254780957

254780957

dihydrofolate reductase protein

GeneID in NCBI database:8209979Locus tag:CLIBASIA_04280
Protein GI in NCBI database:254780957Protein Accession:YP_003065370.1
Gene range:+(953731, 954261)Protein Length:176aa
Gene description:dihydrofolate reductase protein
COG prediction:[H] Dihydrofolate reductase
KEGG prediction:dihydrofolate reductase protein; K00287 dihydrofolate reductase [EC:1.5.1.3]
SEED prediction:Dihydrofolate reductase (EC 1.5.1.3)
Pathway involved in KEGG:Folate biosynthesis [PATH:las00790]
One carbon pool by folate [PATH:las00670]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MTRPEIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPGRTNIIITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYITHIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDRFLSKNCS
ccccEEEEEEEEccccEEEEccccccccHHHHHHHHHHccccEEEEccccHHHccccccccEEEEEcccccccccccccEEEEccHHHHHHHHHHccccEEEEEccHHHHHHHHHHccEEEEEEEcccccccEEcccccHHHEEEEcccccccccccccccEEEEEEEEccccccc
cccccEEEEEEEcHHHEEEEccEcccccHHHHHHHHHHHccccEEEEHHHHHHHccccccccEEEEccccccccccccccEEEccHHHHHHHHHccccccEEEcccHHHHHHHHHHEEEEEEEEEcccccccEEcccccHHHEEHHHHccccccccccccccEEEEEEEEcccccc
MTRPEIILIAAITRnnvigscggmpwkissdlkrfkslttgnpvvmgYRTFQSIgrllpgrtniiitrdntrrasvnpeAVLASSILDSLDlasktgskkifIIGGGEIYAQTISLAHTLYITHIEkeiegdvffpsidsnIWKKQEKEIITsagegddyptrfVIYDrflskncs
MTRPEIILIAaitrnnvigscGGMPWKISSDLKRFKSLTtgnpvvmgyrtfqsigrllpgrtniiitrdntrrasvnpEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYITHIEKEIEGDVFFPSIDSNIWKKQEKEIItsagegddyptrFVIYDrflskncs
MTRPEIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPGRTNIIITRDNTRRASVNPEAVlassildsldlasKTGSKKIFIIGGGEIYAQTISLAHTLYITHIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDRFLSKNCS
**RPEIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPGRTNIIITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYITHIEKEIEGDVFFPSIDSNIWKKQEKE*****GEGDDYPTRFVIY**FL*****
MTRPEIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPGRTNIIITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYITHIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDRFLSKNCS
***PEIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPGRTNIIITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYITHIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDRFL*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRPEIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPGRTNIIITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYITHIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDRFLSKNCS
MTRPEIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPGRTNIIITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYITHIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDRFLSKNCS
MTRPEIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPGRTNIIITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYITHIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDRFLSKNCS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target176 dihydrofolate reductase protein [Candidatus Liberibacte
254780549271 signal peptide protein [Candidatus Liberibacter as 0.003
>gi|254780549|ref|YP_003064962.1| signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Back     alignment
 Score = 33.1 bits (74), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 11/75 (14%)

Query: 11  AITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRL---LPGRTNII-- 65
           AI RN VI +     W I SD KRFK L       +  + F  +G++   + G T ++  
Sbjct: 180 AIVRNRVIAN-----WNIPSDFKRFKKLRVKMHFQLNQKGF-VLGKINVDVVGGTELVRR 233

Query: 66  ITRDNTRRASVNPEA 80
           + R+N R+A +  +A
Sbjct: 234 MLRENARKAVIKSQA 248

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target176 dihydrofolate reductase protein [Candidatus Liberibacte
315122501174 dihydrofolate reductase protein [Candidatus Liberibacte 1 4e-48
86358402172 dihydrofolate reductase protein [Rhizobium etli CFN 42] 1 2e-42
190892526172 dihydrofolate reductase [Rhizobium etli CIAT 652] Lengt 1 2e-42
218659323189 dihydrofolate reductase protein [Rhizobium etli IE4771] 1 6e-42
218463521172 dihydrofolate reductase protein [Rhizobium etli Kim 5] 1 8e-42
209550124172 dihydrofolate reductase [Rhizobium leguminosarum bv. tr 1 7e-41
241205505172 Dihydrofolate reductase [Rhizobium leguminosarum bv. tr 1 9e-41
116252998172 dihydrofolate reductase [Rhizobium leguminosarum bv. vi 1 3e-40
222086378172 dihydrofolate reductase protein [Agrobacterium radiobac 1 9e-40
319408803169 Dihydrofolate reductase [Bartonella schoenbuchensis R1] 1 2e-39
>gi|315122501|ref|YP_004062990.1| dihydrofolate reductase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 174 Back     alignment and organism information
 Score =  194 bits (493), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 100/167 (59%), Positives = 118/167 (70%), Gaps = 2/167 (1%)

Query: 4   PEIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGR-LLPGRT 62
           P+IILI AI  NNVIG  G MPWK+SSDLKRFK LT GNP++MGYRTF SI +  LPGR 
Sbjct: 2   PKIILIVAIASNNVIGDYGHMPWKLSSDLKRFKELTLGNPIIMGYRTFLSIKKNPLPGRL 61

Query: 63  NIIITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYI 122
           NI++TR N R      E   A SI  SL++A KT SKK+F IGG EIY QTI+ A  LY+
Sbjct: 62  NIVLTR-NHRDDVSGSEIKFADSIDRSLEIAYKTESKKVFFIGGQEIYTQTINRADNLYV 120

Query: 123 THIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDR 169
           THIE  I+GD FFP ID + W+++ K I   A E D+YPTRFVIY R
Sbjct: 121 THIEAAIKGDAFFPPIDPSCWQEKGKPIFIPASEKDEYPTRFVIYHR 167


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86358402|ref|YP_470294.1| dihydrofolate reductase protein [Rhizobium etli CFN 42] Length = 172 Back     alignment and organism information
>gi|190892526|ref|YP_001979068.1| dihydrofolate reductase [Rhizobium etli CIAT 652] Length = 172 Back     alignment and organism information
>gi|218659323|ref|ZP_03515253.1| dihydrofolate reductase protein [Rhizobium etli IE4771] Length = 189 Back     alignment and organism information
>gi|218463521|ref|ZP_03503612.1| dihydrofolate reductase protein [Rhizobium etli Kim 5] Length = 172 Back     alignment and organism information
>gi|209550124|ref|YP_002282041.1| dihydrofolate reductase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 172 Back     alignment and organism information
>gi|241205505|ref|YP_002976601.1| Dihydrofolate reductase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 172 Back     alignment and organism information
>gi|116252998|ref|YP_768836.1| dihydrofolate reductase [Rhizobium leguminosarum bv. viciae 3841] Length = 172 Back     alignment and organism information
>gi|222086378|ref|YP_002544912.1| dihydrofolate reductase protein [Agrobacterium radiobacter K84] Length = 172 Back     alignment and organism information
>gi|319408803|emb|CBI82460.1| Dihydrofolate reductase [Bartonella schoenbuchensis R1] Length = 169 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target176 dihydrofolate reductase protein [Candidatus Liberibacte
cd00209158 cd00209, DHFR, Dihydrofolate reductase (DHFR) 5e-44
COG0262167 COG0262, FolA, Dihydrofolate reductase [Coenzyme metabo 1e-33
PRK10769159 PRK10769, folA, dihydrofolate reductase; Provisional 4e-30
PTZ00164 514 PTZ00164, PTZ00164, bifunctional dihydrofolate reductas 3e-25
KOG1324190 KOG1324, KOG1324, KOG1324, Dihydrofolate reductase [Coe 1e-23
pfam00186159 pfam00186, DHFR_1, Dihydrofolate reductase 1e-55
PRK00478 505 PRK00478, scpA, segregation and condensation protein A/ 3e-11
>gnl|CDD|29264 cd00209, DHFR, Dihydrofolate reductase (DHFR) Back     alignment and domain information
>gnl|CDD|30611 COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|182714 PRK10769, folA, dihydrofolate reductase; Provisional Back     alignment and domain information
>gnl|CDD|185491 PTZ00164, PTZ00164, bifunctional dihydrofolate reductase-thymidylate synthase; Provisional Back     alignment and domain information
>gnl|CDD|36538 KOG1324, KOG1324, KOG1324, Dihydrofolate reductase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|143949 pfam00186, DHFR_1, Dihydrofolate reductase Back     alignment and domain information
>gnl|CDD|100572 PRK00478, scpA, segregation and condensation protein A/unknown domain fusion protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 176 dihydrofolate reductase protein [Candidatus Liberibacte
PRK10769159 folA dihydrofolate reductase; Provisional 100.0
pfam00186159 DHFR_1 Dihydrofolate reductase. 100.0
cd00209158 DHFR Dihydrofolate reductase (DHFR). Reduces 7,8-dihydr 100.0
PTZ00164 512 bifunctional dihydrofolate reductase-thymidylate syntha 100.0
KOG1324190 consensus 100.0
COG0262167 FolA Dihydrofolate reductase [Coenzyme metabolism] 100.0
PRK00478 505 scpA segregation and condensation protein A/unknown dom 100.0
pfam01872196 RibD_C RibD C-terminal domain. The function of this dom 99.25
PRK05625239 hypothetical protein; Validated 98.81
COG1985218 RibD Pyrimidine reductase, riboflavin biosynthesis [Coe 97.31
PRK10786367 ribD bifunctional diaminohydroxyphosphoribosylaminopyri 97.11
>PRK10769 folA dihydrofolate reductase; Provisional Back     alignment and domain information
>pfam00186 DHFR_1 Dihydrofolate reductase Back     alignment and domain information
>cd00209 DHFR Dihydrofolate reductase (DHFR) Back     alignment and domain information
>PTZ00164 bifunctional dihydrofolate reductase-thymidylate synthase; Provisional Back     alignment and domain information
>KOG1324 consensus Back     alignment and domain information
>COG0262 FolA Dihydrofolate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK00478 scpA segregation and condensation protein A/unknown domain fusion protein; Provisional Back     alignment and domain information
>pfam01872 RibD_C RibD C-terminal domain Back     alignment and domain information
>PRK05625 hypothetical protein; Validated Back     alignment and domain information
>COG1985 RibD Pyrimidine reductase, riboflavin biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK10786 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target176 dihydrofolate reductase protein [Candidatus Liberibacte
1zdr_A164 Dhfr From Bacillus Stearothermophilus Length = 164 3e-44
2zza_A162 Moritella Profunda Dihydrofolate Reductase Complex 1e-43
3ia4_A162 Moritella Profunda Dihydrofolate Reductase (Dhfr) I 2e-43
3jw3_A168 Crystal Structure Of Bacillus Anthracis (F96i) Dihy 8e-43
3q1h_A163 Crystal Structure Of Dihydrofolate Reductase From Y 8e-43
3fl8_A166 Crystal Structure Of B. Anthracis Dihydrofolate Red 2e-42
3jvx_A168 Crystal Structure Of Bacillus Anthracis Dihydrofola 2e-42
3jw5_A168 Crystal Structure Of Bacillus Anthracis (Y102f) Dih 2e-42
2kgk_A172 Solution Structure Of Bacillus Anthracis Dihydrofol 2e-42
2d0k_A159 Methionine-Free Mutant Of Escherichia Coli Dihydrof 3e-42
2qk8_A162 Crystal Structure Of The Anthrax Drug Target, Bacil 3e-42
3e0b_A166 Bacillus Anthracis Dihydrofolate Reductase Complexe 4e-42
1dds_A159 Molecule: Dihydrofolate Reductase (E.C.1.5.1.3) Com 2e-41
2inq_B159 Neutron Crystal Structure Of Escherichia Coli Dihyd 4e-41
3drc_A159 Investigation Of The Functional Role Of Tryptophan- 5e-41
4dfr_A159 Crystal Structures Of Escherichia Coli And Lactobac 1e-40
1dra_A159 Crystal Structure Of Unliganded Escherichia Coli Di 2e-40
1dhj_A159 Long-Range Structural Effects In A Second-Site Reve 2e-40
3ql0_A160 Crystal Structure Of N23ppS148A MUTANT OF E. COLI D 9e-40
1dhi_A159 Long-Range Structural Effects In A Second-Site Reve 1e-39
2drc_A159 Investigation Of The Functional Role Of Tryptophan- 1e-39
1drb_A159 Crystal Structure Of Unliganded Escherichia Coli Di 2e-39
2w9s_A161 Staphylococcus Aureus S1:dhfr In Complex With Trime 1e-35
3ix9_A190 Crystal Structure Of Streptococcus Pneumoniae Dihyd 7e-35
3lg4_A168 Staphylococcus Aureus V31y, F92i Mutant Dihydrofola 5e-34
3fy8_X158 Crystal Structure Of Staph. Aureus Dhfr Complexed W 2e-33
3m09_A161 F98y Tmp-Resistant Dihydrofolate Reductase From Sta 2e-33
3fyv_X158 Staph. Aureus Dhfr Complexed With Nadph And Ar-102 2e-33
3m08_A161 Wild Type Dihydrofolate Reductase From Staphylococc 2e-33
2w9g_A159 Wild-Type Staphylococcus Aureus Dhfr In Complex Wit 2e-33
3f0u_X157 Staphylococcus Aureus F98y Mutant Dihydrofolate Red 3e-33
3f0b_X157 Staphylococcus Aureus Dihydrofolate Reductase Compl 3e-33
3i8a_X157 Staphylococcus Aureus H30n, F98y Dihydrofolate Redu 2e-32
1lud_A162 Solution Structure Of Dihydrofolate Reductase Compl 2e-29
3k45_A186 Alternate Binding Modes Observed For The E- And Z-I 3e-29
2fzj_A186 New Insights Into Dhfr Interactions: Analysis Of Pn 3e-29
3dfr_A162 Crystal Structures Of Escherichia Coli And Lactobac 6e-29
1df7_A159 Dihydrofolate Reductase Of Mycobacterium Tuberculos 1e-28
2cig_A159 Dihydrofolate Reductase From Mycobacterium Tubercul 1e-28
3l3r_A186 Structural, Computational And Kinetic Data For Anti 1e-28
3ghv_A186 Human Dihydrofolate Reductase Q35kN64F DOUBLE MUTAN 1e-28
3f8y_A187 Correlations Of Human Dihydrofolate Reductase With 2e-28
3nxo_A186 Perferential Selection Of Isomer Binding From Chira 5e-28
1dhf_A186 Crystal Structures Of Recombinant Human Dihydrofola 5e-28
3ghc_A186 Design, Synthesis, And X-Ray Crystal Structure Of C 5e-28
1mvs_A187 Analysis Of Two Polymorphic Forms Of A Pyrido[2,3- 6e-28
3f8z_A187 Human Dihydrofolate Reductase Structural Data With 6e-28
1u70_A186 Understanding The Role Of Leu22 Variants In Methotr 8e-28
3f91_A187 Structural Data For Human Active Site Mutant Enzyme 9e-28
2w3v_A167 Mycobacterium Avium Dihydrofolate Reductase Complex 1e-27
1hfq_A186 Comparison Of Ternary Crystal Complexes Of Human Di 2e-27
1boz_A186 Structure-Based Design And Synthesis Of Lipophilic 2e-27
1dr1_A189 2.2 Angstroms Crystal Structure Of Chicken Liver Di 4e-27
3eig_A186 Crystal Structure Of A Methotrexate-Resistant Mutan 4e-27
1dlr_A186 Methotrexate-Resistant Variants Of Human Dihydrofol 7e-27
3hj3_A 521 Crystal Structure Of The Chts-Dhfr F207a Non-Active 8e-27
1qzf_A 521 Crystal Structure Of Dhfr-Ts From Cryptosporidium H 9e-27
3dl6_A 521 Crystal Structure Of The A287fS290G ACTIVE SITE MUT 1e-26
3dl5_A 521 Crystal Structure Of The A287f Active Site Mutant O 1e-26
1dls_A186 Methotrexate-Resistant Variants Of Human Dihydrofol 1e-26
1u71_A186 Understanding The Role Of Leu22 Variants In Methotr 1e-26
1vdr_A162 Dihydrofolate Reductase Length = 162 1e-25
2jyb_A162 Binary Hvdhfr1:folate Complex Length = 162 2e-25
2oip_A 519 Crystal Structure Of The S290g Active Site Mutant O 4e-25
1cd2_A206 Ligand Induced Conformational Changes In The Crysta 7e-25
3nrr_A 515 Co-Crystal Structure Of Dihydrofolate Reductase-Thy 8e-25
1vj3_A205 Structural Studies On Bio-Active Compounds. Crystal 9e-25
3i3r_A 511 X-Ray Structure Dihydrofolate ReductaseTHYMIDYLATE 1e-24
3jsu_A 608 Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium 1e-19
2bla_A238 Sp21 Double Mutant P. Vivax Dihydrofolate Reductase 4e-19
1j3j_A280 Double Mutant (C59r+s108n) Plasmodium Falciparum Di 4e-19
1j3k_A280 Quadruple Mutant (N51i+c59r+s108n+i164l) Plasmodium 7e-19
3cse_A227 Candida Glabrata Dihydrofolate Reductase Complexed 8e-19
2bl9_A238 X-Ray Crystal Structure Of Plasmodium Vivax Dihydro 1e-18
3inv_A 521 Trypanosoma Cruzi Dihydrofolate Reductase-Thymidyla 4e-18
1j3i_A280 Wild-Type Plasmodium Falciparum Dihydrofolate Reduc 5e-18
2h2q_A 521 Crystal Structure Of Trypanosoma Cruzi Dihydrofolat 6e-18
1ai9_A192 Candida Albicans Dihydrofolate Reductase Length = 1 2e-17
1juv_A193 Crystal Structure Analysis Of Dihydrofolate Reducta 4e-07
1cz3_A168 Dihydrofolate Reductase From Thermotoga Maritima Le 1e-06
gi|75765748|pdb|1ZDR|A Chain A, Dhfr From Bacillus Stearothermophilus Length = 164 Back     alignment and structure
 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 89/168 (52%), Gaps = 5/168 (2%)

Query: 6   IILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPGRTNII 65
           I  I A+  N VIG    +PW + +DL  FK +T G+ +VMG +TF++IGR LPGR N++
Sbjct: 2   ISHIVAMDENRVIGKDNRLPWHLPADLAYFKRVTMGHAIVMGRKTFEAIGRPLPGRDNVV 61

Query: 66  ITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYITHI 125
           +T + + R       ++  S+ +     +     ++FIIGG E++  T+ +   LY+T I
Sbjct: 62  VTGNRSFR---PEGCLVLHSLEEVKQWIASRAD-EVFIIGGAELFRATMPIVDRLYVTKI 117

Query: 126 EKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDRFLSK 173
                GD F+P I  + W+           E + Y   F+IY+R  +K
Sbjct: 118 FASFPGDTFYPPISDDEWEIVS-YTPGGKDEKNPYEHAFIIYERKKAK 164


>gi|289526579|pdb|2ZZA|A Chain A, Moritella Profunda Dihydrofolate Reductase Complex With Nadp+ And Folate Length = 162 Back     alignment and structure
>gi|254575100|pdb|3IA4|A Chain A, Moritella Profunda Dihydrofolate Reductase (Dhfr) In Complex With Nadph And Methotrexate (Mtx) Length = 162 Back     alignment and structure
>gi|306991638|pdb|3JW3|A Chain A, Crystal Structure Of Bacillus Anthracis (F96i) Dihydrofolate Reductase Complexed With Nadph And Trimethoprim Length = 168 Back     alignment and structure
>gi|317455525|pdb|3Q1H|A Chain A, Crystal Structure Of Dihydrofolate Reductase From Yersinia Pestis Length = 163 Back     alignment and structure
>gi|228312069|pdb|3FL8|A Chain A, Crystal Structure Of B. Anthracis Dihydrofolate Reductase (Dhfr) With Rab1, A Tmp-Dihydrophthalazine Derivative Length = 166 Back     alignment and structure
>gi|306991636|pdb|3JVX|A Chain A, Crystal Structure Of Bacillus Anthracis Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-(3-(3,4,5-Trimethoxyphenyl) Prop-1-Ynyl)-6-Ethylpyrimidine (Ucp120a) Length = 168 Back     alignment and structure
>gi|306991640|pdb|3JW5|A Chain A, Crystal Structure Of Bacillus Anthracis (Y102f) Dihydrofolate Reductase Complexed With Nadph And Trimethoprim Length = 168 Back     alignment and structure
>gi|237640369|pdb|2KGK|A Chain A, Solution Structure Of Bacillus Anthracis Dihydrofolate Reductase Length = 172 Back     alignment and structure
>gi|90109160|pdb|2D0K|A Chain A, Methionine-Free Mutant Of Escherichia Coli Dihydrofolate Reductase Length = 159 Back     alignment and structure
gi|158430246|pdb|2QK8|A Chain A, Crystal Structure Of The Anthrax Drug Target, Bacillus Anthracis Dihydrofolate Reductase Length = 162 Back     alignment and structure
>gi|215261240|pdb|3E0B|A Chain A, Bacillus Anthracis Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-(3-(2,5-Dimethoxyphenyl)prop-1- Ynyl)-6-Ethylpyrimidine (Ucp120b) Length = 166 Back     alignment and structure
gi|1311369|pdb|1DDS|A Chain A, Molecule: Dihydrofolate Reductase (E.C.1.5.1.3) Complexed With Methotrexate Length = 159 Back     alignment and structure
>gi|157883897|pdb|2INQ|B Chain B, Neutron Crystal Structure Of Escherichia Coli Dihydrofolate Reductase Bound To The Anti-Cancer Drug, Methotrexate Length = 159 Back     alignment and structure
>gi|494870|pdb|3DRC|A Chain A, Investigation Of The Functional Role Of Tryptophan-22 In Escherichia Coli Dihydrofolate Reductase By Site-Directed Mutagenesis Length = 159 Back     alignment and structure
>gi|230995|pdb|4DFR|A Chain A, Crystal Structures Of Escherichia Coli And Lactobacillus Casei Dihydrofolate Reductase Refined At 1.7 Angstroms Resolution. I. General Features And Binding Of Methotrexate Length = 159 Back     alignment and structure
>gi|493978|pdb|1DRA|A Chain A, Crystal Structure Of Unliganded Escherichia Coli Dihydrofolate Reductase. Ligand-Induced Conformational Changes And Cooperativity In Binding Length = 159 Back     alignment and structure
>gi|493972|pdb|1DHJ|A Chain A, Long-Range Structural Effects In A Second-Site Revertant Of A Mutant Dihydrofolate Reductase Length = 159 Back     alignment and structure
>gi|329666232|pdb|3QL0|A Chain A, Crystal Structure Of N23ppS148A MUTANT OF E. COLI DIHYDROFOLATE Reductase Length = 160 Back     alignment and structure
>gi|493970|pdb|1DHI|A Chain A, Long-Range Structural Effects In A Second-Site Revertant Of A Mutant Dihydrofolate Reductase Length = 159 Back     alignment and structure
>gi|494769|pdb|2DRC|A Chain A, Investigation Of The Functional Role Of Tryptophan-22 In Escherichia Coli Dihydrofolate Reductase By Site-Directed Mutagenesis Length = 159 Back     alignment and structure
>gi|493980|pdb|1DRB|A Chain A, Crystal Structure Of Unliganded Escherichia Coli Dihydrofolate Reductase. Ligand-Induced Conformational Changes And Cooperativity In Binding Length = 159 Back     alignment and structure
>gi|225733918|pdb|2W9S|A Chain A, Staphylococcus Aureus S1:dhfr In Complex With Trimethoprim Length = 161 Back     alignment and structure
>gi|285803403|pdb|3IX9|A Chain A, Crystal Structure Of Streptococcus Pneumoniae Dihydrofolate Reductase - Sp9 Mutant Length = 190 Back     alignment and structure
>gi|301598525|pdb|3LG4|A Chain A, Staphylococcus Aureus V31y, F92i Mutant Dihydrofolate Reductase Complexed With Nadph And 5-[(3s)-3-(5-Methoxy-2',6'-Dimethylbiphenyl- 3-Yl)but-1-Yn-1-Yl]-6-Methylpyrimidine-2,4-Diamine Length = 168 Back     alignment and structure
>gi|255311793|pdb|3FY8|X Chain X, Crystal Structure Of Staph. Aureus Dhfr Complexed With Nadph And Ar-101 Length = 158 Back     alignment and structure
>gi|300508516|pdb|3M09|A Chain A, F98y Tmp-Resistant Dihydrofolate Reductase From Staphylococcus Aureus With Inhibitor Rab1 Length = 161 Back     alignment and structure
>gi|255311795|pdb|3FYV|X Chain X, Staph. Aureus Dhfr Complexed With Nadph And Ar-102 Length = 158 Back     alignment and structure
>gi|300508515|pdb|3M08|A Chain A, Wild Type Dihydrofolate Reductase From Staphylococcus Aureus With Inhibitor Rab1 Length = 161 Back     alignment and structure
gi|225733916|pdb|2W9G|A Chain A, Wild-Type Staphylococcus Aureus Dhfr In Complex With Nadph And Trimethoprim Length = 159 Back     alignment and structure
>gi|225734100|pdb|3F0U|X Chain X, Staphylococcus Aureus F98y Mutant Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-[3-(3-Methoxy-5- Phenylphenyl)but-1-Ynyl]-6-Methylpyrimidine Length = 157 Back     alignment and structure
>gi|225734099|pdb|3F0B|X Chain X, Staphylococcus Aureus Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-[3-(3-Methoxy-5-Phenylphenyl) But-1-Ynyl]-6-Methylpyrimidine Length = 157 Back     alignment and structure
>gi|288563000|pdb|3I8A|X Chain X, Staphylococcus Aureus H30n, F98y Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-(3-(2,5- Dimethoxyphenyl)prop-1-Ynyl)-6-Ethylpyrimidine (Ucp120b) Length = 157 Back     alignment and structure
>gi|27573798|pdb|1LUD|A Chain A, Solution Structure Of Dihydrofolate Reductase Complexed With Trimethoprim And Nadph, 24 Structures Length = 162 Back     alignment and structure
>gi|261278911|pdb|3K45|A Chain A, Alternate Binding Modes Observed For The E- And Z-Isomers Of 2,4- Diaminofuro[2,3d]pyrimidines As Ternary Complexes With Nadph And Mouse Dihydrofolate Reductase Length = 186 Back     alignment and structure
>gi|122920266|pdb|2FZJ|A Chain A, New Insights Into Dhfr Interactions: Analysis Of Pneumocystis Carinii And Mouse Dhfr Complexes With Nadph And Two Highly Potent Trimethoprim Derivatives Length = 186 Back     alignment and structure
>gi|157836796|pdb|3DFR|A Chain A, Crystal Structures Of Escherichia Coli And Lactobacillus Casei Dihydrofolate Reductase Refined At 1.7 Angstroms Resolution. I. General Features And Binding Of Methotrexate Length = 162 Back     alignment and structure
gi|7546611|pdb|1DF7|A Chain A, Dihydrofolate Reductase Of Mycobacterium Tuberculosis Complexed With Nadph And Methotrexate Length = 159 Back     alignment and structure
>gi|99031974|pdb|2CIG|A Chain A, Dihydrofolate Reductase From Mycobacterium Tuberculosis Inhibited By The Acyclic 4r Isomer Of Inh-Nadp A Derivative Of The Prodrug Isoniazid Length = 159 Back     alignment and structure
>gi|316983216|pdb|3L3R|A Chain A, Structural, Computational And Kinetic Data For Antifolate Interactions Against Pneumocystis Jirovecii, Pneumocystis Carinii And Human Dihydrofolate Reductase And Their Active Site Mutants Length = 186 Back     alignment and structure
>gi|259090212|pdb|3GHV|A Chain A, Human Dihydrofolate Reductase Q35kN64F DOUBLE MUTANT Inhibitor Complex Length = 186 Back     alignment and structure
>gi|256032593|pdb|3F8Y|A Chain A, Correlations Of Human Dihydrofolate Reductase With Structural Data For Human Active Site Mutant Enzyme Complexes Length = 187 Back     alignment and structure
>gi|313103879|pdb|3NXO|A Chain A, Perferential Selection Of Isomer Binding From Chiral Mixtures: Alternate Binding Modes Observed For The E- And Z-Isomers Of A Series Of 5-Substituted 2,4-Diaminofuro[2,3-D]pyrimidines As Ternary Complexes With Nadph And Human Dihydrofolate Reductase Length = 186 Back     alignment and structure
>gi|229860|pdb|1DHF|A Chain A, Crystal Structures Of Recombinant Human Dihydrofolate Reductase Complexed With Folate And 5-Deazofolate Length = 186 Back     alignment and structure
>gi|259090211|pdb|3GHC|A Chain A, Design, Synthesis, And X-Ray Crystal Structure Of Classical And Nonclassical 2-Amino-4-Oxo-5-Substituted-6-Thieno[2,3- D]pyrimidines As Dual Thymidylate Synthase And Dihydrofolate Reductase Inhibitors And As Potential Antitumor Agenst Length = 186 Back     alignment and structure
gi|29726522|pdb|1MVS|A Chain A, Analysis Of Two Polymorphic Forms Of A Pyrido[2,3- D]pyrimidine N9-C10 Reverse-Bridge Antifolate Binary Complex With Human Dihydrofolate Reductase Length = 187 Back     alignment and structure
>gi|256032594|pdb|3F8Z|A Chain A, Human Dihydrofolate Reductase Structural Data With Active Site Mutant Enzyme Complexes Length = 187 Back     alignment and structure
>gi|60593615|pdb|1U70|A Chain A, Understanding The Role Of Leu22 Variants In Methotrexate Resistance: Comparison Of Wild-Type And Leu22arg Variant Mouse And Human Dihydrofolate Reductase Length = 186 Back     alignment and structure
>gi|256032595|pdb|3F91|A Chain A, Structural Data For Human Active Site Mutant Enzyme Complexes Length = 187 Back     alignment and structure
>gi|268612134|pdb|2W3V|A Chain A, Mycobacterium Avium Dihydrofolate Reductase Complexed With Nadph And Trimethoprim Length = 167 Back     alignment and structure
>gi|157831328|pdb|1HFQ|A Chain A, Comparison Of Ternary Crystal Complexes Of Human Dihydrofolate Reductase With Nadph And A Classical Antitumor Furopyrimdine Length = 186 Back     alignment and structure
>gi|3660048|pdb|1BOZ|A Chain A, Structure-Based Design And Synthesis Of Lipophilic 2,4- Diamino-6-Substituted Quinazolines And Their Evaluation As Inhibitors Of Dihydrofolate Reductase And Potential Antitumor Agents Length = 186 Back     alignment and structure
gi|157830864|pdb|1DR1|A Chain A, 2.2 Angstroms Crystal Structure Of Chicken Liver Dihydrofolate Reductase Complexed With Nadp+ And Biopterin Length = 189 Back     alignment and structure
>gi|238537777|pdb|3EIG|A Chain A, Crystal Structure Of A Methotrexate-Resistant Mutant Of Human Dihydrofolate Reductase Length = 186 Back     alignment and structure
>gi|157830836|pdb|1DLR|A Chain A, Methotrexate-Resistant Variants Of Human Dihydrofolate Reductase With Substitution Of Leucine 22: Kinetics, Crystallography And Potential As Selectable Markers Length = 186 Back     alignment and structure
>gi|297342898|pdb|3HJ3|A Chain A, Crystal Structure Of The Chts-Dhfr F207a Non-Active Site Mut Length = 521 Back     alignment and structure
gi|39654756|pdb|1QZF|A Chain A, Crystal Structure Of Dhfr-Ts From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>gi|197107405|pdb|3DL6|A Chain A, Crystal Structure Of The A287fS290G ACTIVE SITE MUTANT OF Ts-Dhfr From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>gi|197107400|pdb|3DL5|A Chain A, Crystal Structure Of The A287f Active Site Mutant Of Ts- Dhfr From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>gi|157830837|pdb|1DLS|A Chain A, Methotrexate-Resistant Variants Of Human Dihydrofolate Reductase With Substitution Of Leucine 22: Kinetics, Crystallography And Potential As Selectable Markers Length = 186 Back     alignment and structure
>gi|60593616|pdb|1U71|A Chain A, Understanding The Role Of Leu22 Variants In Methotrexate Resistance: Comparison Of Wild-Type And Leu22arg Variant Mouse And Human Dihydrofolate Reductase Ternary Crystal Complexes With Methotrexate And Nadph Length = 186 Back     alignment and structure
gi|2982132|pdb|1VDR|A Chain A, Dihydrofolate Reductase Length = 162 Back     alignment and structure
>gi|209870271|pdb|2JYB|A Chain A, Binary Hvdhfr1:folate Complex Length = 162 Back     alignment and structure
>gi|152149198|pdb|2OIP|A Chain A, Crystal Structure Of The S290g Active Site Mutant Of Ts- Dhfr From Cryptosporidium Hominis Length = 519 Back     alignment and structure
gi|7245416|pdb|1CD2|A Chain A, Ligand Induced Conformational Changes In The Crystal Structures Of Pneumocystis Carinii Dihydrofolate Reductase Complexes With Folate And Nadp+ Length = 206 Back     alignment and structure
>gi|300508797|pdb|3NRR|A Chain A, Co-Crystal Structure Of Dihydrofolate Reductase-Thymidylate Synthase From Babesia Bovis With Dump, Raltitrexed And Nadp Length = 515 Back     alignment and structure
>gi|42543914|pdb|1VJ3|A Chain A, Structural Studies On Bio-Active Compounds. Crystal Structure And Molecular Modeling Studies On The Pneumocystis Carinii Dihydrofolate Reductase Cofactor Complex With Tab, A Highly Selective Antifolate Length = 205 Back     alignment and structure
gi|256032857|pdb|3I3R|A Chain A, X-Ray Structure Dihydrofolate ReductaseTHYMIDYLATE SYNTHASE From Babesia Bovis At 2.35a Resolution Length = 511 Back     alignment and structure
>gi|301598514|pdb|3JSU|A Chain A, Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium Falciparum Dihydrofolate Reductase-Thymidylate Synthase(Pfdhfr-Ts) Complexed With Qn254, Nadph, And Dump Length = 608 Back     alignment and structure
>gi|78101608|pdb|2BLA|A Chain A, Sp21 Double Mutant P. Vivax Dihydrofolate Reductase In Complex With Pyrimethamine Length = 238 Back     alignment and structure
>gi|30749346|pdb|1J3J|A Chain A, Double Mutant (C59r+s108n) Plasmodium Falciparum Dihydrofolate Reductase-Thymidylate Synthase (Pfdhfr-Ts) Complexed With Pyrimethamine, Nadph, And Dump Length = 280 Back     alignment and structure
>gi|30749350|pdb|1J3K|A Chain A, Quadruple Mutant (N51i+c59r+s108n+i164l) Plasmodium Falciparum Dihydrofolate Reductase-Thymidylate Synthase (Pfdhfr-Ts) Complexed With Wr99210, Nadph, And Dump Length = 280 Back     alignment and structure
>gi|215261185|pdb|3CSE|A Chain A, Candida Glabrata Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-(3-(2,5-Dimethoxyphenyl)prop-1- Ynyl)-6-Ethylpyrimidine (Ucp120b) Length = 227 Back     alignment and structure
>gi|78101607|pdb|2BL9|A Chain A, X-Ray Crystal Structure Of Plasmodium Vivax Dihydrofolate Reductase In Complex With Pyrimethamine And Its Derivative Length = 238 Back     alignment and structure
gi|301598498|pdb|3INV|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate Synthase Complexed With Nadph, Dump And C-448 Antifolate Length = 521 Back     alignment and structure
>gi|30749342|pdb|1J3I|A Chain A, Wild-Type Plasmodium Falciparum Dihydrofolate Reductase- Thymidylate Synthase (Pfdhfr-Ts) Complexed With Wr99210, Nadph, And Dump Length = 280 Back     alignment and structure
>gi|178847032|pdb|2H2Q|A Chain A, Crystal Structure Of Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate Synthase Length = 521 Back     alignment and structure
>gi|2624564|pdb|1AI9|A Chain A, Candida Albicans Dihydrofolate Reductase Length = 192 Back     alignment and structure
gi|40889065|pdb|1JUV|A Chain A, Crystal Structure Analysis Of Dihydrofolate Reductase From Bacteriophage T4 Length = 193 Back     alignment and structure
>gi|7546295|pdb|1CZ3|A Chain A, Dihydrofolate Reductase From Thermotoga Maritima Length = 168 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target176 dihydrofolate reductase protein [Candidatus Liberibacte
3hj3_A 521 Chain A, crystal structure of DHFR; TS, enzyme, crossov 4e-47
3dl5_A 521 Dihydrofolate reductase, DHFR; enzyme active site mutan 9e-44
3nrr_A 515 Dihydrofolate reductase-thymidylate synthase; structura 2e-42
3jwk_A168 Dihydrofolate reductase; oxidoreductase; HET: NAP 5WB; 5e-42
3e0b_A166 Dihydrofolate reductase; oxidoreductase; HET: NAP N22; 2e-41
3jsu_A 608 Dihydrofolate reductase-thymidylate synthase; rossmann 4e-41
3ia4_A162 Dihydrofolate reductase; NADPH, methotrexate, oxidoredu 1e-40
3kjr_A 511 Dihydrofolate reductase/thymidylate synthase; microflui 1e-39
3ix9_A190 Dihydrofolate reductase; central beta sheet surrounded 1e-39
3irm_A 521 Bifunctional dihydrofolate reductase-thymidylate; DHFR- 3e-38
1zdr_A164 Dihydrofolate reductase; DHFR, NADP, oxidoreductase; 2. 1e-36
2h2q_A 521 Bifunctional dihydrofolate reductase-thymidylate syntha 2e-36
3dau_A159 Dihydrofolate reductase; oxidoreductase, pseudo-rossman 4e-36
2w9h_A159 DHFR, dihydrofolate reductase; NADP, trimethoprim, oxid 3e-35
3cse_A227 Dihydrofolate reductase; protein-ligand complex, oxidor 4e-35
2w3w_A167 Dihydrofolate reductase; nonclassical antifolates, one- 2e-34
1kmv_A186 DHFR, dihydrofolate reductase; oxidoreductase, antipara 2e-34
3dfr_A162 Dihydrofolate reductase; oxido-reductase; HET: NDP MTX; 4e-32
1vdr_A162 DHFR, dihydrofolate reductase; oxidoreductase, halophil 6e-32
1j3k_A280 Bifunctional dihydrofolate reductase-thymidylate syntha 2e-31
1juv_A193 DHFR, dihydrofolate reductase; complexed with NADPH, ox 2e-31
1df7_A159 DHFR, dihydrofolate reductase; structure-based inhibito 3e-31
2fzi_A206 Dihydrofolate reductase; trimethoprim derivatives, ring 2e-29
1aoe_A192 DHFR, dihydrofolate reductase; oxidoreductase, antifung 5e-29
2bl9_A238 Dihydrofolate reductase-thymidylate synthase; plamodium 7e-27
1cz3_A168 Dihydrofolate reductase; dimer, hyperthermophIle, oxido 2e-19
3jtw_A178 Dihydrofolate reductase; YP_805003.1, structural genomi 0.002
>3hj3_A Chain A, crystal structure of DHFR; TS, enzyme, crossover, non-active site, oxidoreductase; HET: UMP CB3 MTX NDP; 2.70A {Cryptosporidium hominis} PDB: 1qzf_A* 1sej_A* 3dl5_A* 3dl6_A* 2oip_A* Length = 521 Back     alignment and structure
 Score =  182 bits (463), Expect = 4e-47
 Identities = 49/182 (26%), Positives = 87/182 (47%), Gaps = 18/182 (9%)

Query: 1   MTRPEI-ILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTG-------NPVVMGYRTFQ 52
           M+   + I++AA   ++ IG  G +PW IS DLK F  +T         N ++MG +T+ 
Sbjct: 1   MSEKNVSIVVAASVLSSGIGINGQLPWSISEDLKFFSKITNNKCDSNKKNALIMGRKTWD 60

Query: 53  SIG-RLLPGRTNIIITRDNTRRASVNPEAVLASSILDSLD-LASKTGSKKIFIIGGGEIY 110
           SIG R L  R  ++I+  +  +   +P  V+  ++ DS++ L +    + IF+ GG  IY
Sbjct: 61  SIGRRPLKNRIIVVISS-SLPQDEADPNVVVFRNLEDSIENLMNDDSIENIFVCGGESIY 119

Query: 111 AQTIS--LAHTLYITHIEKE-IEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIY 167
              +       +Y+T +  E IE D +FP I          +   +     +    F+I+
Sbjct: 120 RDALKDNFVDRIYLTRVALEDIEFDTYFPEIPETFLPVYMSQTFCT----KNISYDFMIF 175

Query: 168 DR 169
           ++
Sbjct: 176 EK 177


>3dl5_A Dihydrofolate reductase, DHFR; enzyme active site mutant, enzyme-ligand complex, , oxidoreductase; HET: UMP CB3 DHF NDP; 2.74A {Cryptosporidium hominis} PDB: 3dl6_A* 1qzf_A* 1sej_A* 2oip_A* Length = 521 Back     alignment and structure
>3nrr_A Dihydrofolate reductase-thymidylate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, niaid, DHFR; HET: NAP D16 UMP; 1.80A {Babesia bovis} PDB: 3kjr_A* 3i3r_A* 3k2h_A* Length = 515 Back     alignment and structure
>3jwk_A Dihydrofolate reductase; oxidoreductase; HET: NAP 5WB; 2.08A {Bacillus anthracis} PDB: 3jw5_A* 3jwf_A* 3jwc_A* 3jvx_A* 3jwm_A* 3jw3_A* 3e0b_A* 3dat_A* 2qk8_A* 3fl8_A* 3fl9_A* 2kgk_A* Length = 168 Back     alignment and structure
>3e0b_A Dihydrofolate reductase; oxidoreductase; HET: NAP N22; 2.25A {Bacillus anthracis} PDB: 3dat_A* 2qk8_A* 3fl8_A* 3fl9_A* 2kgk_A* Length = 166 Back     alignment and structure
>3jsu_A Dihydrofolate reductase-thymidylate synthase; rossmann fold, oxidoreductase, transferase; HET: KA5 NDP UMP; 2.70A {Plasmodium falciparum} Length = 608 Back     alignment and structure
>3ia4_A Dihydrofolate reductase; NADPH, methotrexate, oxidoreductase; HET: NDP MTX; 1.70A {Moritella profunda} PDB: 3ia5_A Length = 162 Back     alignment and structure
>3kjr_A Dihydrofolate reductase/thymidylate synthase; microfluidics, slipchip,structural genomics, PSI-2, protein structure initiative; HET: NAP NHE; 1.95A {Babesia bovis T2BO} PDB: 3i3r_A* 3k2h_A* Length = 511 Back     alignment and structure
>3ix9_A Dihydrofolate reductase; central beta sheet surrounded by 4 alpha helices, oxidoreductase; HET: NDP MTX; 1.95A {Streptococcus pneumoniae} Length = 190 Back     alignment and structure
>3irm_A Bifunctional dihydrofolate reductase-thymidylate; DHFR-TS antifolate complex, methyltransfe multifunctional enzyme, NADP; HET: 1CY; 2.10A {Trypanosoma cruzi} PDB: 3inv_A* 3irn_A* 3iro_A* 2h2q_A* 3cl9_A* 3clb_A* 3hbb_A* 3kjs_A* Length = 521 Back     alignment and structure
>1zdr_A Dihydrofolate reductase; DHFR, NADP, oxidoreductase; 2.00A {Geobacillus stearothermophilus} Length = 164 Back     alignment and structure
>2h2q_A Bifunctional dihydrofolate reductase-thymidylate synthase; bifunctional enzyme in complex with NADP and DUMP, oxidoreductase, transferase; HET: NAP DU; 2.40A {Trypanosoma cruzi} PDB: 3cl9_A* 3clb_A* 3hbb_A* Length = 521 Back     alignment and structure
>3dau_A Dihydrofolate reductase; oxidoreductase, pseudo-rossmann fold, adenine nucleotide binding domain, antibiotic resistance; HET: MTX NAP; 1.50A {Escherichia coli K12} PDB: 1ddr_A* 1dds_A* 1ra9_A* 1dre_A* 1drh_A* 1dyi_A* 1dyh_A* 1jol_A* 1jom_A* 1ra1_A* 1dyj_A* 1ra3_A* 1ra8_A* 1ra2_A* 1rb2_A* 1rb3_A* 1rc4_A* 1rd7_A* 1re7_A* 1rf7_A* ... Length = 159 Back     alignment and structure
>2w9h_A DHFR, dihydrofolate reductase; NADP, trimethoprim, oxidoreductase, one-carbon metabolism; HET: TOP; 1.48A {Staphylococcus aureus} PDB: 2w9g_A* 3fyw_X* 3fyv_X* 3fy8_X* 3fy9_X* 3fq0_A* 3f0b_X* 3fqc_A* 3fqz_A* 3f0u_X* 3fqf_A* 3fqo_A* 3fqv_A* 2w9s_A* 2w9t_A Length = 159 Back     alignment and structure
>3cse_A Dihydrofolate reductase; protein-ligand complex, oxidoreductase; HET: NAP N22; 1.60A {Candida glabrata} PDB: 3eej_A* 3eek_A* 3eel_A* 3eem_A* Length = 227 Back     alignment and structure
>2w3w_A Dihydrofolate reductase; nonclassical antifolates, one-carbon metabolism, lipophilic antifolates, NADP, oxidoreductase; HET: VG9 NDP; 1.60A {Mycobacterium avium} PDB: 2w3v_A* Length = 167 Back     alignment and structure
>1kmv_A DHFR, dihydrofolate reductase; oxidoreductase, antiparasitic drugs, lipophilic antifolates; HET: LII NDP; 1.05A {Homo sapiens} SCOP: c.71.1.1 PDB: 1dhf_A* 1hfr_A* 1drf_A* 1kms_A* 1ohj_A* 1ohk_A* 1pd8_A* 1pd9_A* 1pdb_A 1s3u_A* 1s3v_A* 1s3w_A* 1u72_A* 1yho_A* 2c2s_A* 2c2t_A* 2dhf_A* 3ghw_A* 3fs6_A* 1mvs_A* ... Length = 186 Back     alignment and structure
>3dfr_A Dihydrofolate reductase; oxido-reductase; HET: NDP MTX; 1.70A {Lactobacillus casei} SCOP: c.71.1.1 PDB: 1ao8_A* 1bzf_A* 1dis_A* 1diu_A* 1lud_A* 2hm9_A* 2hqp_A* Length = 162 Back     alignment and structure
>1vdr_A DHFR, dihydrofolate reductase; oxidoreductase, halophilic enzyme; 2.55A {Haloferax volcanii} SCOP: c.71.1.1 PDB: 2ith_A 2jyb_A Length = 162 Back     alignment and structure
>1j3k_A Bifunctional dihydrofolate reductase-thymidylate synthase; oxidoreductase, transferase; HET: WRA NDP UMP; 2.10A {Plasmodium falciparum} SCOP: c.71.1.1 PDB: 3dg8_A* 1j3j_A* 1j3i_A* 3dga_A* Length = 280 Back     alignment and structure
>1juv_A DHFR, dihydrofolate reductase; complexed with NADPH, oxidoreductase; HET: NDP; 1.70A {Enterobacteria phage T4} SCOP: c.71.1.1 Length = 193 Back     alignment and structure
>1df7_A DHFR, dihydrofolate reductase; structure-based inhibitor design, folateanalogs, rossmann fold, nicotinamide adenine dinucleotide; HET: NDP MTX; 1.70A {Mycobacterium tuberculosis} SCOP: c.71.1.1 PDB: 1dg5_A* 1dg7_A* 1dg8_A* 2cig_A* Length = 159 Back     alignment and structure
>2fzi_A Dihydrofolate reductase; trimethoprim derivatives, ring stacking interactions, oxidoreductase; HET: NAP DH3; 1.60A {Pneumocystis carinii} SCOP: c.71.1.1 PDB: 1daj_A* 1cd2_A* 1e26_A* 1klk_A* 1ly3_A* 1ly4_A* 1s3y_A* 2cd2_A* 2fzh_A* 1dyr_A* 3cd2_A* 4cd2_A* 1vj3_A* Length = 206 Back     alignment and structure
>1aoe_A DHFR, dihydrofolate reductase; oxidoreductase, antifungal target; HET: NDP GW3; 1.60A {Candida albicans} SCOP: c.71.1.1 PDB: 1ai9_A* 1ia1_A* 1ia2_A* 1ia3_A* 1ia4_A* 1m78_A* 1m79_A* 1m7a_A* Length = 192 Back     alignment and structure
>2bl9_A Dihydrofolate reductase-thymidylate synthase; plamodium vivax, pyrimethamine, malaria, drug resistance, oxidoreductase; HET: NDP CP6; 1.9A {Plasmodium vivax} PDB: 2blb_A* 2blc_A* 2bla_A* Length = 238 Back     alignment and structure
>1cz3_A Dihydrofolate reductase; dimer, hyperthermophIle, oxidoreductase; 2.10A {Thermotoga maritima} SCOP: c.71.1.1 PDB: 1d1g_A* Length = 168 Back     alignment and structure
>3jtw_A Dihydrofolate reductase; YP_805003.1, structural genomics, joint center for structural genomics, JCSG; 1.90A {Pediococcus pentosaceus atcc 25745} Length = 178 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target176 dihydrofolate reductase protein [Candidatus Liberibacte
1zdr_A164 Dihydrofolate reductase; DHFR, NADP, oxidoreductase; 2. 100.0
3dfr_A162 Dihydrofolate reductase; oxido-reductase; HET: NDP MTX; 100.0
3ix9_A190 Dihydrofolate reductase; central beta sheet surrounded 100.0
3ia4_A162 Dihydrofolate reductase; NADPH, methotrexate, oxidoredu 100.0
3jwk_A168 Dihydrofolate reductase; oxidoreductase; HET: NAP 5WB; 100.0
2w9h_A159 DHFR, dihydrofolate reductase; NADP, trimethoprim, oxid 100.0
3dau_A159 Dihydrofolate reductase; oxidoreductase, pseudo-rossman 100.0
2w3w_A167 Dihydrofolate reductase; nonclassical antifolates, one- 100.0
2fzi_A206 Dihydrofolate reductase; trimethoprim derivatives, ring 100.0
1vdr_A162 DHFR, dihydrofolate reductase; oxidoreductase, halophil 100.0
3hj3_A 521 Chain A, crystal structure of DHFR; TS, enzyme, crossov 100.0
1j3k_A280 Bifunctional dihydrofolate reductase-thymidylate syntha 100.0
3nrr_A 515 Dihydrofolate reductase-thymidylate synthase; structura 100.0
1aoe_A192 DHFR, dihydrofolate reductase; oxidoreductase, antifung 100.0
3jsu_A 608 Dihydrofolate reductase-thymidylate synthase; rossmann 100.0
1kmv_A186 DHFR, dihydrofolate reductase; oxidoreductase, antipara 100.0
1df7_A159 DHFR, dihydrofolate reductase; structure-based inhibito 100.0
3cse_A227 Dihydrofolate reductase; protein-ligand complex, oxidor 100.0
2bl9_A238 Dihydrofolate reductase-thymidylate synthase; plamodium 100.0
1juv_A193 DHFR, dihydrofolate reductase; complexed with NADPH, ox 100.0
1cz3_A168 Dihydrofolate reductase; dimer, hyperthermophIle, oxido 100.0
3jtw_A178 Dihydrofolate reductase; YP_805003.1, structural genomi 99.84
2gd9_A189 Hypothetical protein YYAP; 2636623, structural genomics 99.57
3ky8_A197 Putative riboflavin biosynthesis protein; structural ge 99.52
3kgy_A231 Bifunctional deaminase-reductase domain protein; putati 98.77
2p4g_A270 Hypothetical protein; pyrimidine reductase-like protein 98.62
3irm_A 521 Bifunctional dihydrofolate reductase-thymidylate; DHFR- 100.0
2azn_A219 HTP reductase, putative 5-amino-6-(5-phosphoribosylamin 98.79
2hxv_A360 Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 97.93
2g6v_A402 Riboflavin biosynthesis protein RIBD; RIBD APO structur 97.86
2b3z_A373 Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, 97.7
>1zdr_A Dihydrofolate reductase; DHFR, NADP, oxidoreductase; 2.00A {Geobacillus stearothermophilus} Back     alignment and structure
Probab=100.00  E-value=0  Score=367.43  Aligned_cols=164  Identities=34%  Similarity=0.656  Sum_probs=149.9

Q ss_pred             CEEEEEEECCCCEEEECCCCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCEEEEEEECCCCCCCCCCCEEEEC
Q ss_conf             19999997179768562676877889999999970898799971111343456689638999214774345689859990
Q gi|254780957|r    5 EIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPGRTNIIITRDNTRRASVNPEAVLAS   84 (176)
Q Consensus         5 ~i~~I~A~~~n~~IG~~~~lPW~~~~Dl~~Fk~~T~~~~vimGrkT~~sl~~pLp~R~niVlTr~~~~~~~~~~~~~~~~   84 (176)
                      +|++|||+++||+||++|+||||+|+||+|||++|+|++||||||||+|||+|||+|.||||||+.....   .....+.
T Consensus         1 mi~~I~A~~~n~~IG~~~~lPW~~~~Dl~~Fk~~T~~~~viMGRkT~esi~~pL~~R~niVls~~~~~~~---~~~~~~~   77 (164)
T 1zdr_A            1 MISHIVAMDENRVIGKDNRLPWHLPADLAYFKRVTMGHAIVMGRKTFEAIGRPLPGRDNVVVTGNRSFRP---EGCLVLH   77 (164)
T ss_dssp             CEEEEEEEETTCEEEBTTBCSSCCHHHHHHHHHHHTTSEEEEEHHHHHHHCSCCTTSEEEEECSCTTCCC---TTCEEEC
T ss_pred             CEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCHHHHHHHCCCCCCEEEEECCCCCCC---CCCEEEC
T ss_conf             9799999989997828996165588999999986589789996426576654177883599860322235---6530113


Q ss_pred             CHHHHHHHHCCCCCCEEEEECHHHHHHHHHHHCCEEEEEEECCCCCCCEECCCCCHHHEEEEEEEEEECCCCCCCCCEEE
Q ss_conf             18898876323798459997108899874200589999877386278476657895560898566510268888873699
Q gi|254780957|r   85 SILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYITHIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRF  164 (176)
Q Consensus        85 s~~~al~~~~~~~~~~i~IIGG~~IY~~~l~~~d~l~iT~I~~~~egD~~fP~id~~~~~~~~~~~~~~~~e~n~~~y~f  164 (176)
                      ++++++... +...++||||||++||++++++||+||||+|+.+++||+|||+++.+.|++++++. ...+++|+++|+|
T Consensus        78 ~~~~~~~~~-~~~~~~i~IiGG~~iY~~~l~~~~~i~lT~I~~~~egD~~FP~~~~~~~~~~~~~~-~~~de~n~~~y~f  155 (164)
T 1zdr_A           78 SLEEVKQWI-ASRADEVFIIGGAELFRATMPIVDRLYVTKIFASFPGDTFYPPISDDEWEIVSYTP-GGKDEKNPYEHAF  155 (164)
T ss_dssp             SHHHHHHHH-HTCCSCEEEEECHHHHHHHGGGCCEEEEEEESSCCCCSEECCCCCTTTEEEEEEEE-CCCSSSSCSCEEE
T ss_pred             CHHHHHHHH-HCCCCCEEEECCHHHHHHHHHHCCEEEEEEECCCCCCCEECCCCCHHHCEEEEEEE-CCCCCCCCCCEEE
T ss_conf             689999997-43787389945489999998752699999976453677678889867889999887-6767889974799


Q ss_pred             EEEEEECCC
Q ss_conf             999980123
Q gi|254780957|r  165 VIYDRFLSK  173 (176)
Q Consensus       165 ~~y~R~~~~  173 (176)
                      ++|+|+.+|
T Consensus       156 ~~y~Rk~~~  164 (164)
T 1zdr_A          156 IIYERKKAK  164 (164)
T ss_dssp             EEEEEC---
T ss_pred             EEEEEECCC
T ss_conf             999971579



>3dfr_A Dihydrofolate reductase; oxido-reductase; HET: NDP MTX; 1.70A {Lactobacillus casei} SCOP: c.71.1.1 PDB: 1ao8_A* 1bzf_A* 1dis_A* 1diu_A* 1lud_A* 2hm9_A* 2hqp_A* Back     alignment and structure
>3ix9_A Dihydrofolate reductase; central beta sheet surrounded by 4 alpha helices, oxidoreductase; HET: NDP MTX; 1.95A {Streptococcus pneumoniae} Back     alignment and structure
>3ia4_A Dihydrofolate reductase; NADPH, methotrexate, oxidoreductase; HET: NDP MTX; 1.70A {Moritella profunda} PDB: 3ia5_A 2zza_A* Back     alignment and structure
>3jwk_A Dihydrofolate reductase; oxidoreductase; HET: NAP 5WB; 2.08A {Bacillus anthracis} PDB: 3jw5_A* 3jwf_A* 3jwc_A* 3jvx_A* 3jwm_A* 3jw3_A* 3e0b_A* 3dat_A* 2qk8_A* 3fl8_A* 3fl9_A* 2kgk_A* Back     alignment and structure
>2w9h_A DHFR, dihydrofolate reductase; NADP, trimethoprim, oxidoreductase, one-carbon metabolism; HET: TOP; 1.48A {Staphylococcus aureus} PDB: 2w9g_A* 3frd_X* 3fre_X* 3frf_X* 3fyv_X* 3fyw_X* 3frb_X* 3fra_X* 3fy8_X* 3fy9_X* 3fq0_A* 3f0b_X* 3f0s_X* 3f0q_X* 3fqc_A* 3fqz_A* 3m08_A* 3f0u_X* 3f0v_X* 3f0x_X* ... Back     alignment and structure
>3dau_A Dihydrofolate reductase; oxidoreductase, pseudo-rossmann fold, adenine nucleotide binding domain, antibiotic resistance; HET: MTX NAP; 1.50A {Escherichia coli K12} PDB: 1ddr_A* 1dds_A* 3k74_A 1ra9_A* 1dre_A* 1drh_A* 1dyi_A* 1dyh_A* 1jol_A* 1jom_A* 1ra1_A* 1dyj_A* 1ra3_A* 1ra8_A* 1ra2_A* 1rb2_A* 1rb3_A* 1rc4_A* 1rd7_A* 1re7_A* ... Back     alignment and structure
>2w3w_A Dihydrofolate reductase; nonclassical antifolates, one-carbon metabolism, lipophilic antifolates, NADP, oxidoreductase; HET: VG9 NDP; 1.60A {Mycobacterium avium} PDB: 2w3v_A* Back     alignment and structure
>2fzi_A Dihydrofolate reductase; trimethoprim derivatives, ring stacking interactions, oxidoreductase; HET: NAP DH3; 1.60A {Pneumocystis carinii} SCOP: c.71.1.1 PDB: 1daj_A* 1cd2_A* 1e26_A* 1klk_A* 1ly3_A* 1ly4_A* 1s3y_A* 2cd2_A* 2fzh_A* 1dyr_A* 3cd2_A* 4cd2_A* 1vj3_A* Back     alignment and structure
>1vdr_A DHFR, dihydrofolate reductase; oxidoreductase, halophilic enzyme; 2.55A {Haloferax volcanii} SCOP: c.71.1.1 PDB: 2ith_A 2jyb_A Back     alignment and structure
>3hj3_A Chain A, crystal structure of DHFR; TS, enzyme, crossover, non-active site, oxidoreductase; HET: UMP CB3 MTX NDP; 2.70A {Cryptosporidium hominis} PDB: 1qzf_A* 1sej_A* 3dl5_A* 3dl6_A* 2oip_A* Back     alignment and structure
>1j3k_A Bifunctional dihydrofolate reductase-thymidylate synthase; oxidoreductase, transferase; HET: WRA NDP UMP; 2.10A {Plasmodium falciparum} SCOP: c.71.1.1 PDB: 3dg8_A* 1j3j_A* 1j3i_A* 3dga_A* Back     alignment and structure
>3nrr_A Dihydrofolate reductase-thymidylate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, niaid, DHFR; HET: NAP D16 UMP; 1.80A {Babesia bovis} PDB: 3kjr_A* 3i3r_A* 3k2h_A* Back     alignment and structure
>1aoe_A DHFR, dihydrofolate reductase; oxidoreductase, antifungal target; HET: NDP GW3; 1.60A {Candida albicans} SCOP: c.71.1.1 PDB: 1ai9_A* 1ia1_A* 1ia2_A* 1ia3_A* 1ia4_A* 1m78_A* 1m79_A* 1m7a_A* Back     alignment and structure
>3jsu_A Dihydrofolate reductase-thymidylate synthase; rossmann fold, oxidoreductase, transferase; HET: KA5 NDP UMP; 2.70A {Plasmodium falciparum} Back     alignment and structure
>1kmv_A DHFR, dihydrofolate reductase; oxidoreductase, antiparasitic drugs, lipophilic antifolates; HET: LII NDP; 1.05A {Homo sapiens} SCOP: c.71.1.1 PDB: 1dhf_A* 1hfr_A* 1drf_A* 1kms_A* 1ohj_A* 1ohk_A* 1pd8_A* 1pd9_A* 1pdb_A 1s3u_A* 1s3v_A* 1s3w_A* 1u72_A* 1yho_A* 2c2s_A* 2c2t_A* 2dhf_A* 3ghw_A* 3fs6_A* 1mvs_A* ... Back     alignment and structure
>1df7_A DHFR, dihydrofolate reductase; structure-based inhibitor design, folateanalogs, rossmann fold, nicotinamide adenine dinucleotide; HET: NDP MTX; 1.70A {Mycobacterium tuberculosis} SCOP: c.71.1.1 PDB: 1dg5_A* 1dg7_A* 1dg8_A* 2cig_A* Back     alignment and structure
>3cse_A Dihydrofolate reductase; protein-ligand complex, oxidoreductase; HET: NAP N22; 1.60A {Candida glabrata} PDB: 3eej_A* 3eek_A* 3eel_A* 3eem_A* Back     alignment and structure
>2bl9_A Dihydrofolate reductase-thymidylate synthase; plamodium vivax, pyrimethamine, malaria, drug resistance, oxidoreductase; HET: NDP CP6; 1.9A {Plasmodium vivax} PDB: 2blb_A* 2blc_A* 2bla_A* Back     alignment and structure
>1juv_A DHFR, dihydrofolate reductase; complexed with NADPH, oxidoreductase; HET: NDP; 1.70A {Enterobacteria phage T4} SCOP: c.71.1.1 Back     alignment and structure
>1cz3_A Dihydrofolate reductase; dimer, hyperthermophIle, oxidoreductase; 2.10A {Thermotoga maritima} SCOP: c.71.1.1 PDB: 1d1g_A* Back     alignment and structure
>3jtw_A Dihydrofolate reductase; YP_805003.1, structural genomics, joint center for structural genomics, JCSG; 1.90A {Pediococcus pentosaceus atcc 25745} Back     alignment and structure
>2gd9_A Hypothetical protein YYAP; 2636623, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ky8_A Putative riboflavin biosynthesis protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL; 2.12A {Shewanella loihica} Back     alignment and structure
>3kgy_A Bifunctional deaminase-reductase domain protein; putative dihydrofolate reductase, structural genomics; HET: MSE NDP; 1.50A {Chloroflexus aurantiacus j-10-fl} Back     alignment and structure
>2p4g_A Hypothetical protein; pyrimidine reductase-like protein, structural genomics, JOIN for structural genomics; 2.30A {Corynebacterium diphtheriae nctc 13129ORGANISM_TAXID} Back     alignment and structure
>3irm_A Bifunctional dihydrofolate reductase-thymidylate; DHFR-TS antifolate complex, methyltransfe multifunctional enzyme, NADP; HET: 1CY; 2.10A {Trypanosoma cruzi} PDB: 3inv_A* 3irn_A* 3iro_A* 2h2q_A* 3cl9_A* 3clb_A* 3hbb_A* 3kjs_A* Back     alignment and structure
>2azn_A HTP reductase, putative 5-amino-6-(5-phosphoribosylamino)uracil reductase; oxidoreductase; HET: MA5 NAP EPE; 2.70A {Methanocaldococcus jannaschii} SCOP: c.71.1.2 Back     alignment and structure
>2hxv_A Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil...; TM1828, structural genomics, PSI-2; HET: NDP; 1.80A {Thermotoga maritima} SCOP: c.71.1.2 c.97.1.2 Back     alignment and structure
>2g6v_A Riboflavin biosynthesis protein RIBD; RIBD APO structure, structural genomics, structural proteomics in europe, spine, hydrolase; 2.60A {Escherichia coli} PDB: 2obc_A* 2o7p_A* Back     alignment and structure
>2b3z_A Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, deaminase domain and reductase domain, hydrolase, oxidoreductase; 2.41A {Bacillus subtilis} SCOP: c.71.1.2 c.97.1.2 PDB: 2d5n_A* 3ex8_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 176 dihydrofolate reductase protein [Candidatus Liberibacte
d1ra9a_159 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type 3e-36
d1vdra_157 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type 1e-33
d3dfra_162 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type 3e-32
d1juva_193 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type 1e-30
d1kmva_186 c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type 1e-30
d1seja1178 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate re 6e-30
d1df7a_159 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type 8e-30
d1aoea_192 c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type 1e-29
d2fzia1206 c.71.1.1 (A:1-206) Dihydrofolate reductases, eukaryotic 1e-29
d1j3ka_231 c.71.1.1 (A:) Bifunctional enzyme dihydrofolate reducta 1e-26
d1d1ga_164 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type 7e-19
>d1ra9a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]} Length = 159 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Dihydrofolate reductase-like
superfamily: Dihydrofolate reductase-like
family: Dihydrofolate reductases
domain: Dihydrofolate reductase, prokaryotic type
species: Escherichia coli [TaxId: 562]
 Score =  145 bits (366), Expect = 3e-36
 Identities = 60/164 (36%), Positives = 84/164 (51%), Gaps = 7/164 (4%)

Query: 6   IILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPGRTNII 65
           I LIAA+  + VIG    MPW + +DL  FK  T   PV+MG  T++SIGR LPGR NII
Sbjct: 2   ISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNII 61

Query: 66  ITRDNTRRASVNPEAVLASSILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYITHI 125
           ++           + V     +D    A      +I +IGGG +Y Q +  A  LY+THI
Sbjct: 62  LSSQ-----PGTDDRVTWVKSVDEAIAACGD-VPEIMVIGGGRVYEQFLPKAQKLYLTHI 115

Query: 126 EKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRFVIYDR 169
           + E+EGD  FP  + + W+    E    A   + +   F I +R
Sbjct: 116 DAEVEGDTHFPDYEPDDWESVFSEFH-DADAQNSHSYCFEILER 158


>d1vdra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]} Length = 157 Back     information, alignment and structure
>d3dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei [TaxId: 1582]} Length = 162 Back     information, alignment and structure
>d1juva_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Bacteriophage T4 [TaxId: 10665]} Length = 193 Back     information, alignment and structure
>d1kmva_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1seja1 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]} Length = 178 Back     information, alignment and structure
>d1df7a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Mycobacterium tuberculosis [TaxId: 1773]} Length = 159 Back     information, alignment and structure
>d1aoea_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]} Length = 192 Back     information, alignment and structure
>d2fzia1 c.71.1.1 (A:1-206) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]} Length = 206 Back     information, alignment and structure
>d1j3ka_ c.71.1.1 (A:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 231 Back     information, alignment and structure
>d1d1ga_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]} Length = 164 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target176 dihydrofolate reductase protein [Candidatus Liberibacte
d1ra9a_159 Dihydrofolate reductase, prokaryotic type {Escherichia 100.0
d3dfra_162 Dihydrofolate reductase, prokaryotic type {Lactobacillu 100.0
d2fzia1206 Dihydrofolate reductases, eukaryotic type {Fungus (Pneu 100.0
d1vdra_157 Dihydrofolate reductase, prokaryotic type {Haloferax vo 100.0
d1aoea_192 Dihydrofolate reductases, eukaryotic type {Yeast (Candi 100.0
d1df7a_159 Dihydrofolate reductase, prokaryotic type {Mycobacteriu 100.0
d1kmva_186 Dihydrofolate reductases, eukaryotic type {Human (Homo 100.0
d1j3ka_231 Bifunctional enzyme dihydrofolate reductase-thymidylate 100.0
d1seja1178 Bifunctional enzyme dihydrofolate reductase-thymidylate 100.0
d1juva_193 Dihydrofolate reductase, prokaryotic type {Bacteriophag 100.0
d1d1ga_164 Dihydrofolate reductase, prokaryotic type {Thermotoga m 100.0
d2hxva1198 Riboflavin biosynthesis protein RibD {Thermotoga mariti 98.87
d2azna1219 HTP reductase {Methanococcus jannaschii [TaxId: 2190]} 98.79
d2b3za1214 Riboflavin biosynthesis protein RibD {Bacillus subtilis 98.33
>d1ra9a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Dihydrofolate reductase-like
superfamily: Dihydrofolate reductase-like
family: Dihydrofolate reductases
domain: Dihydrofolate reductase, prokaryotic type
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=358.44  Aligned_cols=159  Identities=36%  Similarity=0.645  Sum_probs=144.8

Q ss_pred             CEEEEEEECCCCEEEECCCCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCEEEEEEECCCCCCCCCCCEEEEC
Q ss_conf             19999997179768562676877889999999970898799971111343456689638999214774345689859990
Q gi|254780957|r    5 EIILIAAITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRLLPGRTNIIITRDNTRRASVNPEAVLAS   84 (176)
Q Consensus         5 ~i~~I~A~~~n~~IG~~~~lPW~~~~Dl~~Fk~~T~~~~vimGrkT~~sl~~pLp~R~niVlTr~~~~~~~~~~~~~~~~   84 (176)
                      +|++|||+++||+||++|+|||++|+||+|||++|+|++||||||||+|||+|||+|.||||||+....    +.+.+..
T Consensus         1 mi~~I~A~~~~~~IG~~~~lPW~~~~Dl~~Fk~~T~~~~viMGrkT~esl~~~Lp~R~niVls~~~~~~----~~~~~~~   76 (159)
T d1ra9a_           1 MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTD----DRVTWVK   76 (159)
T ss_dssp             CEEEEEEECGGGEEECSSCCSCCCHHHHHHHHHHHTTSCEEEEHHHHHHHCSCCTTSCEEEECSSCCSC----TTSEEES
T ss_pred             CEEEEEEECCCCCEECCCCCCEECHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCCCCEEEEEECCCCC----CCCCCHH
T ss_conf             989999997999450799515148999999885148977998151835546537998129985067754----3200013


Q ss_pred             CHHHHHHHHCCCCCCEEEEECHHHHHHHHHHHCCEEEEEEECCCCCCCEECCCCCHHHEEEEEEEEEECCCCCCCCCEEE
Q ss_conf             18898876323798459997108899874200589999877386278476657895560898566510268888873699
Q gi|254780957|r   85 SILDSLDLASKTGSKKIFIIGGGEIYAQTISLAHTLYITHIEKEIEGDVFFPSIDSNIWKKQEKEIITSAGEGDDYPTRF  164 (176)
Q Consensus        85 s~~~al~~~~~~~~~~i~IIGG~~IY~~~l~~~d~l~iT~I~~~~egD~~fP~id~~~~~~~~~~~~~~~~e~n~~~y~f  164 (176)
                      ++++++....  ..++||||||++||++++++||++|+|+|+.+|+||+|||+++.+.|+++.++. ...+++|+++|+|
T Consensus        77 ~~~~~~~~~~--~~~~i~ViGG~~IY~~~l~~~d~i~lT~I~~~~egD~~FP~~d~~~w~~v~~~~-~~~~~~~~~~y~f  153 (159)
T d1ra9a_          77 SVDEAIAACG--DVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEF-HDADAQNSHSYCF  153 (159)
T ss_dssp             SHHHHHHTTC--SCSCEEECCCHHHHHHHGGGCSEEEEEEECCCCCCSEECCCCCGGGEEEEEEEE-ECCCSSCSSCEEE
T ss_pred             HHHHHHHHHH--CCCCEEEECCCHHHHHHHHHCCEEEEEEECCCCCCCEECCCCCHHHCEEEEEEE-CCCCCCCCCCEEE
T ss_conf             2788999860--687439976805999886550789999847642684468999868989999997-2667789986799


Q ss_pred             EEEEEE
Q ss_conf             999980
Q gi|254780957|r  165 VIYDRF  170 (176)
Q Consensus       165 ~~y~R~  170 (176)
                      ++|+|+
T Consensus       154 ~~y~RK  159 (159)
T d1ra9a_         154 EILERR  159 (159)
T ss_dssp             EEEEEC
T ss_pred             EEEECC
T ss_conf             999869



>d3dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2fzia1 c.71.1.1 (A:1-206) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]} Back     information, alignment and structure
>d1vdra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]} Back     information, alignment and structure
>d1aoea_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1df7a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kmva_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ka_ c.71.1.1 (A:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1seja1 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]} Back     information, alignment and structure
>d1juva_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1d1ga_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hxva1 c.71.1.2 (A:148-345) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2azna1 c.71.1.2 (A:6-224) HTP reductase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2b3za1 c.71.1.2 (A:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 176 dihydrofolate reductase protein [Candidatus Liberi
3dau_A_159 (A:) Dihydrofolate reductase; oxidoreductase, pseu 2e-37
1zdr_A_