254780956

254780956

thymidylate synthase

GeneID in NCBI database:8209978Locus tag:CLIBASIA_04275
Protein GI in NCBI database:254780956Protein Accession:YP_003065369.1
Gene range:+(952937, 953731)Protein Length:264aa
Gene description:thymidylate synthase
COG prediction:[F] Thymidylate synthase
KEGG prediction:thyA; thymidylate synthase (EC:2.1.1.45); K00560 thymidylate synthase [EC:2.1.1.45]
SEED prediction:Thymidylate synthase (EC 2.1.1.45)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
One carbon pool by folate [PATH:las00670]
Subsystem involved in SEED:pyrimidine conversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV
cHHHHHHHHHHHHccccccccccccEEEEEccEEEEEcccccEEEEcccHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHccccccEEEEEEEcHHHHccccccccEEEEEEEEEccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEcHHHHHHHHHHccccccccEEEEccccccccccccccEEEEcccccccccccccc
cHHHHHHHHHHHHHcEEEEcccccEEEEEEEEEEEEEHHHccccccccccccHHHHHHHHHHHHcccEcHHHHHccccccHHHcccccEccccHHHHHHHEEcccccEEcHHHHHHHHHHHcccccccEEEcccHHHHHHccccccEEEEEEEEEccEEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEEEEHHHHHHHHHHHccccccccEEEEccccccHHHccHHHEEEEcccccccccccccc
MHQYLDLLRHVIKfgsdrrdrtgvgtrstfgyqmrfdlskgfpllttkkvHWKSVVHELLWFLrgdsnvsylhrhgvsiwdewadkdgelgpiygvqwrswpdydgnvIDQISSIVQSlradpysrrHIVSAWNVALidkmalppchclfqfyvdngkLSCQLYQrsgdvflgipfNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQadlqlsrsprtlpqmiinpnIVDLLSfryedftlrsyePHAAILAKVSV
MHQYLDLLRHVikfgsdrrdrtgvgtrstfgyqmrfDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV
MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV
MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV
MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV
MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKV**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV
MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV
MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target264 thymidylate synthase [Candidatus Liberibacter asiaticus
315122502264 thymidylate synthase [Candidatus Liberibacter solanacea 1 1e-138
150397222264 thymidylate synthase [Sinorhizobium medicae WSM419] Len 1 1e-112
15965880264 thymidylate synthase [Sinorhizobium meliloti 1021] Leng 1 1e-112
325293415264 Thymidylate synthase [Agrobacterium sp. H13-3] Length = 1 1e-112
159185026264 thymidylate synthase [Agrobacterium tumefaciens str. C5 1 1e-111
255066674264 thymidylate synthase [Neisseria sicca ATCC 29256] Lengt 1 1e-111
325205579264 thymidylate synthase [Neisseria meningitidis M04-240196 1 1e-110
254805456264 Thymidylate synthase [Neisseria meningitidis alpha14] L 1 1e-110
313575265264 hypothetical protein [uncultured bacterium] Length = 26 1 1e-110
329119726264 thymidylate synthase [Neisseria bacilliformis ATCC BAA- 1 1e-109
>gi|315122502|ref|YP_004062991.1| thymidylate synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 264 Back     alignment and organism information
 Score =  495 bits (1274), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 234/264 (88%), Positives = 249/264 (94%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+LLRHVI  GSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVH KSV++ELL
Sbjct: 1   MRQYLNLLRHVITSGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHLKSVIYELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+G SN+SYLH+HGVSIWDEWA KDG+LGPIYGVQWRSWPDYDGN IDQISSI++SLR
Sbjct: 61  WFLKGGSNISYLHQHGVSIWDEWASKDGDLGPIYGVQWRSWPDYDGNTIDQISSIIRSLR 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVD+GKLSCQLYQRSGDVFLGIPFNIAS
Sbjct: 121 TDPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDDGKLSCQLYQRSGDVFLGIPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           YSLLTMMLASVIGF+YGEFIHTLGDVHLYNNHFEQA LQLSRSP+  P MIINPN+VDL 
Sbjct: 181 YSLLTMMLASVIGFRYGEFIHTLGDVHLYNNHFEQAHLQLSRSPKKTPHMIINPNVVDLF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
           SF+YEDFTL SYEPHAAI AKV+V
Sbjct: 241 SFQYEDFTLESYEPHAAIPAKVTV 264


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397222|ref|YP_001327689.1| thymidylate synthase [Sinorhizobium medicae WSM419] Length = 264 Back     alignment and organism information
>gi|15965880|ref|NP_386233.1| thymidylate synthase [Sinorhizobium meliloti 1021] Length = 264 Back     alignment and organism information
>gi|325293415|ref|YP_004279279.1| Thymidylate synthase [Agrobacterium sp. H13-3] Length = 264 Back     alignment and organism information
>gi|159185026|ref|NP_355015.2| thymidylate synthase [Agrobacterium tumefaciens str. C58] Length = 264 Back     alignment and organism information
>gi|255066674|ref|ZP_05318529.1| thymidylate synthase [Neisseria sicca ATCC 29256] Length = 264 Back     alignment and organism information
>gi|325205579|gb|ADZ01032.1| thymidylate synthase [Neisseria meningitidis M04-240196] Length = 264 Back     alignment and organism information
>gi|254805456|ref|YP_003083677.1| Thymidylate synthase [Neisseria meningitidis alpha14] Length = 264 Back     alignment and organism information
>gi|313575265|emb|CBI71203.1| hypothetical protein [uncultured bacterium] Length = 264 Back     alignment and organism information
>gi|329119726|ref|ZP_08248406.1| thymidylate synthase [Neisseria bacilliformis ATCC BAA-1200] Length = 264 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target264 thymidylate synthase [Candidatus Liberibacter asiaticus
PRK01827264 PRK01827, thyA, thymidylate synthase; Reviewed 1e-143
TIGR03284296 TIGR03284, thym_sym, thymidylate synthase 1e-127
COG0207268 COG0207, ThyA, Thymidylate synthase [Nucleotide transpo 1e-109
PTZ00164514 PTZ00164, PTZ00164, bifunctional dihydrofolate reductas 1e-105
KOG0673293 KOG0673, KOG0673, KOG0673, Thymidylate synthase [Nucleo 1e-91
PRK13821323 PRK13821, thyA, thymidylate synthase; Provisional 1e-55
pfam00303262 pfam00303, Thymidylat_synt, Thymidylate synthase 1e-119
cd00351215 cd00351, TS_Pyrimidine_HMase, Thymidylate synthase and 1e-84
PRK00956208 PRK00956, thyA, thymidylate synthase; Provisional 4e-09
TIGR03283199 TIGR03283, thy_syn_methano, thymidylate synthase, metha 1e-07
>gnl|CDD|179340 PRK01827, thyA, thymidylate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|132327 TIGR03284, thym_sym, thymidylate synthase Back     alignment and domain information
>gnl|CDD|30556 COG0207, ThyA, Thymidylate synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|185491 PTZ00164, PTZ00164, bifunctional dihydrofolate reductase-thymidylate synthase; Provisional Back     alignment and domain information
>gnl|CDD|35892 KOG0673, KOG0673, KOG0673, Thymidylate synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|184347 PRK13821, thyA, thymidylate synthase; Provisional Back     alignment and domain information
>gnl|CDD|144042 pfam00303, Thymidylat_synt, Thymidylate synthase Back     alignment and domain information
>gnl|CDD|58645 cd00351, TS_Pyrimidine_HMase, Thymidylate synthase and pyrimidine hydroxymethylase: Thymidylate synthase (TS) and deoxycytidylate hydroxymethylase (dCMP-HMase) are homologs that catalyze analogous alkylation of C5 of pyrimidine nucleotides Back     alignment and domain information
>gnl|CDD|179181 PRK00956, thyA, thymidylate synthase; Provisional Back     alignment and domain information
>gnl|CDD|132326 TIGR03283, thy_syn_methano, thymidylate synthase, methanogen type Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 264 thymidylate synthase [Candidatus Liberibacter asiaticus
PTZ00164512 bifunctional dihydrofolate reductase-thymidylate syntha 100.0
TIGR03284296 thym_sym thymidylate synthase. Members of this protein 100.0
PRK01827264 thyA thymidylate synthase; Reviewed 100.0
PRK13821323 thyA thymidylate synthase; Provisional 100.0
KOG0673293 consensus 100.0
pfam00303262 Thymidylat_synt Thymidylate synthase. 100.0
COG0207268 ThyA Thymidylate synthase [Nucleotide transport and met 100.0
cd00351215 TS_Pyrimidine_HMase Thymidylate synthase and pyrimidine 100.0
PRK00956208 thyA thymidylate synthase; Provisional 100.0
TIGR03283199 thy_syn_methano thymidylate synthase, methanogen type. 100.0
>PTZ00164 bifunctional dihydrofolate reductase-thymidylate synthase; Provisional Back     alignment and domain information
>TIGR03284 thym_sym thymidylate synthase Back     alignment and domain information
>PRK01827 thyA thymidylate synthase; Reviewed Back     alignment and domain information
>PRK13821 thyA thymidylate synthase; Provisional Back     alignment and domain information
>KOG0673 consensus Back     alignment and domain information
>pfam00303 Thymidylat_synt Thymidylate synthase Back     alignment and domain information
>COG0207 ThyA Thymidylate synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00351 TS_Pyrimidine_HMase Thymidylate synthase and pyrimidine hydroxymethylase: Thymidylate synthase (TS) and deoxycytidylate hydroxymethylase (dCMP-HMase) are homologs that catalyze analogous alkylation of C5 of pyrimidine nucleotides Back     alignment and domain information
>PRK00956 thyA thymidylate synthase; Provisional Back     alignment and domain information
>TIGR03283 thy_syn_methano thymidylate synthase, methanogen type Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target264 thymidylate synthase [Candidatus Liberibacter asiaticus
1tlc_A265 Thymidylate Synthase Complexed With Dgmp And Folate 8e-89
2bbq_A264 Structural Basis For Recognition Of Polyglutamyl Fo 8e-89
2tsc_A264 Structure, Multiple Site Binding, And Segmental Acc 2e-88
1tys_A265 Water-Mediated Substrate(Slash)product Discriminati 3e-88
1kce_A264 E. Coli Thymidylate Synthase Mutant E58q In Complex 7e-88
2vet_A264 Crystal Structure Of The Thymidylate Synthase K48q 1e-87
1kzj_A264 Crystal Structure Of Ects W80gDUMPCB3717 COMPLEX Le 1e-87
2ftn_A264 E. Coli Thymidylate Synthase Y94f Mutant Length = 2 1e-87
1aiq_A264 Crystal Structure Of Thymidylate Synthase R126e Mut 1e-87
1f4g_A264 Crystal Structure Of E. Coli Thymidylate Synthase C 2e-87
1dna_A264 D221(169)n Mutant Does Not Promote Opening Of The C 2e-87
1ffl_A264 Crystal Structure Of The Apo-Thymidylate Synthase R 2e-87
1zpr_A264 E. Coli Thymidylate Synthase Mutant E58q In Complex 2e-87
1ev5_A264 Crystal Structure Analysis Of Ala167 Mutant Of Esch 2e-87
1bq1_A264 E. Coli Thymidylate Synthase Mutant N177a In Comple 3e-87
1evg_A264 Crystal Structure Analysis Of Cys167 Mutant Of Esch 3e-87
2g8m_A264 Escherichia Coli Thymidylate Synthase Y209w In Comp 3e-87
3bgx_A264 E. Coli Thymidylate Synthase C146s Mutant Complexed 3e-87
3bfi_A264 E. Coli Thymidylate Synthase Y209m Mutant Complexed 5e-87
2vf0_A264 Crystal Structure Of The Thymidylate Synthase K48q 9e-87
1nce_A264 Crystal Structure Of A Ternary Complex Of E. Coli T 1e-86
1f4d_A264 Crystal Structure Of E. Coli Thymidylate Synthase C 1e-86
1jg0_A264 Crystal Structure Of Escherichia Coli Thymidylate S 1e-86
3ix6_A360 Crystal Structure Of Thymidylate Synthase Thya From 2e-86
1ev8_A264 Crystal Structure Analysis Of Cys167 Mutant Of Esch 3e-86
1evf_A264 Crystal Structure Analysis Of Cys167 Mutant Of Esch 8e-86
1qqq_A264 Crystal Structure Analysis Of Ser254 Mutant Of Esch 1e-85
2rd8_A313 Human Thymidylate Synthase Stabilized In Active Con 2e-80
1hw4_A355 Structure Of Thymidylate Synthase Suggests Advantag 2e-80
1ju6_A313 Human Thymidylate Synthase Complex With Dump And Ly 2e-80
3ihh_A307 Crystal Structure Of Mouse Thymidylate Synthase In 2e-80
3ef9_A313 Replacement Of Val3 In Human Thymidylate Synthase A 2e-80
3edw_X313 Replacement Of Val3 In Human Thymidylate Synthase A 3e-80
3gg5_A313 Replacement Of Val3 In Human Thymidylate Synthase A 4e-80
3gh2_X313 Replacement Of Val3 In Human Thymidylate Synthase A 6e-80
3eaw_X313 Replacement Of Val3 In Human Thymidylate Synthase A 6e-80
3ehi_X313 Crystal Structure Of Human Thymidyalte Synthase M19 7e-80
1hzw_A290 Crystal Structure Of Human Thymidylate Synthase Len 1e-79
1hvy_A288 Human Thymidylate Synthase Complexed With Dump And 2e-79
1rts_A307 Thymidylate Synthase From Rat In Ternary Complex Wi 2e-79
2rd8_B313 Human Thymidylate Synthase Stabilized In Active Con 3e-79
3ed7_A295 Replacement Of Val3 In Human Thymidylate Synthase A 3e-79
3ebu_A313 Replacement Of Val3 In Human Thymidylate Synthase A 5e-79
1hw3_A313 Structure Of Human Thymidylate Synthase Suggests Ad 9e-79
3egy_X313 Crystal Structure Of Human Thymidyalte Synthase A19 3e-78
3hj3_A521 Crystal Structure Of The Chts-Dhfr F207a Non-Active 1e-74
3dl6_A521 Crystal Structure Of The A287fS290G ACTIVE SITE MUT 1e-74
3dl5_A521 Crystal Structure Of The A287f Active Site Mutant O 1e-74
2oip_A519 Crystal Structure Of The S290g Active Site Mutant O 2e-74
1qzf_A521 Crystal Structure Of Dhfr-Ts From Cryptosporidium H 2e-74
1lca_A316 Lactobacillus Casei Thymidylate Synthase Ternary Co 3e-73
1bo8_A316 Thymidylate Synthase R178t Mutant Length = 316 3e-73
1njc_A316 Thymidylate Synthase, Mutation, N229d With 2'-Deoxy 4e-73
1vzb_A316 L. Casei Thymidylate Synthase Mutant E60q Binary Co 5e-73
1nja_A316 Thymidylate Synthase, Mutation, N229c With 2'-Deoxy 5e-73
2g86_A316 L. Casei Thymidylate Synthase Y261f In Complex With 5e-73
1jmi_A316 Contributions Of Orientation And Hydrogen Bonding T 6e-73
1tsv_A316 Thymidylate Synthase R179a Mutant Length = 316 7e-73
1tsy_A316 Thymidylate Synthase R179k Mutant Length = 316 7e-73
1bo7_A316 Thymidylate Synthase R179t Mutant Length = 316 8e-73
1bpj_A316 Thymidylate Synthase R178t, R179t Double Mutant Len 1e-72
1tsx_A316 Thymidylate Synthase R179e Mutant Length = 316 1e-72
1jmg_A316 Contributions Of Orientation And Hydrogen Bonding T 1e-72
2g89_A316 L. Casei Thymidylate Synthase Y261a In Complex With 1e-72
1jmf_A316 Contributions Of Orientation And Hydrogen Bonding T 1e-72
2g8d_A316 Lactobacillus Casei Thymidylate Synthase Y261w-Dump 1e-72
1vza_A316 Thymidylate Synthase E60d Mutant Binary Complex Wit 2e-72
2g8a_A316 Lactobacillus Casei Y261m In Complex With Substrate 2e-72
1tda_A315 Structures Of Thymidylate Synthase With A C-Termina 2e-72
1jmh_A316 Contributions Of Orientation And Hydrogen Bonding T 2e-72
1bp0_A316 Thymidylate Synthase R23i Mutant Length = 316 1e-71
1bp6_A316 Thymidylate Synthase R23i, R179t Double Mutant Leng 4e-71
2h2q_A521 Crystal Structure Of Trypanosoma Cruzi Dihydrofolat 6e-70
3inv_A521 Trypanosoma Cruzi Dihydrofolate Reductase-Thymidyla 6e-70
3nrr_A515 Co-Crystal Structure Of Dihydrofolate Reductase-Thy 1e-69
3i3r_A511 X-Ray Structure Dihydrofolate ReductaseTHYMIDYLATE 2e-69
3kgb_A294 Crystal Structure Of Thymidylate Synthase 12 FROM E 5e-68
1ci7_A297 Ternary Complex Of Thymidylate Synthase From Pneumo 2e-66
3jsu_A608 Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium 1e-64
1j3i_C328 Wild-Type Plasmodium Falciparum Dihydrofolate Reduc 4e-64
2aaz_B317 Cryptococcus Neoformans Thymidylate Synthase Comple 1e-63
1tis_A286 Crystal Structure Of Thymidylate Synthase From T4 P 1e-62
1bko_A278 Thermostable Thymidylate Synthase A From Bacillus S 8e-57
1b02_A279 Crystal Structure Of Thymidylate Synthase A From Ba 1e-56
1b5d_A246 Dcmp Hydroxymethylase From T4 (Intact) Length = 246 3e-14
>gi|1065359|pdb|1TLC|A Chain A, Thymidylate Synthase Complexed With Dgmp And Folate Analog 1843u89 Length = 265 Back     alignment and structure
 Score =  331 bits (848), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 153/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 2   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 61

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 62  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 121

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 122 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 181

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 182 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 241

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 242 DYRFEDFEIEGYDPHPGIKAPVAI 265


gi|494741|pdb|2BBQ|A Chain A, Structural Basis For Recognition Of Polyglutamyl Folates By Thymidylate Synthase Length = 264 Back     alignment and structure
>gi|230780|pdb|2TSC|A Chain A, Structure, Multiple Site Binding, And Segmental Accomodation In Thymidylate Synthase On Binding DUMP AND An Anti-Folate Length = 264 Back     alignment and structure
>gi|2098345|pdb|1KCE|A Chain A, E. Coli Thymidylate Synthase Mutant E58q In Complex With Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump) Length = 264 Back     alignment and structure
>gi|161761105|pdb|2VET|A Chain A, Crystal Structure Of The Thymidylate Synthase K48q Complexed With Dump Length = 264 Back     alignment and structure
>gi|21730590|pdb|1KZJ|A Chain A, Crystal Structure Of Ects W80gDUMPCB3717 COMPLEX Length = 264 Back     alignment and structure
>gi|99032324|pdb|2FTN|A Chain A, E. Coli Thymidylate Synthase Y94f Mutant Length = 264 Back     alignment and structure
>gi|2624566|pdb|1AIQ|A Chain A, Crystal Structure Of Thymidylate Synthase R126e Mutant Length = 264 Back     alignment and structure
>gi|9257019|pdb|1F4G|A Chain A, Crystal Structure Of E. Coli Thymidylate Synthase Complexed With Sp-876 Length = 264 Back     alignment and structure
>gi|4140014|pdb|1DNA|A Chain A, D221(169)n Mutant Does Not Promote Opening Of The Cofactor Imidazolidine Ring Length = 264 Back     alignment and structure
>gi|9955004|pdb|1FFL|A Chain A, Crystal Structure Of The Apo-Thymidylate Synthase R166q Mutant Length = 264 Back     alignment and structure
>gi|2392650|pdb|1ZPR|A Chain A, E. Coli Thymidylate Synthase Mutant E58q In Complex With Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump) Length = 264 Back     alignment and structure
>gi|7766859|pdb|1EV5|A Chain A, Crystal Structure Analysis Of Ala167 Mutant Of Escherichia Coli Length = 264 Back     alignment and structure
>gi|5107510|pdb|1BQ1|A Chain A, E. Coli Thymidylate Synthase Mutant N177a In Complex With Cb3717 And 2'-Deoxyuridine 5'-Monophosphate (Dump) Length = 264 Back     alignment and structure
>gi|7766862|pdb|1EVG|A Chain A, Crystal Structure Analysis Of Cys167 Mutant Of Escherichia Coli With Unmodified Catalytic Cysteine Length = 264 Back     alignment and structure
>gi|93279927|pdb|2G8M|A Chain A, Escherichia Coli Thymidylate Synthase Y209w In Complex With Substrate, Dump, And A Cofactor Analog, Cb3717 Length = 264 Back     alignment and structure
>gi|217035336|pdb|3BGX|A Chain A, E. Coli Thymidylate Synthase C146s Mutant Complexed With Dtmp And Mtf Length = 264 Back     alignment and structure
>gi|215794567|pdb|3BFI|A Chain A, E. Coli Thymidylate Synthase Y209m Mutant Complexed With 5- Nitro-Dump Length = 264 Back     alignment and structure
>gi|161761106|pdb|2VF0|A Chain A, Crystal Structure Of The Thymidylate Synthase K48q Complexed With 5no2dump And Bw1843u89 Length = 264 Back     alignment and structure
>gi|27574165|pdb|1NCE|A Chain A, Crystal Structure Of A Ternary Complex Of E. Coli Thymidylate Synthase D169c With Dump And The Antifolate Cb3717 Length = 264 Back     alignment and structure
>gi|9257014|pdb|1F4D|A Chain A, Crystal Structure Of E. Coli Thymidylate Synthase C146s, L143c Covalently Modified At C143 With N-[tosyl-D- Prolinyl]amino-Ethanethiol Length = 264 Back     alignment and structure
>gi|20150422|pdb|1JG0|A Chain A, Crystal Structure Of Escherichia Coli Thymidylate Synthase Complexed With 2'-Deoxyuridine-5'-Monophosphate And N,O- Didansyl-L-Tyrosine Length = 264 Back     alignment and structure
>gi|259090368|pdb|3IX6|A Chain A, Crystal Structure Of Thymidylate Synthase Thya From Brucella Melitensis Length = 360 Back     alignment and structure
>gi|7766860|pdb|1EV8|A Chain A, Crystal Structure Analysis Of Cys167 Mutant Of Escherichia Coli Length = 264 Back     alignment and structure
>gi|7766861|pdb|1EVF|A Chain A, Crystal Structure Analysis Of Cys167 Mutant Of Escherichia Coli Length = 264 Back     alignment and structure
>gi|5542439|pdb|1QQQ|A Chain A, Crystal Structure Analysis Of Ser254 Mutant Of Escherichia Coli Thymidylate Synthase Length = 264 Back     alignment and structure
>gi|189095969|pdb|2RD8|A Chain A, Human Thymidylate Synthase Stabilized In Active Conformation By R163k Mutation: Asymmetry And Reactivity Of Cys195 Length = 313 Back     alignment and structure
>gi|13096425|pdb|1HW4|A Chain A, Structure Of Thymidylate Synthase Suggests Advantages Of Chemotherapy With Noncompetitive Inhibitors Length = 355 Back     alignment and structure
>gi|15988336|pdb|1JU6|A Chain A, Human Thymidylate Synthase Complex With Dump And Ly231514, A Pyrrolo(2,3-D)pyrimidine-Based Antifolate Length = 313 Back     alignment and structure
gi|285803264|pdb|3IHH|A Chain A, Crystal Structure Of Mouse Thymidylate Synthase In Complex With Dump Length = 307 Back     alignment and structure
>gi|290560090|pdb|3EF9|A Chain A, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313 Back     alignment and structure
>gi|290560086|pdb|3EDW|X Chain X, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313 Back     alignment and structure
>gi|290560115|pdb|3GG5|A Chain A, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313 Back     alignment and structure
>gi|290560120|pdb|3GH2|X Chain X, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313 Back     alignment and structure
>gi|290560083|pdb|3EAW|X Chain X, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313 Back     alignment and structure
>gi|256032572|pdb|3EHI|X Chain X, Crystal Structure Of Human Thymidyalte Synthase M190k With Loop 181-197 Stabilized In The Inactive Conformation Length = 313 Back     alignment and structure
>gi|14277914|pdb|1HZW|A Chain A, Crystal Structure Of Human Thymidylate Synthase Length = 290 Back     alignment and structure
>gi|13096294|pdb|1HVY|A Chain A, Human Thymidylate Synthase Complexed With Dump And Raltitrexed, An Antifolate Drug, Is In The Closed Conformation Length = 288 Back     alignment and structure
gi|4558189|pdb|1RTS|A Chain A, Thymidylate Synthase From Rat In Ternary Complex With Dump And Tomudex Length = 307 Back     alignment and structure
>gi|189095970|pdb|2RD8|B Chain B, Human Thymidylate Synthase Stabilized In Active Conformation By R163k Mutation: Asymmetry And Reactivity Of Cys195 Length = 313 Back     alignment and structure
>gi|290560085|pdb|3ED7|A Chain A, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 295 Back     alignment and structure
>gi|290560084|pdb|3EBU|A Chain A, Replacement Of Val3 In Human Thymidylate Synthase Affects Its Kinetic Properties And Intracellular Stability Length = 313 Back     alignment and structure
>gi|13096424|pdb|1HW3|A Chain A, Structure Of Human Thymidylate Synthase Suggests Advantages Of Chemotherapy With Noncompetitive Inhibitors Length = 313 Back     alignment and structure
>gi|256032568|pdb|3EGY|X Chain X, Crystal Structure Of Human Thymidyalte Synthase A191k With Loop 181-197 Stabilized In The Inactive Conformation Length = 313 Back     alignment and structure
>gi|297342898|pdb|3HJ3|A Chain A, Crystal Structure Of The Chts-Dhfr F207a Non-Active Site Mut Length = 521 Back     alignment and structure
>gi|197107405|pdb|3DL6|A Chain A, Crystal Structure Of The A287fS290G ACTIVE SITE MUTANT OF Ts-Dhfr From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>gi|197107400|pdb|3DL5|A Chain A, Crystal Structure Of The A287f Active Site Mutant Of Ts- Dhfr From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>gi|152149198|pdb|2OIP|A Chain A, Crystal Structure Of The S290g Active Site Mutant Of Ts- Dhfr From Cryptosporidium Hominis Length = 519 Back     alignment and structure
gi|39654756|pdb|1QZF|A Chain A, Crystal Structure Of Dhfr-Ts From Cryptosporidium Hominis Length = 521 Back     alignment and structure
gi|157831773|pdb|1LCA|A Chain A, Lactobacillus Casei Thymidylate Synthase Ternary Complex With Dump And Cb3717 Length = 316 Back     alignment and structure
>gi|6729993|pdb|1BO8|A Chain A, Thymidylate Synthase R178t Mutant Length = 316 Back     alignment and structure
>gi|157832139|pdb|1NJC|A Chain A, Thymidylate Synthase, Mutation, N229d With 2'-Deoxycytidine 5'-Monophosphate (Dcmp) Length = 316 Back     alignment and structure
>gi|157834186|pdb|1VZB|A Chain A, L. Casei Thymidylate Synthase Mutant E60q Binary Complex With Dump Length = 316 Back     alignment and structure
>gi|157832137|pdb|1NJA|A Chain A, Thymidylate Synthase, Mutation, N229c With 2'-Deoxycytidine 5'-Monophosphate (Dcmp) Length = 316 Back     alignment and structure
>gi|93279921|pdb|2G86|A Chain A, L. Casei Thymidylate Synthase Y261f In Complex With Substrate, Dump Length = 316 Back     alignment and structure
>gi|157831561|pdb|1JMI|A Chain A, Contributions Of Orientation And Hydrogen Bonding To Catalysis In Asn-229 Mutants Of Thymidylate Synthase Length = 316 Back     alignment and structure
>gi|157834021|pdb|1TSV|A Chain A, Thymidylate Synthase R179a Mutant Length = 316 Back     alignment and structure
>gi|157834024|pdb|1TSY|A Chain A, Thymidylate Synthase R179k Mutant Length = 316 Back     alignment and structure
>gi|6729992|pdb|1BO7|A Chain A, Thymidylate Synthase R179t Mutant Length = 316 Back     alignment and structure
>gi|6729893|pdb|1BPJ|A Chain A, Thymidylate Synthase R178t, R179t Double Mutant Length = 316 Back     alignment and structure
>gi|157834023|pdb|1TSX|A Chain A, Thymidylate Synthase R179e Mutant Length = 316 Back     alignment and structure
>gi|157831559|pdb|1JMG|A Chain A, Contributions Of Orientation And Hydrogen Bonding To Catalysis In Asn-229 Mutants Of Thymidylate Synthase Length = 316 Back     alignment and structure
>gi|93279922|pdb|2G89|A Chain A, L. Casei Thymidylate Synthase Y261a In Complex With Substrate, Dump Length = 316 Back     alignment and structure
>gi|157831558|pdb|1JMF|A Chain A, Contributions Of Orientation And Hydrogen Bonding To Catalysis In Asn-229 Mutants Of Thymidylate Synthase Length = 316 Back     alignment and structure
>gi|93279924|pdb|2G8D|A Chain A, Lactobacillus Casei Thymidylate Synthase Y261w-Dump Complex Length = 316 Back     alignment and structure
>gi|157834185|pdb|1VZA|A Chain A, Thymidylate Synthase E60d Mutant Binary Complex With 2'- Deoxyuridine 5'-Monophosphate (Dump) Length = 316 Back     alignment and structure
>gi|93279923|pdb|2G8A|A Chain A, Lactobacillus Casei Y261m In Complex With Substrate, Dump Length = 316 Back     alignment and structure
>gi|157833915|pdb|1TDA|A Chain A, Structures Of Thymidylate Synthase With A C-Terminal Deletion: Role Of The C-Terminus In Alignment Of DUMP AND Ch2h4folate Length = 315 Back     alignment and structure
>gi|157831560|pdb|1JMH|A Chain A, Contributions Of Orientation And Hydrogen Bonding To Catalysis In Asn-229 Mutants Of Thymidylate Synthase Length = 316 Back     alignment and structure
>gi|6980894|pdb|1BP0|A Chain A, Thymidylate Synthase R23i Mutant Length = 316 Back     alignment and structure
>gi|6729892|pdb|1BP6|A Chain A, Thymidylate Synthase R23i, R179t Double Mutant Length = 316 Back     alignment and structure
>gi|178847032|pdb|2H2Q|A Chain A, Crystal Structure Of Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate Synthase Length = 521 Back     alignment and structure
gi|301598498|pdb|3INV|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate Synthase Complexed With Nadph, Dump And C-448 Antifolate Length = 521 Back     alignment and structure
>gi|300508797|pdb|3NRR|A Chain A, Co-Crystal Structure Of Dihydrofolate Reductase-Thymidylate Synthase From Babesia Bovis With Dump, Raltitrexed And Nadp Length = 515 Back     alignment and structure
gi|256032857|pdb|3I3R|A Chain A, X-Ray Structure Dihydrofolate ReductaseTHYMIDYLATE SYNTHASE From Babesia Bovis At 2.35a Resolution Length = 511 Back     alignment and structure
gi|266618852|pdb|3KGB|A Chain A, Crystal Structure Of Thymidylate Synthase 12 FROM Encephalitozoon Cuniculi At 2.2 A Resolution Length = 294 Back     alignment and structure
gi|7767148|pdb|1CI7|A Chain A, Ternary Complex Of Thymidylate Synthase From Pneumocystis Carinii Length = 297 Back     alignment and structure
>gi|301598514|pdb|3JSU|A Chain A, Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium Falciparum Dihydrofolate Reductase-Thymidylate Synthase(Pfdhfr-Ts) Complexed With Qn254, Nadph, And Dump Length = 608 Back     alignment and structure
>gi|30749344|pdb|1J3I|C Chain C, Wild-Type Plasmodium Falciparum Dihydrofolate Reductase- Thymidylate Synthase (Pfdhfr-Ts) Complexed With Wr99210, Nadph, And Dump Length = 328 Back     alignment and structure
gi|157833959|pdb|1TIS|A Chain A, Crystal Structure Of Thymidylate Synthase From T4 Phage Length = 286 Back     alignment and structure
>gi|4388862|pdb|1BKO|A Chain A, Thermostable Thymidylate Synthase A From Bacillus Subtilis Length = 278 Back     alignment and structure
gi|4699624|pdb|1B02|A Chain A, Crystal Structure Of Thymidylate Synthase A From Bacillus Subtilis Length = 279 Back     alignment and structure
gi|4389322|pdb|1B5D|A Chain A, Dcmp Hydroxymethylase From T4 (Intact) Length = 246 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target264 thymidylate synthase [Candidatus Liberibacter asiaticus
3jsu_A608 Dihydrofolate reductase-thymidylate synthase; rossmann 1e-114
1f28_A297 Thymidylate synthase; beta-sheet, protein-inhibitor com 1e-107
3hj3_A521 Chain A, crystal structure of DHFR; TS, enzyme, crossov 1e-105
3irm_A521 Bifunctional dihydrofolate reductase-thymidylate; DHFR- 1e-104
3nrr_A515 Dihydrofolate reductase-thymidylate synthase; structura 1e-100
1hw4_A355 TS, thymidylate synthase; methyltransferase; HET: CME; 2e-99
3ihh_A307 Tsase, TS, thymidylate synthase; protein-ligand complex 1e-97
1j3k_C328 Bifunctional dihydrofolate reductase-thymidylate syntha 3e-97
3dl5_A521 Dihydrofolate reductase, DHFR; enzyme active site mutan 3e-96
3ed7_A295 Tsase, TS, thymidylate synthase; transferase, methyltra 8e-96
3ik0_A316 TS, tsase, thymidylate synthase; transferase, nucleotid 9e-95
1jmg_A316 Thymidylate synthase; transferase, methyltransferase; H 2e-94
2h2q_A521 Bifunctional dihydrofolate reductase-thymidylate syntha 6e-93
3ix6_A360 TS, tsase, thymidylate synthase; niaid, ssgcid, seattle 2e-90
3kjr_A511 Dihydrofolate reductase/thymidylate synthase; microflui 3e-89
2g8o_A264 TS, tsase, thymidylate synthase; methyltransferase, DUM 6e-84
2aaz_A317 TS, tsase, thymidylate synthase; methyl transferase, nu 3e-80
3kgb_A294 Thymidylate synthase 1/2; ssgcid, NIH, niaid, SBRI, UW, 1e-74
1tis_A286 Thymidylate synthase; transferase(methyltransferase); 2 4e-68
1bkp_A278 Thymidylate synthase A; methyltransferase, DTMP synthas 7e-64
1b5e_A246 Protein (deoxycytidylate hydroxymethylase); DNTP synthe 5e-61
>3jsu_A Dihydrofolate reductase-thymidylate synthase; rossmann fold, oxidoreductase, transferase; HET: KA5 NDP UMP; 2.70A {Plasmodium falciparum} Length = 608 Back     alignment and structure
 Score =  406 bits (1045), Expect = e-114
 Identities = 124/282 (43%), Positives = 180/282 (63%), Gaps = 20/282 (7%)

Query: 2   HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLW 61
           +QYL+++  ++  G+ + DRTGVG  S FGY M+FDLS+ FPLLTTKK+  + ++ ELLW
Sbjct: 326 YQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLW 385

Query: 62  FLRGDSNVSYLHRHGVSIWDEWAD------------KDGELGPIYGVQWRS--------W 101
           F+RG++N + L    V IW+                +  +LGPIYG QWR         +
Sbjct: 386 FIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMY 445

Query: 102 PDYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSC 161
            +Y+   +DQ+ +I+  ++ DP SRR ++ AWNV  +D+MALPPCH L QFYV +GKLSC
Sbjct: 446 DNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSC 505

Query: 162 QLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLS 221
            +YQRS D+ LG+PFNIASYS+ T M+A V   Q  +FIH LG+ H+YNNH +   +QL+
Sbjct: 506 IMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLN 565

Query: 222 RSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVS 263
           R P   P + +NP+I ++  F   DFT+++Y  H  I   ++
Sbjct: 566 RIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMA 607


>1f28_A Thymidylate synthase; beta-sheet, protein-inhibitor complex, transferase; HET: UMP F89; 1.90A {Pneumocystis carinii} SCOP: d.117.1.1 PDB: 1ci7_A* Length = 297 Back     alignment and structure
>3hj3_A Chain A, crystal structure of DHFR; TS, enzyme, crossover, non-active site, oxidoreductase; HET: UMP CB3 MTX NDP; 2.70A {Cryptosporidium hominis} PDB: 1qzf_A* 1sej_A* 3dl5_A* 3dl6_A* 2oip_A* Length = 521 Back     alignment and structure
>3irm_A Bifunctional dihydrofolate reductase-thymidylate; DHFR-TS antifolate complex, methyltransfe multifunctional enzyme, NADP; HET: 1CY; 2.10A {Trypanosoma cruzi} PDB: 3inv_A* 3irn_A* 3iro_A* 2h2q_A* 3cl9_A* 3clb_A* 3hbb_A* 3kjs_A* Length = 521 Back     alignment and structure
>3nrr_A Dihydrofolate reductase-thymidylate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, niaid, DHFR; HET: NAP D16 UMP; 1.80A {Babesia bovis} PDB: 3kjr_A* 3i3r_A* 3k2h_A* Length = 515 Back     alignment and structure
>1hw4_A TS, thymidylate synthase; methyltransferase; HET: CME; 2.06A {Homo sapiens} SCOP: d.117.1.1 Length = 355 Back     alignment and structure
>3ihh_A Tsase, TS, thymidylate synthase; protein-ligand complex, methyltransferase, nucleotide biosynthesis; HET: UMP; 1.70A {Mus musculus} PDB: 3ihi_A 2tsr_A* 1rts_A* 2rd8_A* 2rda_A 1ypv_A* 1hw3_A* 2onb_A* 1ju6_A* 1juj_A* 3egy_X* 3ehi_X* 1hvy_A* 1hzw_A 1i00_A* Length = 307 Back     alignment and structure
>1j3k_C Bifunctional dihydrofolate reductase-thymidylate synthase; oxidoreductase, transferase; HET: WRA NDP UMP; 2.10A {Plasmodium falciparum} SCOP: d.117.1.1 PDB: 1j3i_C* 1j3j_C* 3dg8_C* 3dga_C* Length = 328 Back     alignment and structure
>3dl5_A Dihydrofolate reductase, DHFR; enzyme active site mutant, enzyme-ligand complex, , oxidoreductase; HET: UMP CB3 DHF NDP; 2.74A {Cryptosporidium hominis} PDB: 3dl6_A* 1qzf_A* 1sej_A* 2oip_A* Length = 521 Back     alignment and structure
>3ed7_A Tsase, TS, thymidylate synthase; transferase, methyltransferase, nucleotide biosynthesis; 1.56A {Homo sapiens} PDB: 3ebu_A* 1hvy_A* 1ypv_A* 1hw3_A* 2onb_A* 3eaw_X* 3gg5_A 3gh0_A 3ef9_A 3edw_X 3ejl_A* 3gh2_X* 2rd8_A* 2rda_A 3h9k_A* 3hb8_A* 1ju6_A* 1juj_A* 3egy_X* 3ehi_X* ... Length = 295 Back     alignment and structure
>3ik0_A TS, tsase, thymidylate synthase; transferase, nucleotide synthase, methyltransferase, nucleot biosynthesis; HET: 7C1 UMP; 2.10A {Lactobacillus casei} PDB: 1lcb_A* 1lce_A* 1lca_A* 1thy_A* 1tsl_A* 1tsm_A* 2tdm_A* 3bnz_A* 3byx_A* 3bz0_A* 3c06_A* 3c0a_A* 1nje_A* 3ijz_A* 3ik1_A* 4tms_A 1tsy_A* 1tsz_A 1tdb_A* 1tda_A* ... Length = 316 Back     alignment and structure
>1jmg_A Thymidylate synthase; transferase, methyltransferase; HET: UMP; 2.20A {Lactobacillus casei} SCOP: d.117.1.1 PDB: 1jmf_A* 1tvu_A* 1nje_A* 1lcb_A* 1lce_A* 1lca_A* 1thy_A* 1tsl_A* 1tsm_A* 2tdm_A* 3bnz_A* 3byx_A* 3bz0_A* 3c06_A* 3c0a_A* 4tms_A 1jmi_A* 1tvw_A* 1njd_A* 1njc_A* ... Length = 316 Back     alignment and structure
>2h2q_A Bifunctional dihydrofolate reductase-thymidylate synthase; bifunctional enzyme in complex with NADP and DUMP, oxidoreductase, transferase; HET: NAP DU; 2.40A {Trypanosoma cruzi} PDB: 3cl9_A* 3clb_A* 3hbb_A* Length = 521 Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious disease, brucellosis, orchitis, epididymitis; 2.20A {Brucella melitensis} Length = 360 Back     alignment and structure
>3kjr_A Dihydrofolate reductase/thymidylate synthase; microfluidics, slipchip,structural genomics, PSI-2, protein structure initiative; HET: NAP NHE; 1.95A {Babesia bovis T2BO} PDB: 3i3r_A* 3k2h_A* Length = 511 Back     alignment and structure
>2g8o_A TS, tsase, thymidylate synthase; methyltransferase, DUMP, antifolate, high-resolution, ternary complex, beta sheet, alpha/beta protein; HET: CXM UMP CB3; 1.30A {Escherichia coli} SCOP: d.117.1.1 PDB: 1aob_A* 1f4c_A* 1f4e_A* 1f4f_A* 1jtq_A* 1jtu_A* 1jut_A* 1kce_A* 1kzi_A* 1tls_A* 1tsn_A* 1f4b_A* 2bbq_A* 2ftq_A* 2a9w_A* 2kce_A* 3b9h_A* 3bhl_A* 3bhr_A* 3tms_A ... Length = 264 Back     alignment and structure
>3kgb_A Thymidylate synthase 1/2; ssgcid, NIH, niaid, SBRI, UW, decode, methyltransferase, nucleotide biosynthesis, transferase; 2.20A {Encephalitozoon cuniculi gb-m1} Length = 294 Back     alignment and structure
>1tis_A Thymidylate synthase; transferase(methyltransferase); 2.70A {Enterobacteria phage T4} SCOP: d.117.1.1 Length = 286 Back     alignment and structure
>1bkp_A Thymidylate synthase A; methyltransferase, DTMP synthase; 1.70A {Bacillus subtilis} SCOP: d.117.1.1 PDB: 1bko_A 1bsf_A 1bsp_A 1b02_A* Length = 278 Back     alignment and structure
>1b5e_A Protein (deoxycytidylate hydroxymethylase); DNTP synthesizing complex; HET: DCM; 1.60A {Bacteriophage T4} SCOP: d.117.1.1 PDB: 1b49_A* 1b5d_A* Length = 246 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target264 thymidylate synthase [Candidatus Liberibacter asiaticus
3jsu_A608 Dihydrofolate reductase-thymidylate synthase; rossmann 100.0
3hj3_A521 Chain A, crystal structure of DHFR; TS, enzyme, crossov 100.0
1f28_A297 Thymidylate synthase; beta-sheet, protein-inhibitor com 100.0
1hw4_A355 TS, thymidylate synthase; methyltransferase; HET: CME; 100.0
3ix6_A360 TS, tsase, thymidylate synthase; niaid, ssgcid, seattle 100.0
1j3k_C328 Bifunctional dihydrofolate reductase-thymidylate syntha 100.0
2g8o_A264 TS, tsase, thymidylate synthase; methyltransferase, DUM 100.0
3ik0_A316 TS, tsase, thymidylate synthase; transferase, nucleotid 100.0
2aaz_A317 TS, tsase, thymidylate synthase; methyl transferase, nu 100.0
3nrr_A515 Dihydrofolate reductase-thymidylate synthase; structura 100.0
3kgb_A294 Thymidylate synthase 1/2; ssgcid, NIH, niaid, SBRI, UW, 100.0
3ed7_A295 Tsase, TS, thymidylate synthase; transferase, methyltra 100.0
3irm_A521 Bifunctional dihydrofolate reductase-thymidylate; DHFR- 100.0
1bkp_A278 Thymidylate synthase A; methyltransferase, DTMP synthas 100.0
1tis_A286 Thymidylate synthase; transferase(methyltransferase); 2 100.0
1b5e_A246 Protein (deoxycytidylate hydroxymethylase); DNTP synthe 100.0
>3jsu_A Dihydrofolate reductase-thymidylate synthase; rossmann fold, oxidoreductase, transferase; HET: KA5 NDP UMP; 2.70A {Plasmodium falciparum} Back     alignment and structure
Probab=100.00  E-value=0  Score=771.83  Aligned_cols=263  Identities=47%  Similarity=0.895  Sum_probs=257.2

Q ss_pred             HHHHHHHHHHHHCCCEECCCCCCCEEEEEECEEEEECCCCCCEEEEEEHHHHHHHHHHHHHHCCCCCHHHHHHHCCCHHH
Q ss_conf             57999999998639260379985347776120464423698104642022688999999985366646888640032135
Q gi|254780956|r    2 HQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELLWFLRGDSNVSYLHRHGVSIWD   81 (264)
Q Consensus         2 ~qYl~l~~~il~~G~~~~dRtG~~t~s~fg~~~~~dl~~gfPllTtkk~~~k~~i~EllW~l~G~tn~~~l~~~~~~iWd   81 (264)
                      +|||+||++||++|+.++||||++|+|+||++|||||++|||||||||||||++++||||||+|+||+++|+++||||||
T Consensus       326 ~qYl~ll~~il~~G~~~~dRTG~gT~s~FG~~~rfdl~~gfPlLTTKkv~~k~vi~ELLWfL~G~tn~~~L~~~~v~IWd  405 (608)
T 3jsu_A          326 YQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWE  405 (608)
T ss_dssp             HHHHHHHHHHHHHCEEECCSSSSCEEEEEEEEEEEETTTCCCCCSSSCCCCHHHHHHHHHHHTTCCBHHHHHTTTCCTTG
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCEEEECCCEEEECCCCCCCEEEECCCHHHHHHHHHHHHHHCCCCHHHHHHCCEEECC
T ss_conf             99999999999849876798989868861660464324587612314000899999999998589757889744603366


Q ss_pred             HHHHH------------HCCCCCCCCCHHHCCC--------CCCCCHHHHHHHHHHHHHCCCCHHHHHHHHCCHHHHHHC
Q ss_conf             65421------------0013876620100036--------775326889999999998088523677751698883202
Q gi|254780956|r   82 EWADK------------DGELGPIYGVQWRSWP--------DYDGNVIDQISSIVQSLRADPYSRRHIVSAWNVALIDKM  141 (264)
Q Consensus        82 ~~a~~------------~g~lg~~YG~qwR~~~--------~~~~~~~DQl~~vi~~Lk~np~sRR~i~~~wnp~~~~~~  141 (264)
                      +|+++            +|++||+||+|||+|+        +|.++++|||++||++||+||+|||+|+++|||+++++|
T Consensus       406 ~n~~~e~ld~~~~~~~~~gdlGpvYG~QWR~fga~y~~~~~~~~~~~~DQl~~vI~~Lk~nP~sRR~iis~WNp~dl~~m  485 (608)
T 3jsu_A          406 ANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQM  485 (608)
T ss_dssp             GGSSHHHHHHTTCTTSCTTBCCSCHHHHHHHBTSCCCCTTSCCTTCSBCHHHHHHHHHHHCTTCSCCEEECCCTTTGGGS
T ss_pred             CCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECCCHHHCCCC
T ss_conf             55553045422644434676475332110037974567667877750088999999974096778266533476670667


Q ss_pred             CCCCCCCCEEEEECCCEEEEEEEECCCCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCEEEHHHHHHHHHHHC
Q ss_conf             42113540246676880599997262440222021679999999999976224211113522730210036899999833
Q gi|254780956|r  142 ALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIASYSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLS  221 (264)
Q Consensus       142 ~lpPC~~~~qf~v~~g~L~~~~~qRS~D~~lG~pfNi~~y~lL~~~iA~~~gl~~G~~~~~~~d~HIY~nH~~~vk~ql~  221 (264)
                      ||||||+.+||+|++|+|+|++||||+|+|||+|||||+||+|++|||++||++||+|+|++||+|||+||+|+|++||+
T Consensus       486 aLpPCh~~~QF~V~~g~L~~~~~QRS~D~~LG~PfNiasyalL~~miA~~~gl~~G~~~h~igd~HIY~nH~~~v~~ql~  565 (608)
T 3jsu_A          486 ALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLN  565 (608)
T ss_dssp             SSCCSEEEEEEEEETTEEEEEEEEEEEETTTHHHHHHHHHHHHHHHHHHHTTCEEEEEEEEEEEEEEEGGGHHHHHHHTT
T ss_pred             CCCCCCEEEEEEEECCEEEEEEEEHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEECHHHHHHHHHHHC
T ss_conf             78886068999980998999997131012125627999999999999998598166599980455860868999999857


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             6987687799648868711262033799768768887875569
Q gi|254780956|r  222 RSPRTLPQMIINPNIVDLLSFRYEDFTLRSYEPHAAILAKVSV  264 (264)
Q Consensus       222 R~p~~~P~L~i~~~~~~i~d~~~eDf~L~~Y~~hp~Ik~~mAV  264 (264)
                      |+|+++|+|+|++++++|+||+++||+|+||+|||+||||||-
T Consensus       566 R~P~~~P~L~in~~~~~i~d~~~~Df~l~~Y~~hp~Ik~~maa  608 (608)
T 3jsu_A          566 RIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA  608 (608)
T ss_dssp             SCCCCCCEEEECTTCCSTTSCCGGGEEEECCCCCCCCCSCC--
T ss_pred             CCCCCCCEEEECCCCCCHHCCCHHHEEEECCCCCCCCCCCCCC
T ss_conf             8998998579799988640188659799688789987866569



>3hj3_A Chain A, crystal structure of DHFR; TS, enzyme, crossover, non-active site, oxidoreductase; HET: UMP CB3 MTX NDP; 2.70A {Cryptosporidium hominis} PDB: 1qzf_A* 1sej_A* 3dl5_A* 3dl6_A* 2oip_A* Back     alignment and structure
>1f28_A Thymidylate synthase; beta-sheet, protein-inhibitor complex, transferase; HET: UMP F89; 1.90A {Pneumocystis carinii} SCOP: d.117.1.1 PDB: 1ci7_A* Back     alignment and structure
>1hw4_A TS, thymidylate synthase; methyltransferase; HET: CME; 2.06A {Homo sapiens} SCOP: d.117.1.1 Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious disease, brucellosis, orchitis, epididymitis; 2.20A {Brucella melitensis} Back     alignment and structure
>1j3k_C Bifunctional dihydrofolate reductase-thymidylate synthase; oxidoreductase, transferase; HET: WRA NDP UMP; 2.10A {Plasmodium falciparum} SCOP: d.117.1.1 PDB: 1j3i_C* 1j3j_C* 3dg8_C* 3dga_C* Back     alignment and structure
>2g8o_A TS, tsase, thymidylate synthase; methyltransferase, DUMP, antifolate, high-resolution, ternary complex, beta sheet, alpha/beta protein; HET: CXM UMP CB3; 1.30A {Escherichia coli} SCOP: d.117.1.1 PDB: 1aob_A* 1f4c_A* 1f4e_A* 1f4f_A* 1jtq_A* 1jtu_A* 1jut_A* 1kce_A* 1kzi_A* 1tls_A* 1tsn_A* 1f4b_A* 2bbq_A* 2ftq_A* 2a9w_A* 2kce_A* 3b9h_A* 3bhl_A* 3bhr_A* 3tms_A ... Back     alignment and structure
>3ik0_A TS, tsase, thymidylate synthase; transferase, nucleotide synthase, methyltransferase, nucleot biosynthesis; HET: 7C1 UMP; 2.10A {Lactobacillus casei} PDB: 1lcb_A* 1lce_A* 1lca_A* 1thy_A* 1tsl_A* 1tsm_A* 2tdm_A* 3bnz_A* 3byx_A* 3bz0_A* 3c06_A* 3c0a_A* 1nje_A* 3ijz_A* 3ik1_A* 4tms_A 1tsy_A* 1tsz_A 1tdb_A* 1tda_A* ... Back     alignment and structure
>3nrr_A Dihydrofolate reductase-thymidylate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, niaid, DHFR; HET: NAP D16 UMP; 1.80A {Babesia bovis} PDB: 3kjr_A* 3i3r_A* 3k2h_A* Back     alignment and structure
>3kgb_A Thymidylate synthase 1/2; ssgcid, NIH, niaid, SBRI, UW, decode, methyltransferase, nucleotide biosynthesis, transferase; 2.20A {Encephalitozoon cuniculi gb-m1} Back     alignment and structure
>3ed7_A Tsase, TS, thymidylate synthase; transferase, methyltransferase, nucleotide biosynthesis; 1.56A {Homo sapiens} PDB: 3ebu_A* 1hvy_A* 1ypv_A* 1hw3_A* 2onb_A* 3eaw_X* 3gg5_A 3gh0_A 3ef9_A 3edw_X 3ejl_A* 3gh2_X* 2rd8_A* 2rda_A 3h9k_A* 3hb8_A* 1ju6_A* 1juj_A* 3egy_X* 3ehi_X* ... Back     alignment and structure
>3irm_A Bifunctional dihydrofolate reductase-thymidylate; DHFR-TS antifolate complex, methyltransfe multifunctional enzyme, NADP; HET: 1CY; 2.10A {Trypanosoma cruzi} PDB: 3inv_A* 3irn_A* 3iro_A* 2h2q_A* 3cl9_A* 3clb_A* 3hbb_A* 3kjs_A* Back     alignment and structure
>1bkp_A Thymidylate synthase A; methyltransferase, DTMP synthase; 1.70A {Bacillus subtilis} SCOP: d.117.1.1 PDB: 1bko_A 1bsf_A 1bsp_A 1b02_A* Back     alignment and structure
>1tis_A Thymidylate synthase; transferase(methyltransferase); 2.70A {Enterobacteria phage T4} SCOP: d.117.1.1 Back     alignment and structure
>1b5e_A Protein (deoxycytidylate hydroxymethylase); DNTP synthesizing complex, transferase; HET: DCM; 1.60A {Enterobacteria phage T4} SCOP: d.117.1.1 PDB: 1b49_A* 1b5d_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 264 thymidylate synthase [Candidatus Liberibacter asiaticus
d2g8oa1264 d.117.1.1 (A:1-264) Thymidylate synthase {Escherichia c 4e-83
d1tswa_316 d.117.1.1 (A:) Thymidylate synthase {Lactobacillus case 2e-82
d1f28a_295 d.117.1.1 (A:) Thymidylate synthase {Pneumocystis carin 7e-79
d1seja2289 d.117.1.1 (A:233-521) Bifunctional enzyme dihydrofolate 2e-78
d1hvya_288 d.117.1.1 (A:) Thymidylate synthase {Human (Homo sapien 2e-75
d1j3kc_326 d.117.1.1 (C:) Bifunctional enzyme dihydrofolate reduct 9e-75
d1tisa_286 d.117.1.1 (A:) Thymidylate synthase {Bacteriophage T4 [ 2e-67
d1bkpa_278 d.117.1.1 (A:) Thymidylate synthase {Bacillus subtilis 2e-63
d1b5ea_241 d.117.1.1 (A:) dCMP hydroxymethylase {Bacteriophage T4 3e-58
>d2g8oa1 d.117.1.1 (A:1-264) Thymidylate synthase {Escherichia coli [TaxId: 562]} Length = 264 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thymidylate synthase/dCMP hydroxymethylase
superfamily: Thymidylate synthase/dCMP hydroxymethylase
family: Thymidylate synthase/dCMP hydroxymethylase
domain: Thymidylate synthase
species: Escherichia coli [TaxId: 562]
 Score =  301 bits (772), Expect = 4e-83
 Identities = 153/264 (57%), Positives = 201/264 (76%)

Query: 1   MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60
           M QYL+L++ V+  G+ + DRTG GT S FG+QMRF+L  GFPL+TTK+ H +S++HELL
Sbjct: 1   MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL 60

Query: 61  WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120
           WFL+GD+N++YLH + V+IWDEWAD++G+LGP+YG QWR+WP  DG  IDQI++++  L+
Sbjct: 61  WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK 120

Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180
            DP SRR IVSAWNV  +DKMAL PCH  FQFYV +GKLSCQLYQRS DVFLG+PFNIAS
Sbjct: 121 NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS 180

Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240
           Y+LL  M+A     + G+F+ T GD HLY+NH +Q  LQLSR PR LP++II      + 
Sbjct: 181 YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF 240

Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264
            +R+EDF +  Y+PH  I A V++
Sbjct: 241 DYRFEDFEIEGYDPHPGIKAPVAI 264


>d1tswa_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]} Length = 316 Back     information, alignment and structure
>d1f28a_ d.117.1.1 (A:) Thymidylate synthase {Pneumocystis carinii [TaxId: 4754]} Length = 295 Back     information, alignment and structure
>d1seja2 d.117.1.1 (A:233-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]} Length = 289 Back     information, alignment and structure
>d1hvya_ d.117.1.1 (A:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1j3kc_ d.117.1.1 (C:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 326 Back     information, alignment and structure
>d1tisa_ d.117.1.1 (A:) Thymidylate synthase {Bacteriophage T4 [TaxId: 10665]} Length = 286 Back     information, alignment and structure
>d1bkpa_ d.117.1.1 (A:) Thymidylate synthase {Bacillus subtilis [TaxId: 1423]} Length = 278 Back     information, alignment and structure
>d1b5ea_ d.117.1.1 (A:) dCMP hydroxymethylase {Bacteriophage T4 [TaxId: 10665]} Length = 241 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target264 thymidylate synthase [Candidatus Liberibacter asiaticus
d1f28a_295 Thymidylate synthase {Pneumocystis carinii [TaxId: 4754 100.0
d1tswa_316 Thymidylate synthase {Lactobacillus casei [TaxId: 1582] 100.0
d1j3kc_326 Bifunctional enzyme dihydrofolate reductase-thymidylate 100.0
d2g8oa1264 Thymidylate synthase {Escherichia coli [TaxId: 562]} 100.0
d1seja2289 Bifunctional enzyme dihydrofolate reductase-thymidylate 100.0
d1hvya_288 Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606 100.0
d1bkpa_278 Thymidylate synthase {Bacillus subtilis [TaxId: 1423]} 100.0
d1tisa_286 Thymidylate synthase {Bacteriophage T4 [TaxId: 10665]} 100.0
d1b5ea_241 dCMP hydroxymethylase {Bacteriophage T4 [TaxId: 10665]}