254780954

254780954

hypothetical protein CLIBASIA_04265

GeneID in NCBI database:8209976Locus tag:CLIBASIA_04265
Protein GI in NCBI database:254780954Protein Accession:YP_003065367.1
Gene range:+(950302, 951444)Protein Length:380aa
Gene description:hypothetical protein
COG prediction:[M] Uncharacterized protein involved in outer membrane biogenesis
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP3 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380
MLRRVLIGLGFLFSVVLVGAFTVPLFIDWTDFREDFERQATLIVGKKIAVKGGIKIHILPFPSVFFKDIRIDQKEDGSFESKIEGLSMRAEFLPLLSGEIRVFDMYIDQPHLNFYLSSKGVSNWFQRKSTMDMIHNVILEKIHVKGGRIKIIDQESDQVYFLSDLNLQISARFLNIISPLSIDSIKGSVIAEGTGNFDNKRSAFKITANFPAKNKAISLKIQLFPLAYPIIIDLFGNLFWNEKQPIYSGVFSVAGDFSKLLNLELSAKKSRLSGNFKISDGNVRISRYKLQSILPNSSTDEDNKTKVSQDEENLLNFSENGAESMHDLNETDFFEEEEKKNKNDDLKKDDIQYSVNKKEEKDNSHDKENQENFSGDKMIL
cccEEEHHHHHHHHHHHHHHHHccEEccHHHHHHHHHHHHHHHccccEEEEcccEEEEEcccEEEEEEEEEcccccccccEEEEEEEEEEEccHHHccccEEEEEEEcccEEEEEEcccccccccccccccccccccccccEEEEccEEEEEEcccccEEEEccEEEEcccccccccccEEEcccccEEEEEEEEEEcccccccEEEcccccccccEEEEEEEccccccccEEcccccccccccccccEEEEEcccccHHccccccccccccccEEEEcccccEEEEccHHHHccccccHHHHHcccccccccEEEEEccccccccccccccHHHHHccccccccccHHHHHHccccHHHHcccccHHHHHccccccEEc
ccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccEEEEEccEEEEEcccccEEEcEEEEcccccccccEEEcEEEEEEEcHHHHcccEEEcEEEEcccEEEEEEccccccccccccccccccccEEEcEEEEEccEEEEEEcccccEEEEccEEEEEccccccccccccccHccccEEEcEEEEEEcEEccEEEEcccccccccEEEEEEEccccccEEEEEccEEEcccccccEcEEEEEcccHHHHHcccccccccEEEEEEEcccHHcccccEEEEcccccccEEEEEEEEEEccccccEEEEEccccccccccccccccccccccccccccHccEEEEEccccccccccccccccccccccccc
MLRRVLIGLGFLFSVVLVGAftvplfidwtdfREDFERQATLIVGkkiavkggikihilpfpsvffkdiridqkedgsfeskIEGLSMRAEflpllsgeirvfdmyidqphlnfylsskgvsnwfqrKSTMDMIHNVILEKIhvkggrikiidqesdqvyflsdlNLQISARFLNiisplsidsikgsviaegtgnfdnkrsafkitanfpaknkAISLKIQLFPLAYPIIIDLFgnlfwnekqpiysgvfsvaGDFSKLLNLELSAkksrlsgnfkisdgnvriSRYKLqsilpnsstdednktkvsQDEENLLNFSengaesmhdlnetdffeeeekknknddlkkddiqysvnkkeekdnshdkenqenfsgdkmil
MLRRVLIGLGFLFSVVLVGAFTVPLFIDWTDFREDFERQATLIVgkkiavkggikihilpfpsvfFKDIRIDQKEDGSFESKIEGLSMRAEFLPLLSGEIRVFDMYIDQPHLNFYLSSKGVSNWFQRKSTMDMIHNVILEKIHVKGGRIKIIDQESDQVYFLSDLNLQISARFLNIISPLSIDSIKGSVIAEGTGNFDNKRSAFKITANFPAKNKAISLKIQLFPLAYPIIIDLFGNLFWNEKQPIYSGVFSVAGDFSKLLNLELSakksrlsgnfkisdgnvrisrYKLQsilpnsstdednktkvSQDEENLLNFSENGAESMHDLNETDFFEEeekknknddlkkddiqysvnkkeekdnshdkenqenfsgdkmil
MLRRVLIGLGFLFSVVLVGAFTVPLFIDWTDFREDFERQATLivgkkiavkggikiHILPFPSVFFKDIRIDQKEDGSFESKIEGLSMRAEFLPLLSGEIRVFDMYIDQPHLNFYLSSKGVSNWFQRKSTMDMIHNVILEKIHVKGGRIKIIDQESDQVYFLSDLNLQISARFLNIISPLSIDSIKGSVIAEGTGNFDNKRSAFKITANFPAKNKAISLKIQLFPLAYPIIIDLFGNLFWNEKQPIYSGVFSVAGDFSKLLNLELSAKKSRLSGNFKISDGNVRISRYKLQSILPNSSTDEDNKTKVSQDEENLLNFSENGAESMHdlnetdffeeeekknknddlkkddIQYSVNKKEEKDNSHDKENQENFSGDKMIL
MLRRVLIGLGFLFSVVLVGAFTVPLFIDWTDFREDFERQATLIVGKKIAVKGGIKIHILPFPSVFFKDIRIDQKEDGSFESKIEGLSMRAEFLPLLSGEIRVFDMYIDQPHLNFYLSSK*******************LEKIHVKGGRIKIIDQESDQVYFLSDLNLQISARFLNIISPLSIDSIKGSVIAEGTGNFDNKRSAFKIT**********SLKIQLFPLAYPIIIDLFGNLFWNEKQPIYSGVFSVAGDFSKLLN*E***KKSRLSGNFKISDGNVRISRYKLQSILPNSSTDED**T*VSQDEENLLNFSENGAESMHDLNET******************DIQYSV*****************FSGDKMIL
MLRRVLIGLGFLFSVVLVGAFTVPLFIDWTDFREDFERQATLIVGKKIAVKGGIKIHILPFPSVFFKDIRIDQKEDGSFESKIEGLSMRAEFLPLLSGEIRVFDMYIDQPHLNFYLSSKGVSNWFQRKSTMDMIHNVILEKIHVKGGRIKIIDQESDQVYFLSDLNLQISARFLNIISPLSIDSIKGSVIAEGTGNFDNKRSAFKITANFPAKNKAISLKIQLFPLAYPIIIDLFGNLFWNEKQPIYSGVFSVAGDFSKLLNLELSAKKSRLSGNFKISDGNVRISRYKLQSILPN**************EENLLNFSENGAESMHDLNETDF**********DDLKKDDIQYSVN************************
MLRRVLIGLGFLFSVVLVGAFTVPLFIDWTDFREDFERQATLIVGKKIAVKGGIKIHILPFPSVFFKDIRIDQKEDGSFESKIEGLSMRAEFLPLLSGEIRVFDMYIDQPHLNFYLSSKGVSNWFQRKSTMDMIHNVILEKIHVKGGRIKIIDQESDQVYFLSDLNLQISARFLNIISPLSIDSIKGSVIAEGTGNFDNKRSAFKITANFPAKNKAISLKIQLFPLAYPIIIDLFGNLFWNEKQPIYSGVFSVAGDFSKLLNLELSAKKSRLSGNFKISDGNVRISRYKLQSILPNSSTDEDNKTKVSQDEENLLNFSENGAESMHDLNETDFFEEEEKKNKNDDLKKDDIQYSVNKK**********************
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MLRRVLIGLGFLFSVVLVGAFTVPLFIDWTDFREDFERQATLIVGKKIAVKGGIKIHILPFPSVFFKDIRIDQKEDGSFESKIEGLSMRAEFLPLLSGEIRVFDMYIDQPHLNFYLSSKGVSNWFQRKSTMDMIHNVILEKIHVKGGRIKIIDQESDQVYFLSDLNLQISARFLNIISPLSIDSIKGSVIAEGTGNFDNKRSAFKITANFPAKNKAISLKIQLFPLAYPIIIDLFGNLFWNEKQPIYSGVFSVAGDFSKLLNLELSAKKSRLSGNFKISDGNVRISRYKLQSILPNSSTDEDNKTKVSQDEENLLNFSENGAESMHDLNETDFFEEEEKKNKNDDLKKDDIQYSVNKKEEKDNSHDKENQENFSGDKMIL
MLRRVLIGLGFLFSVVLVGAFTVPLFIDWTDFREDFERQATLIVGKKIAVKGGIKIHILPFPSVFFKDIRIDQKEDGSFESKIEGLSMRAEFLPLLSGEIRVFDMYIDQPHLNFYLSSKGVSNWFQRKSTMDMIHNVILEKIHVKGGRIKIIDQESDQVYFLSDLNLQISARFLNIISPLSIDSIKGSVIAEGTGNFDNKRSAFKITANFPAKNKAISLKIQLFPLAYPIIIDLFGNLFWNEKQPIYSGVFSVAGDFSKLLNLELSAKKSRLSGNFKISDGNVRISRYKLQSILPNSSTDEDNKTKVSQDEENLLNFSENGAESMHDLNETDFFEEEEKKNKNDDLKKDDIQYSVNKKEEKDNSHDKENQENFSGDKMIL
MLRRVLIGLGFLFSVVLVGAFTVPLFIDWTDFREDFERQATLIVGKKIAVKGGIKIHILPFPSVFFKDIRIDQKEDGSFESKIEGLSMRAEFLPLLSGEIRVFDMYIDQPHLNFYLSSKGVSNWFQRKSTMDMIHNVILEKIHVKGGRIKIIDQESDQVYFLSDLNLQISARFLNIISPLSIDSIKGSVIAEGTGNFDNKRSAFKITANFPAKNKAISLKIQLFPLAYPIIIDLFGNLFWNEKQPIYSGVFSVAGDFSKLLNLELSAKKSRLSGNFKISDGNVRISRYKLQSILPNSSTDEDNKTKVSQDEENLLNFSENGAESMHDLNETDFFEEEEKKNKNDDLKKDDIQYSVNKKEEKDNSHDKENQENFSGDKMIL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target380 hypothetical protein CLIBASIA_04265 [Candidatus Liberib
315122504336 hypothetical protein CKC_03780 [Candidatus Liberibacter 1 6e-83
209550129 1234 hypothetical protein Rleg2_2547 [Rhizobium leguminosaru 1 6e-45
86358407 1236 hypothetical protein RHE_CH02803 [Rhizobium etli CFN 42 1 1e-44
15889338 1234 hypothetical protein Atu2052 [Agrobacterium tumefaciens 1 3e-44
325293421 1243 hypothetical protein AGROH133_07317 [Agrobacterium sp. 1 4e-44
241205510 1238 hypothetical protein Rleg_2806 [Rhizobium leguminosarum 1 7e-44
116253003 1238 hypothetical protein RL3260 [Rhizobium leguminosarum bv 1 9e-44
150397231 1246 hypothetical protein Smed_2030 [Sinorhizobium medicae W 1 1e-43
190892532 1234 hypothetical protein RHECIAT_CH0002947 [Rhizobium etli 1 2e-43
222086401 1234 hypothetical protein Arad_2939 [Agrobacterium radiobact 1 1e-41
>gi|315122504|ref|YP_004062993.1| hypothetical protein CKC_03780 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 336 Back     alignment and organism information
 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 159/311 (51%), Positives = 221/311 (71%), Gaps = 11/311 (3%)

Query: 11  FLFSVVLVGAFTVPLFIDWTDFREDFERQATLIVGKKIAVKGGIKIHILPFPSVFFKDIR 70
           FL SV+L+GAF++P FI WTDF+E  ERQA+L +GKKI V+G I++ ILPFP++ F+DI 
Sbjct: 27  FLLSVLLLGAFSIPFFISWTDFQEKIERQASLFIGKKIVVRG-IEVSILPFPAIVFRDIG 85

Query: 71  IDQKEDGSFESKIEGLSMRAEFLPLLSGEIRVFDMYIDQPHLNFYLS-SKGV-------- 121
           IDQ+++GSFES+I+ +S+   F PLL GEIRV DM+ID+P++ FYL  +KG+        
Sbjct: 86  IDQRDNGSFESRIKKISINVHFFPLLFGEIRVCDMHIDRPYVTFYLPKNKGMFNVSKESN 145

Query: 122 -SNWFQRKSTMDMIHNVILEKIHVKGGRIKIIDQESDQVYFLSDLNLQISARFLNIISPL 180
             N     S M MIHN++LEK H+  GRI+IIDQESD+ YF+S LNL+ISA  L+I SPL
Sbjct: 146 KVNSSHENSIMAMIHNIVLEKSHIDEGRIQIIDQESDKSYFISGLNLEISANILDISSPL 205

Query: 181 SIDSIKGSVIAEGTGNFDNKRSAFKITANFPAKNKAISLKIQLFPLAYPIIIDLFGNLFW 240
           SI+SIKG +  EG G +++ +S+FKI A  PA+N +  LK+Q+  L Y I+ D  GN FW
Sbjct: 206 SINSIKGFIGVEGRGKYEDNKSSFKIMATLPAQNNSFPLKVQIASLDYSIVFDFNGNFFW 265

Query: 241 NEKQPIYSGVFSVAGDFSKLLNLELSAKKSRLSGNFKISDGNVRISRYKLQSILPNSSTD 300
           ++K PIY+GVFS  G  SKLL L++  + S++SG+F  SD ++RI  YKLQS    S  D
Sbjct: 266 DQKNPIYTGVFSAYGHISKLLPLKIPIEWSKVSGDFDFSDWHMRIEHYKLQSGSLRSLKD 325

Query: 301 EDNKTKVSQDE 311
           +D  ++  +D+
Sbjct: 326 KDQSSEQKRDK 336


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209550129|ref|YP_002282046.1| hypothetical protein Rleg2_2547 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 1234 Back     alignment and organism information
>gi|86358407|ref|YP_470299.1| hypothetical protein RHE_CH02803 [Rhizobium etli CFN 42] Length = 1236 Back     alignment and organism information
>gi|15889338|ref|NP_355019.1| hypothetical protein Atu2052 [Agrobacterium tumefaciens str. C58] Length = 1234 Back     alignment and organism information
>gi|325293421|ref|YP_004279285.1| hypothetical protein AGROH133_07317 [Agrobacterium sp. H13-3] Length = 1243 Back     alignment and organism information
>gi|241205510|ref|YP_002976606.1| hypothetical protein Rleg_2806 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 1238 Back     alignment and organism information
>gi|116253003|ref|YP_768841.1| hypothetical protein RL3260 [Rhizobium leguminosarum bv. viciae 3841] Length = 1238 Back     alignment and organism information
>gi|150397231|ref|YP_001327698.1| hypothetical protein Smed_2030 [Sinorhizobium medicae WSM419] Length = 1246 Back     alignment and organism information
>gi|190892532|ref|YP_001979074.1| hypothetical protein RHECIAT_CH0002947 [Rhizobium etli CIAT 652] Length = 1234 Back     alignment and organism information
>gi|222086401|ref|YP_002544935.1| hypothetical protein Arad_2939 [Agrobacterium radiobacter K84] Length = 1234 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target380 hypothetical protein CLIBASIA_04265 [Candidatus Liberib
COG2982 648 COG2982, AsmA, Uncharacterized protein involved in oute 9e-10
pfam05170 537 pfam05170, AsmA, AsmA family 2e-11
>gnl|CDD|32801 COG2982, AsmA, Uncharacterized protein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|147383 pfam05170, AsmA, AsmA family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 380 hypothetical protein CLIBASIA_04265 [Candidatus Liberib
PRK10833 617 putative assembly protein; Provisional 100.0
pfam05170 537 AsmA AsmA family. The AsmA gene, whose product is invol 100.0
COG2982 648 AsmA Uncharacterized protein involved in outer membrane 100.0
TIGR02099 1362 TIGR02099 conserved hypothetical protein TIGR02099; Int 99.81
COG3164 1271 Predicted membrane protein [Function unknown] 99.54
COG2911 1278 Uncharacterized protein conserved in bacteria [Function 97.65
TIGR03545 554 conserved hypothetical protein TIGR03545. This model re 99.26
PRK10695 876 hypothetical protein; Provisional 95.76
pfam01203251 GSPII_N Bacterial type II secretion system protein N. 94.88
COG4093338 Uncharacterized protein conserved in bacteria [Function 94.33
pfam05359150 DUF748 Domain of Unknown Function (DUF748). 97.39
pfam08118503 MDM31_MDM32 Yeast mitochondrial distribution and morpho 96.78
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phosphona 92.98
>PRK10833 putative assembly protein; Provisional Back     alignment and domain information
>pfam05170 AsmA AsmA family Back     alignment and domain information
>COG2982 AsmA Uncharacterized protein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02099 TIGR02099 conserved hypothetical protein TIGR02099; InterPro: IPR011836 This entry describes a family of long proteins, over 1250 amino acids in length and present in the Proteobacteria Back     alignment and domain information
>COG3164 Predicted membrane protein [Function unknown] Back     alignment and domain information
>COG2911 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03545 conserved hypothetical protein TIGR03545 Back     alignment and domain information
>PRK10695 hypothetical protein; Provisional Back     alignment and domain information
>pfam01203 GSPII_N Bacterial type II secretion system protein N Back     alignment and domain information
>COG4093 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam05359 DUF748 Domain of Unknown Function (DUF748) Back     alignment and domain information
>pfam08118 MDM31_MDM32 Yeast mitochondrial distribution and morphology (MDM) proteins Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00