [TaxId: 358]} Length = 117 Back     information, alignment and structure

class: All beta proteins
fold: SspB-like
superfamily: SspB-like
family: AGR C 3712p-like
domain: Uncharacterized protein AGR C 3712p
species: Agrobacterium tumefaciens [TaxId: 358]
 Score =  184 bits (468), Expect = 7e-48
 Identities = 82/115 (71%), Positives = 101/115 (87%)

Query: 28  DHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEK 87
           DHIRYDILA++ALRG+++ VL EVA+ G LPG+HHF+ITF T A GVRISQ+L+  Y E+
Sbjct: 2   DHIRYDILAQDALRGVIRKVLGEVAATGRLPGDHHFFITFLTGAPGVRISQHLKSKYAEQ 61

Query: 88  MTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDV 142
           MTIVIQ+QFWD+KV +  FE+GLSFS+ PE+LVIP+NAI+GFYDPSVNFELEFDV
Sbjct: 62  MTIVIQHQFWDMKVTETGFEIGLSFSDTPEKLVIPYNAIRGFYDPSVNFELEFDV 116


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target204 hypothetical protein CLIBASIA_04270 [Candidatus Liberib
d2nysa1117 Uncharacterized protein AGR_C_3712p {Agrobacterium tume 100.0
d1yfna1108 Stringent starvation protein B, SspB {Escherichia coli 98.47
d1ou8a_106 Stringent starvation protein B, SspB {Haemophilus influ 98.37
>d2nysa1 b.136.1.2 (A:3-119) Uncharacterized protein AGR_C_3712p {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
class: All beta proteins
fold: SspB-like
superfamily: SspB-like
family: AGR C 3712p-like
domain: Uncharacterized protein AGR C 3712p
species: Agrobacterium tumefaciens [TaxId: 358]
Probab=100.00  E-value=0  Score=404.78  Aligned_cols=116  Identities=71%  Similarity=1.221  Sum_probs=114.3

Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCHHHHHHCCCEEEEEEEEEECCEEECCCEE
Q ss_conf             21049899999999999999999999708999874699998458888775989996397537998431121807645479
Q gi|254780955|r   27 YDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHF  106 (204)
Q Consensus        27 ~Dli~Y~~l~~~Alr~Vvr~~L~~v~~~g~LpG~hHfyItF~T~~~gV~ip~~L~~~yP~emTIVlQhqf~dL~V~~~~F  106 (204)
                      +|+|+|++|+++|||+|||++|+.|+++|+|||+|||||||+|++|||+||+|||++||+|||||||||||||+|++++|
T Consensus         1 ~d~i~Y~~lv~~alr~Vvr~~L~~v~~~G~Lpg~hHfyITF~T~~~gV~ip~~L~~~YPeEMTIVlQhqF~dL~V~~~~F   80 (117)
T d2nysa1           1 QDHIRYDILAQDALRGVIRKVLGEVAATGRLPGDHHFFITFLTGAPGVRISQHLKSKYAEQMTIVIQHQFWDMKVTETGF   80 (117)
T ss_dssp             CCSSCHHHHHHHHHHHHHHHHHHHHHHHSSCCTTCCEEEEEESSSTTCBCCHHHHHHSSSEEEEEESSSCEEEEECSSEE
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCHHHHHHCCCCCEEEEEEEECCCEECCCEE
T ss_conf             97247899999999999999999999749799984899999749999678999996198715999862234335322638


Q ss_pred             EEEEEECCEEEEEEEEHHHHEEEECCCCCEEEEECC
Q ss_conf             999984987668998442420230677530356034
Q gi|254780955|r  107 EVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDV  142 (204)
Q Consensus       107 sV~LsF~g~~e~L~IPf~AIt~F~DPSV~FgLqF~~  142 (204)
                      ||+|||||+||+|+|||+||++|+||||+|||||+.
T Consensus        81 sV~LsF~~~~e~L~IPf~aI~~F~DPsv~FgL~F~~  116 (117)
T d2nysa1          81 EIGLSFSDTPEKLVIPYNAIRGFYDPSVNFELEFDV  116 (117)
T ss_dssp             EEEEEETTEEEEEEEEGGGEEEEEEGGGTEEEECCC
T ss_pred             EEEEEECCEEEEEEEEHHHHHEECCCCCCEEEEECC
T ss_conf             999970993578994368830123888772897148



>d1yfna1 b.136.1.1 (A:4-111) Stringent starvation protein B, SspB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ou8a_ b.136.1.1 (A:) Stringent starvation protein B, SspB {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 204 hypothetical protein CLIBASIA_04270 [Candidatus Li
2nys_A_176 (A:) AGR_C_3712P; SSPB, stringent starvation prote 5e-59
2qas_A_157 (A:) SSPB, hypothetical protein; SSPB, adaptor, CL 1e-54
1yfn_A_118 (A:) Stringent starvation protein B; protein-pepti 4e-24
1ou9_A_129 (A:) Stringent starvation protein B homolog; SSRA 6e-22
1ou8_A_111 (A:) Stringent starvation protein B homolog; pepti 8e-21
>2nys_A (A:) AGR_C_3712P; SSPB, stringent starvation protein B, NESG, ATR88, structural genomics, PSI-2, protein structure initiative; 2.70A {Agrobacterium tumefaciens str}Length = 176 Back     alignment and structure
 Score =  221 bits (565), Expect = 5e-59
 Identities = 97/177 (54%), Positives = 122/177 (68%), Gaps = 13/177 (7%)

Query: 28  DHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEK 87
           DHIRYDILA++ALRG+++ VL EVA+ G LPG+HHF+ITF T A GVRISQ+L+  Y E+
Sbjct: 4   DHIRYDILAQDALRGVIRKVLGEVAATGRLPGDHHFFITFLTGAPGVRISQHLKSKYAEQ 63

Query: 88  MTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEHI 147
            TIVIQ+QFWD KV +  FE+GLSFS+ PE+LVIP+NAI+GFYDPSVNFELEFDV +   
Sbjct: 64  XTIVIQHQFWDXKVTETGFEIGLSFSDTPEKLVIPYNAIRGFYDPSVNFELEFDVPLAKE 123

Query: 148 EEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKSTKKQNKNKMASVISLDNFRKK 204
           EE  E   T      P + +    +   +   +KK           SV+SLD FRKK
Sbjct: 124 EEXEEAEIT----AYPVSHEAKPASETPKSGEEKKE---------GSVVSLDAFRKK 167


>1yfn_A (A:) Stringent starvation protein B; protein-peptide complex, SSPB, RSEA, protein binding; 1.80A {Escherichia coli}Length = 118 Back     alignment and structure
>1ou9_A (A:) Stringent starvation protein B homolog; SSRA peptide-binding protein, homodimer, transport protein; 1.80A {Haemophilus influenzae}Length = 129 Back     alignment and structure
>1ou8_A (A:) Stringent starvation protein B homolog; peptide-binding pocket, protein-peptide complex, homodimer, transport protein; 1.60A {Haemophilus influenzae}Length = 111 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target204 hypothetical protein CLIBASIA_04270 [Candidatus Liberib
2nys_A_176 AGR_C_3712P; SSPB, stringent starvation protein B, 100.0
2qas_A_157 SSPB, hypothetical protein; SSPB, adaptor, CLPX, u 100.0
1yfn_A_118 Stringent starvation protein B; protein-peptide co 99.94
1ou9_A_129 Stringent starvation protein B homolog; SSRA pepti 99.92
1ou8_A_111 Stringent starvation protein B homolog; peptide-bi 99.9
>2nys_A (A:) AGR_C_3712P; SSPB, stringent starvation protein B, NESG, ATR88, structural genomics, PSI-2, protein structure initiative; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
Probab=100.00  E-value=0  Score=488.76  Aligned_cols=166  Identities=58%  Similarity=0.943  Sum_probs=141.3

Q ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCHHHHHHCCCEEEEEEEEEECCEEECCCE
Q ss_conf             22104989999999999999999999970899987469999845888877598999639753799843112180764547
Q gi|254780955|r   26 NYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNH  105 (204)
Q Consensus        26 ~~Dli~Y~~l~~~Alr~Vvr~~L~~v~~~g~LpG~hHfyItF~T~~~gV~ip~~L~~~yP~emTIVlQhqf~dL~V~~~~  105 (204)
                      ++|+|+|++||++|||||||+||..|++.|+|||+|||||||+|++|||+||+|||+|||+|||||||||||||+|++++
T Consensus         2 a~d~I~Y~~l~~~AlrgVVr~vL~~va~~g~LPG~HHFyITF~T~~pGV~l~~~L~~~YP~EMTIVLQHQF~dL~V~e~~   81 (176)
T 2nys_A            2 GQDHIRYDILAQDALRGVIRKVLGEVAATGRLPGDHHFFITFLTGAPGVRISQHLKSKYAEQXTIVIQHQFWDXKVTETG   81 (176)
T ss_dssp             -CCSSCHHHHHHHHHHHHHHHHHHHHHHHSSCCTTCCEEEEEESSSTTCBCCHHHHHHSSSEEEEEESSSCEEEEECSSE
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCHHHHHHCCCEEEEEHHHHHCCEEEECCE
T ss_conf             73405799999999999999999999983979988679999965999958899998609843778636553230781364


Q ss_pred             EEEEEEECCEEEEEEEEHHHHEEEECCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99999849876689984424202306775303560346766543344456544444565566433444444455566555
Q gi|254780955|r  106 FEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEHIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKSTK  185 (204)
Q Consensus       106 FsV~LsF~g~~e~L~IPf~AIt~F~DPSV~FgLqF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  185 (204)
                      |||+|||||+||+|+|||+||++|+||||+|||||++..+.+++..+......             ..........+.++
T Consensus        82 FsV~LsFgg~pE~L~IPf~AI~~F~DPsv~F~L~Fe~~~~~~~~~~~~~~~~~-------------~~~~~~~~~~~~~~  148 (176)
T 2nys_A           82 FEIGLSFSDTPEKLVIPYNAIRGFYDPSVNFELEFDVPLAKEEEXEEAEITAY-------------PVSHEAKPASETPK  148 (176)
T ss_dssp             EEEEEEETTEEEEEEEEGGGEEEEEEGGGTEEEECCCC------------------------------------------
T ss_pred             EEEEEEECCEEEEEEEEHHHHHEEECCCCCCCEECCCCCCCCCCCCCCCCCCC-------------CCCCCCCCCCCCCC
T ss_conf             89999759986999988688236267677864321886654444456666667-------------76655577767887


Q ss_pred             CCCCCCCCCEEEEEECCCC
Q ss_conf             6665677728983100269
Q gi|254780955|r  186 KQNKNKMASVISLDNFRKK  204 (204)
Q Consensus       186 ~~~~~~~aeVVSLD~FRKK  204 (204)
                      .....++|+|||||+||||
T Consensus       149 ~~~~~~~a~VVsLD~FRKK  167 (176)
T 2nys_A          149 SGEEKKEGSVVSLDAFRKK  167 (176)
T ss_dssp             -------------------
T ss_pred             CCCCCCCCCEEEECCCCCC
T ss_conf             8787888999971310267



>1yfn_A (A:) Stringent starvation protein B; protein-peptide complex, SSPB, RSEA, protein binding; 1.80A {Escherichia coli} Back     alignment and structure
>1ou9_A (A:) Stringent starvation protein B homolog; SSRA peptide-binding protein, homodimer, transport protein; 1.80A {Haemophilus influenzae} Back     alignment and structure
>1ou8_A (A:) Stringent starvation protein B homolog; peptide-binding pocket, protein-peptide complex, homodimer, transport protein; 1.60A {Haemophilus influenzae} Back     alignment and structure