254780959

254780959

putative hydrolase serine protease transmembrane protein

GeneID in NCBI database:8209981Locus tag:CLIBASIA_04290
Protein GI in NCBI database:254780959Protein Accession:YP_003065372.1
Gene range:+(955426, 956334)Protein Length:302aa
Gene description:putative hydrolase serine protease transmembrane protein
COG prediction:[O] Membrane protease subunits, stomatin/prohibitin homologs
KEGG prediction:putative hydrolase serine protease transmembrane protein; K04087 membrane protease subunit HflC [EC:3.4.-.-]
SEED prediction:HflC protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Hfl operon
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MSNKSCISFFLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEARRDSEINYGKGEAERGRILSNVFQKDPEFFEFYRSMRAYTDSLASSDTFLVLSPDSDFFKYFDRFQERQKNYRKEY
ccccHHHHHHHHHHHHHHHHHccEEEccccEEEEEEEccEEEEEEccccEEEEcccccccEEEEEEEEEEEEEEcccccEEEcccccEEEEEEEEEEEEccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHccccccHHHHHcc
cccHHHHHHHHHHHHHHHHHHccEEEEccccEEEEEEccEEEEEEEccccEEEccccHHHHHHHHHHHHHHHHcccccccEEEcccccEEEEcEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHcccccccccccccc
MSNKSCISFFLFIFLLLglsfssffIVDARQQAIVTRFGKIhatyrepgiyfkmpfsfmNVDRVKYLQKQIMRLNLDNIrvqvsdgkfyeVDAMMtyriidpslfcqsvscDRIAAESRLRTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEArrdseinygkgeaergrILSNVFQKDPEFFEFYRSMRaytdslassdtflvlspdsdffKYFDRFQERQKNYRKEY
MSNKSCISFFLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAesrlrtrldasirrvyglrrfddalskqREKMMMEVCEDLRYDAEKLGisiedvrvlrtdltqevsqqtydrMKAERLAEAEFirargreegqkrmsiadrkatqilsearrdseinygkgeaergrilsnvfQKDPEFFEFYRSMRAYTDSLASSDTFLVLSPDSDFFKYFDRFQERQKNYRKEY
MSNKscisfflfiflllglsfssffiVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEARRDSEINYGKGEAERGRILSNVFQKDPEFFEFYRSMRAYTDSLASSDTFLVLSPDSDFFKYFDRFQERQKNYRKEY
****SCI*FFLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERL********************ADRKATQILSEARRDSEINYGKGEAERGRILSNVFQKDPEFFEFYRSMRAYTDSLASSDTFLVLSPDSDFF*****************
MSNKSCISFFLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRARG**********ADRKATQILSEARRDSEINYGKGEAERGRILSNVFQKDPEFFEFYRSMRAYTDSLASSDTFLVLSPDSDFFKYFDRFQERQKNYRKEY
*SNKSCISFFLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEARRDSEINYGKGEAERGRILSNVFQKDPEFFEFYRSMRAYTDSLASSDTFLVLSPDSDFFKYFDRFQE*********
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MSNKSCISFFLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEARRDSEINYGKGEAERGRILSNVFQKDPEFFEFYRSMRAYTDSLASSDTFLVLSPDSDFFKYFDRFQERQKNYRKEY
MSNKSCISFFLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEARRDSEINYGKGEAERGRILSNVFQKDPEFFEFYRSMRAYTDSLASSDTFLVLSPDSDFFKYFDRFQERQKNYRKEY
MSNKSCISFFLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEARRDSEINYGKGEAERGRILSNVFQKDPEFFEFYRSMRAYTDSLASSDTFLVLSPDSDFFKYFDRFQERQKNYRKEY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target302 putative hydrolase serine protease transmembrane protei
254780958355 HflK protein [Candidatus Liberibacter asiaticus st 3e-05
254780872254 3-demethylubiquinone-9 3-methyltransferase [Candid 0.024
>gi|254780958|ref|YP_003065371.1| HflK protein [Candidatus Liberibacter asiaticus str. psy62] Length = 355 Back     alignment
 Score = 40.8 bits (94), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 107/243 (44%), Gaps = 21/243 (8%)

Query: 12  FIFLLLG--LSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQK 69
            I LL+G   +F S +IV   ++A+  RFGK       PG++  M +    V+ VK +++
Sbjct: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIVKVIER 113

Query: 70  QIMRLNLDNIRVQVSDGKFYEVDAMMT-------YRIIDPSLFCQSVSCDRIAAESRLRT 122
           Q  ++   +  V  + G     D  +        Y + DP L+  ++          L+ 
Sbjct: 114 Q-QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN----PGETLKQ 168

Query: 123 RLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLR--YDAEKLGISIEDVRVLRTDLTQE 180
             ++++R V G R   D    QR+++ +EV   ++   D  K GI I  + +      +E
Sbjct: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228

Query: 181 VSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQI--LSEARRDSEINYGKGE 238
           V+   +D ++     E  F+    +    + +  A  +A+ I   S A +D  I   +GE
Sbjct: 229 VA-DAFDEVQRAEQDEDRFVEESNKYS-NRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286

Query: 239 AER 241
           A+R
Sbjct: 287 ADR 289

>gi|254780872|ref|YP_003065285.1| 3-demethylubiquinone-9 3-methyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Back     alignment
 Score = 31.2 bits (69), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 29 ARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMR 73
           + Q  + +F  I + + EP   FK P   +N  R+KY+Q +IM+
Sbjct: 10 TKNQDAINQFSNIASEWWEPTGKFK-PLHQINPVRIKYIQDKIMQ 53

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target302 putative hydrolase serine protease transmembrane protei
315122499301 putative hydrolase serine protease transmembrane protei 1 1e-133
227822571310 putative transmembrane serine protease [Sinorhizobium f 1 3e-99
15965876310 putative hydrolase serine protease transmembrane protei 1 2e-96
150397218310 HflC protein [Sinorhizobium medicae WSM419] Length = 31 1 6e-96
222086376304 hydrolase serine protease transmembrane subunit C prote 1 8e-94
325293412307 hflC protein [Agrobacterium sp. H13-3] Length = 307 1 4e-93
15889331307 HFLC protein [Agrobacterium tumefaciens str. C58] Lengt 1 8e-93
222149080305 HFLC protein [Agrobacterium vitis S4] Length = 305 1 1e-92
116252996321 transmembrane serine protease [Rhizobium leguminosarum 1 1e-91
241205503321 HflC protein [Rhizobium leguminosarum bv. trifolii WSM1 1 1e-90
>gi|315122499|ref|YP_004062988.1| putative hydrolase serine protease transmembrane protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 301 Back     alignment and organism information
 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/300 (77%), Positives = 266/300 (88%)

Query: 1   MSNKSCISFFLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMN 60
           +  +S I F L   LL+GLS +SFF+V+ R+QA+V RFGKI + Y EPGIYFKMPFSF+N
Sbjct: 2   IEKRSYIVFLLIFSLLVGLSLTSFFVVNVREQAVVIRFGKISSVYNEPGIYFKMPFSFLN 61

Query: 61  VDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRL 120
            DRV+YLQKQI+ LNLD+IRVQV+DGKFY++DAMM +RI+DP LFCQSVSCDRI AE+RL
Sbjct: 62  FDRVQYLQKQILSLNLDSIRVQVADGKFYQIDAMMAHRIVDPVLFCQSVSCDRIIAEARL 121

Query: 121 RTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQE 180
           RTRLDA++RRVYGLRRF+DALSKQRE MM EV +DLR DAEKLGISIEDVRV RTDLTQE
Sbjct: 122 RTRLDAALRRVYGLRRFNDALSKQREVMMREVRDDLRLDAEKLGISIEDVRVRRTDLTQE 181

Query: 181 VSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEARRDSEINYGKGEAE 240
           VS+QTYDRMKAERLAE+E IRARGREEGQ+RMSIADRKATQIL+EARR SE+NYG+GEAE
Sbjct: 182 VSKQTYDRMKAERLAESELIRARGREEGQRRMSIADRKATQILAEARRYSEVNYGQGEAE 241

Query: 241 RGRILSNVFQKDPEFFEFYRSMRAYTDSLASSDTFLVLSPDSDFFKYFDRFQERQKNYRK 300
           R RILS VF+KDPEFFEFYRSM+AY +SL SSDTF VLSPDSDFFKYFDR QE++ N +K
Sbjct: 242 RERILSAVFKKDPEFFEFYRSMKAYANSLNSSDTFFVLSPDSDFFKYFDRSQEKETNSKK 301


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822571|ref|YP_002826543.1| putative transmembrane serine protease [Sinorhizobium fredii NGR234] Length = 310 Back     alignment and organism information
>gi|15965876|ref|NP_386229.1| putative hydrolase serine protease transmembrane protein [Sinorhizobium meliloti 1021] Length = 310 Back     alignment and organism information
>gi|150397218|ref|YP_001327685.1| HflC protein [Sinorhizobium medicae WSM419] Length = 310 Back     alignment and organism information
>gi|222086376|ref|YP_002544910.1| hydrolase serine protease transmembrane subunit C protein [Agrobacterium radiobacter K84] Length = 304 Back     alignment and organism information
>gi|325293412|ref|YP_004279276.1| hflC protein [Agrobacterium sp. H13-3] Length = 307 Back     alignment and organism information
>gi|15889331|ref|NP_355012.1| HFLC protein [Agrobacterium tumefaciens str. C58] Length = 307 Back     alignment and organism information
>gi|222149080|ref|YP_002550037.1| HFLC protein [Agrobacterium vitis S4] Length = 305 Back     alignment and organism information
>gi|116252996|ref|YP_768834.1| transmembrane serine protease [Rhizobium leguminosarum bv. viciae 3841] Length = 321 Back     alignment and organism information
>gi|241205503|ref|YP_002976599.1| HflC protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 321 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target302 putative hydrolase serine protease transmembrane protei
COG0330291 COG0330, HflC, Membrane protease subunits, stomatin/pro 5e-43
TIGR01932317 TIGR01932, hflC, HflC protein 9e-40
PRK11029334 PRK11029, PRK11029, FtsH protease regulator HflC; Provi 3e-36
cd03404266 cd03404, Band_7_HflK, Band_7_HflK: The band 7 domain of 1e-20
TIGR01933261 TIGR01933, hflK, HflK protein 2e-18
cd03405242 cd03405, Band_7_HflC, Band_7_HflC: The band 7 domain of 2e-62
pfam01145177 pfam01145, Band_7, SPFH domain / Band 7 family 6e-21
smart00244160 smart00244, PHB, prohibitin homologues 7e-17
cd03403215 cd03403, Band_7_stomatin_like, Band_7_stomatin_like: A 2e-15
KOG2621288 KOG2621, KOG2621, KOG2621, Prohibitins and stomatins of 6e-09
cd03402219 cd03402, Band_7_2, A subgroup of the band 7 domain of f 4e-08
cd03408207 cd03408, Band_7_5, A subgroup of the band 7 domain of f 7e-04
KOG2620301 KOG2620, KOG2620, KOG2620, Prohibitins and stomatins of 3e-11
PRK10930419 PRK10930, PRK10930, FtsH protease regulator HflK; Provi 4e-06
cd03407262 cd03407, Band_7_4, A subgroup of the band 7 domain of f 7e-04
cd02106121 cd02106, Band_7, The band 7 domain of flotillin (reggie 3e-10
>gnl|CDD|30678 COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162612 TIGR01932, hflC, HflC protein Back     alignment and domain information
>gnl|CDD|182913 PRK11029, PRK11029, FtsH protease regulator HflC; Provisional Back     alignment and domain information
>gnl|CDD|48216 cd03404, Band_7_HflK, Band_7_HflK: The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>gnl|CDD|130988 TIGR01933, hflK, HflK protein Back     alignment and domain information
>gnl|CDD|48217 cd03405, Band_7_HflC, Band_7_HflC: The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>gnl|CDD|144658 pfam01145, Band_7, SPFH domain / Band 7 family Back     alignment and domain information
>gnl|CDD|128540 smart00244, PHB, prohibitin homologues Back     alignment and domain information
>gnl|CDD|48215 cd03403, Band_7_stomatin_like, Band_7_stomatin_like: A subgroup of the band 7 domain of flotillin (reggie) like proteins similar to stomatin and podicin (two lipid raft-associated integral membrane proteins) Back     alignment and domain information
>gnl|CDD|37832 KOG2621, KOG2621, KOG2621, Prohibitins and stomatins of the PID superfamily [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|48214 cd03402, Band_7_2, A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>gnl|CDD|48220 cd03408, Band_7_5, A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>gnl|CDD|37831 KOG2620, KOG2620, KOG2620, Prohibitins and stomatins of the PID superfamily [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|182847 PRK10930, PRK10930, FtsH protease regulator HflK; Provisional Back     alignment and domain information
>gnl|CDD|48219 cd03407, Band_7_4, A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>gnl|CDD|48210 cd02106, Band_7, The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 302 putative hydrolase serine protease transmembrane protei
PRK11029334 FtsH protease regulator HflC; Provisional 100.0
TIGR01932345 hflC HflC protein; InterPro: IPR010200 HflK and HflC ar 100.0
PRK10930419 FtsH protease regulator HflK; Provisional 100.0
TIGR01933285 hflK HflK protein; InterPro: IPR010201 The accumulation 100.0
cd03407262 Band_7_4 A subgroup of the band 7 domain of flotillin ( 100.0
COG0330291 HflC Membrane protease subunits, stomatin/prohibitin ho 100.0
cd03403215 Band_7_stomatin_like Band_7_stomatin_like: A subgroup o 100.0
KOG2620301 consensus 99.94
KOG2621288 consensus 99.94
KOG3090290 consensus 99.92
KOG3083271 consensus 99.85
KOG2962322 consensus 99.75
cd03405242 Band_7_HflC Band_7_HflC: The band 7 domain of flotillin 100.0
cd03404266 Band_7_HflK Band_7_HflK: The band 7 domain of flotillin 100.0
cd03401196 Band_7_prohibitin Band_7_prohibitin. A subgroup of the 100.0
cd03402219 Band_7_2 A subgroup of the band 7 domain of flotillin ( 99.97
smart00244160 PHB prohibitin homologues. prohibitin homologues 99.95
pfam01145177 Band_7 SPFH domain / Band 7 family. This family has bee 99.94
cd03406280 Band_7_3 A subgroup of the band 7 domain of flotillin ( 99.82
COG2268 548 Uncharacterized protein conserved in bacteria [Function 99.73
KOG2668 428 consensus 99.62
cd03408207 Band_7_5 A subgroup of the band 7 domain of flotillin ( 99.21
COG4260345 Membrane protease subunit, stomatin/prohibitin family [ 98.46
cd03400124 Band_7_1 A subgroup of the band 7 domain of flotillin ( 99.51
cd02106121 Band_7 The band 7 domain of flotillin (reggie) like pro 99.47
cd03399128 Band_7_flotillin Band_7_flotillin: a subgroup of the ba 99.27
COG1580159 FliL Flagellar basal body-associated protein [Cell moti 94.45
cd03405242 Band_7_HflC Band_7_HflC: The band 7 domain of flotillin 97.52
PRK01558198 V-type ATP synthase subunit E; Provisional 96.79
PRK01005208 V-type ATP synthase subunit E; Provisional 96.0
PRK01005208 V-type ATP synthase subunit E; Provisional 95.98
PRK01558198 V-type ATP synthase subunit E; Provisional 95.82
COG0330291 HflC Membrane protease subunits, stomatin/prohibitin ho 94.93
KOG2620301 consensus 94.54
PRK02292187 V-type ATP synthase subunit E; Provisional 93.27
PRK03963198 V-type ATP synthase subunit E; Provisional 92.2
cd03407262 Band_7_4 A subgroup of the band 7 domain of flotillin ( 97.34
PRK11029334 FtsH protease regulator HflC; Provisional 97.28
TIGR01932345 hflC HflC protein; InterPro: IPR010200 HflK and HflC ar 95.8
TIGR01933285 hflK HflK protein; InterPro: IPR010201 The accumulation 93.05
cd03404266 Band_7_HflK Band_7_HflK: The band 7 domain of flotillin 96.99
PRK10930419 FtsH protease regulator HflK; Provisional 96.66
COG2268548 Uncharacterized protein conserved in bacteria [Function 95.27
cd03403215 Band_7_stomatin_like Band_7_stomatin_like: A subgroup o 91.73
PRK13665327 hypothetical protein; Provisional 95.88
pfam12127321 YdfA_immunity SigmaW regulon antibacterial. This protei 95.79
PRK02292187 V-type ATP synthase subunit E; Provisional 92.61
PRK05696168 fliL flagellar basal body-associated protein FliL; Revi 91.98
PRK07718142 fliL flagellar basal body-associated protein FliL; Revi 90.55
>PRK11029 FtsH protease regulator HflC; Provisional Back     alignment and domain information
>TIGR01932 hflC HflC protein; InterPro: IPR010200 HflK and HflC are paralogs encoded by tandem genes in proteobacteria, spirochetes, and some other bacterial lineages Back     alignment and domain information
>PRK10930 FtsH protease regulator HflK; Provisional Back     alignment and domain information
>TIGR01933 hflK HflK protein; InterPro: IPR010201 The accumulation of abnormal membrane proteins is something which must be avoided in order to maintain cell viability Back     alignment and domain information
>cd03407 Band_7_4 A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>COG0330 HflC Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03403 Band_7_stomatin_like Band_7_stomatin_like: A subgroup of the band 7 domain of flotillin (reggie) like proteins similar to stomatin and podicin (two lipid raft-associated integral membrane proteins) Back     alignment and domain information
>KOG2620 consensus Back     alignment and domain information
>KOG2621 consensus Back     alignment and domain information
>KOG3090 consensus Back     alignment and domain information
>KOG3083 consensus Back     alignment and domain information
>KOG2962 consensus Back     alignment and domain information
>cd03405 Band_7_HflC Band_7_HflC: The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>cd03404 Band_7_HflK Band_7_HflK: The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>cd03401 Band_7_prohibitin Band_7_prohibitin Back     alignment and domain information
>cd03402 Band_7_2 A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>smart00244 PHB prohibitin homologues Back     alignment and domain information
>pfam01145 Band_7 SPFH domain / Band 7 family Back     alignment and domain information
>cd03406 Band_7_3 A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>COG2268 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2668 consensus Back     alignment and domain information
>cd03408 Band_7_5 A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>COG4260 Membrane protease subunit, stomatin/prohibitin family [Amino acid transport and metabolism] Back     alignment and domain information
>cd03400 Band_7_1 A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>cd02106 Band_7 The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>cd03399 Band_7_flotillin Band_7_flotillin: a subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>COG1580 FliL Flagellar basal body-associated protein [Cell motility and secretion] Back     alignment and domain information
>cd03405 Band_7_HflC Band_7_HflC: The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>PRK01558 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK01005 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK01005 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK01558 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>COG0330 HflC Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2620 consensus Back     alignment and domain information
>PRK02292 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK03963 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>cd03407 Band_7_4 A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>PRK11029 FtsH protease regulator HflC; Provisional Back     alignment and domain information
>TIGR01932 hflC HflC protein; InterPro: IPR010200 HflK and HflC are paralogs encoded by tandem genes in proteobacteria, spirochetes, and some other bacterial lineages Back     alignment and domain information
>TIGR01933 hflK HflK protein; InterPro: IPR010201 The accumulation of abnormal membrane proteins is something which must be avoided in order to maintain cell viability Back     alignment and domain information
>cd03404 Band_7_HflK Band_7_HflK: The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>PRK10930 FtsH protease regulator HflK; Provisional Back     alignment and domain information
>COG2268 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd03403 Band_7_stomatin_like Band_7_stomatin_like: A subgroup of the band 7 domain of flotillin (reggie) like proteins similar to stomatin and podicin (two lipid raft-associated integral membrane proteins) Back     alignment and domain information
>PRK13665 hypothetical protein; Provisional Back     alignment and domain information
>pfam12127 YdfA_immunity SigmaW regulon antibacterial Back     alignment and domain information
>PRK02292 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>PRK07718 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target302 putative hydrolase serine protease transmembrane protei
3bk6_A188 PH stomatin; archaea, trimer, coiled- coil, flotillin, 5e-13
2rpb_A113 Hypothetical membrane protein; SPFH domain; NMR {Pyroco 3e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated PIT, 5e-05
>3bk6_A PH stomatin; archaea, trimer, coiled- coil, flotillin, SPFH, membrane fusion, trafficking, transmembrane, membrane protein; 3.20A {Pyrococcus horikoshii} Length = 188 Back     alignment and structure
 Score = 70.2 bits (171), Expect = 5e-13
 Identities = 31/166 (18%), Positives = 67/166 (40%), Gaps = 9/166 (5%)

Query: 61  VDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRL 120
            ++   +  +   L++        D     V+A++ +R++DP      V           
Sbjct: 3   FEKAVIVDLRTQVLDVPVQETITKDNVPVRVNAVVYFRVVDPVKAVTQVKNY----IMAT 58

Query: 121 RTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQE 180
                 ++R V G    D+ LS++  K+ M++   +    +  GI +  V +   +L   
Sbjct: 59  SQISQTTLRSVIGQAHLDELLSERD-KLNMQLQRIIDEATDPWGIKVTAVEIKDVELPAG 117

Query: 181 VSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEA 226
           + +    + +AER   A    A    E +++ +   R+A +I+SE 
Sbjct: 118 MQKAMARQAEAERERRARITLA----EAERQAAEKLREAAEIISEH 159


>2rpb_A Hypothetical membrane protein; SPFH domain; NMR {Pyrococcus horikoshii} Length = 113 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target302 putative hydrolase serine protease transmembrane protei
3bk6_A188 PH stomatin; archaea, trimer, coiled- coil, flotillin, 99.88
2rpb_A113 Hypothetical membrane protein; SPFH domain; NMR {Pyroco 99.59
1win_A143 Flotillin 2; BAND 7 domain, structural genomics, riken 99.59
>3bk6_A PH stomatin; archaea, trimer, coiled- coil, flotillin, SPFH, membrane fusion, trafficking, transmembrane, membrane protein; 3.20A {Pyrococcus horikoshii} Back     alignment and structure
Probab=99.88  E-value=2.7e-23  Score=194.87  Aligned_cols=178  Identities=17%  Similarity=0.272  Sum_probs=149.7

Q ss_pred             EEEEEEEEEEECCCCCCCCHHCCCCCCCCCCCCCCCEEEECCCHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             03799987520134433100001122210124332101201101222013313346643467778765310112420000
Q gi|254780959|r   61 VDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDA  140 (302)
Q Consensus        61 i~~v~~~~~r~~~~~~~~~~v~T~D~~~v~vd~~v~yrI~dp~~~~~~~~~~~~~~~~~l~~~~~~~lr~v~~~~~~~e~  140 (302)
                      ++++..+|.|+++++.++.+++|+|++.+.++++++|||.||.+|++.+++    +...+.+.+++++|+++|+++++++
T Consensus         3 i~~~~~vD~R~~~~~i~~q~v~T~D~~~v~v~~~v~yrI~dp~~~~~~~~~----~~~~l~~~~~~~lr~~i~~~~l~ei   78 (188)
T 3bk6_A            3 FEKAVIVDLRTQVLDVPVQETITKDNVPVRVNAVVYFRVVDPVKAVTQVKN----YIMATSQISQTTLRSVIGQAHLDEL   78 (188)
T ss_dssp             EEECCCCCSSCEEEEEEEEEEECTTSCEEEEEEEEEEEESCHHHHHHSSSC----HHHHHHHHHHHHHHHHHHTSCHHHH
T ss_pred             EEEEEEEEEEEEEEECCCCEEECCCCCEEEEEEEEEEEECCHHHHHHHCCC----HHHHHHHHHHHHHHHHHCCCCHHHH
T ss_conf             886389972578761798657738999899989999998987999874479----9999999999999988501658999


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             01210015899999998874221443100000011110124455431128999998877678899997655778899999
Q gi|254780959|r  141 LSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKAT  220 (302)
Q Consensus       141 l~~~R~~i~~~v~~~l~~~~~~~GI~I~~V~I~~i~~p~~i~~ai~~~~~ae~~~~A~~~~a~~~~ea~~~~a~ae~~~~  220 (302)
                      ++ +|..+...+.+.+.+.+.+|||+|.+|.|++++||+++.+++.+++.|+++++|...+|+++.++            
T Consensus        79 l~-~r~~i~~~~~~~~~~~~~~~Gi~v~~V~I~di~~p~~v~~ai~~~~~Ae~e~~a~~~~Ae~e~~~------------  145 (188)
T 3bk6_A           79 LS-ERDKLNMQLQRIIDEATDPWGIKVTAVEIKDVELPAGMQKAMARQAEAERERRARITLAEAERQA------------  145 (188)
T ss_dssp             HH-CHHHHHHHHHHHHHHHTGGGTEEEEEEEEEEEEEETTHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------
T ss_pred             HH-HHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------
T ss_conf             86-47777678999999888732869999873467998779999999999999999999998999999------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             768989999888633878999999999987579999999999999998346993
Q gi|254780959|r  221 QILSEARRDSEINYGKGEAERGRILSNVFQKDPEFFEFYRSMRAYTDSLASSDT  274 (302)
Q Consensus       221 ~i~AeA~~~a~~~~A~aeA~a~~~~~~a~~~~p~~~~~~~~l~~~~~~~~~~~~  274 (302)
                                    |+++++++++    +..+|..++ ++++|+++++.++.++
T Consensus       146 --------------ae~~~~aa~~----~~e~~~a~~-lr~~q~i~~i~~~~~~  180 (188)
T 3bk6_A          146 --------------AEKLREAAEI----ISEHPMALQ-LRTLQTISDVAGDKSN  180 (188)
T ss_dssp             --------------HHHHHHHHHH----HHHCTTHHH-HHHTTC----------
T ss_pred             --------------HHHHHHHHHH----HHCCHHHHH-HHHHHHHHHHHHCCCC
T ss_conf             --------------9999999999----852999999-9999999999716366



>2rpb_A Hypothetical membrane protein; SPFH domain; NMR {Pyrococcus horikoshii} Back     alignment and structure
>1win_A Flotillin 2; BAND 7 domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, cell adhesion; NMR {Mus musculus} SCOP: d.43.2.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target302 putative hydrolase serine protease transmembrane protei
d1wina_143 Flotillin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.56
>d1wina_ d.43.2.1 (A:) Flotillin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: EF-Ts domain-like
superfamily: Band 7/SPFH domain
family: Band 7/SPFH domain
domain: Flotillin-2
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.56  E-value=1.5e-16  Score=141.71  Aligned_cols=129  Identities=13%  Similarity=0.148  Sum_probs=113.8

Q ss_pred             EEEEEEEEECCCCCCCCHHCCCCCCCCCCCCCCCEEEECCCHHHHH-----CCCCHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             7999875201344331000011222101243321012011012220-----13313346643467778765310112420
Q gi|254780959|r   63 RVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQS-----VSCDRIAAESRLRTRLDASIRRVYGLRRF  137 (302)
Q Consensus        63 ~v~~~~~r~~~~~~~~~~v~T~D~~~v~vd~~v~yrI~dp~~~~~~-----~~~~~~~~~~~l~~~~~~~lr~v~~~~~~  137 (302)
                      .+.+++.|+++++.+.++++|+|+.++.|+++++|||.||.+++.+     ++.....++..+.+.+.+++|+++|++++
T Consensus         6 s~~rislr~~~l~~~~q~v~TkD~v~v~V~a~v~~rV~~~~~~~~~a~~~~l~~~~~~~~~~i~~~~~~~lR~vig~~~l   85 (143)
T d1wina_           6 SGQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTV   85 (143)
T ss_dssp             CCCSCCCSCEEECCCEEEEECSSSCEEEECCEEEEEECCCSSCCHHHHHHHSSSCHHHHHHHHHHHHHHHHHHHHHHSCH
T ss_pred             CEEEEEEEEEEECCCCCEEECCCCCEEEEEEEEEEEECCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCH
T ss_conf             50576526786158873679789978999999999984808888888876503658899999999999999987523668


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             0000121001589999999887422144310000001111012445543112899
Q gi|254780959|r  138 DDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAE  192 (302)
Q Consensus       138 ~e~l~~~R~~i~~~v~~~l~~~~~~~GI~I~~V~I~~i~~p~~i~~ai~~~~~ae  192 (302)
                      +++++ +|+++.+.+.+.+++.+.+|||+|.+|.|+||++|+++.+++.+++.|.
T Consensus        86 ~el~~-~R~~i~~~v~~~i~~~l~~~Gi~v~~v~I~dI~~~~~~~~a~~~~q~A~  139 (143)
T d1wina_          86 EQIYQ-DRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTSG  139 (143)
T ss_dssp             HHHHH-THHHHHHHHHHHHHHHHTTTTEEEEEEECCCEECTTCHHHHHCCCCCCC
T ss_pred             HHHHH-CHHHHHHHHHHHHHHHHHHHCEEEEEEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             99985-7999999999999999997381898999996188399999999999863



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 302 putative hydrolase serine protease transmembrane p
1win_A_143 (A:) Flotillin 2; BAND 7 domain, structural genomi 3e-15
2rpb_A_113 (A:) Hypothetical membrane protein; SPFH domain; N 1e-12
3bk6_A_1-114114 (A:1-114) PH stomatin; archaea, trimer, coiled- co 2e-11
>1win_A (A:) Flotillin 2; BAND 7 domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, cell adhesion; NMR {Mus musculus}Length = 143 Back     alignment and structure
 Score = 77.0 bits (189), Expect = 3e-15
 Identities = 17/140 (12%), Positives = 43/140 (30%), Gaps = 6/140 (4%)

Query: 61  VDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIA----- 115
               + +  +IM L      V+ ++G    V  +   +I+             +      
Sbjct: 4   GSSGQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQD 63

Query: 116 AESRLRTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRT 175
            ++ +   L+  +R + G    +    + R++    V E    D  ++GI I    +   
Sbjct: 64  IKNVVLQTLEGHLRSILGTLTVEQIY-QDRDQFAKLVREVAAPDVGRMGIEILSFTIKDV 122

Query: 176 DLTQEVSQQTYDRMKAERLA 195
               +          +   +
Sbjct: 123 YDKVDYLSSLGKTQTSGPSS 142


>2rpb_A (A:) Hypothetical membrane protein; SPFH domain; NMR {Pyrococcus horikoshii}Length = 113 Back     alignment and structure
>3bk6_A (A:1-114) PH stomatin; archaea, trimer, coiled- coil, flotillin, SPFH, membrane fusion, trafficking, transmembrane, membrane protein; 3.20A {Pyrococcus horikoshii}Length = 114 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target302 putative hydrolase serine protease transmembrane protei
1win_A_143 Flotillin 2; BAND 7 domain, structural genomics, r 99.65
2rpb_A_113 Hypothetical membrane protein; SPFH domain; NMR {P 99.57
3bk6_A_1-114114 PH stomatin; archaea, trimer, coiled- coil, flotil 99.49
>1win_A (A:) Flotillin 2; BAND 7 domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, cell adhesion; NMR {Mus musculus} Back     alignment and structure
Probab=99.65  E-value=9e-18  Score=154.05  Aligned_cols=133  Identities=13%  Similarity=0.124  Sum_probs=121.1

Q ss_pred             EEEEEEEEEEECCCCCCCCHHCCCCCCCCCCCCCCCEEEECCCHHHHHCC-----CCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             03799987520134433100001122210124332101201101222013-----3133466434677787653101124
Q gi|254780959|r   61 VDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVS-----CDRIAAESRLRTRLDASIRRVYGLR  135 (302)
Q Consensus        61 i~~v~~~~~r~~~~~~~~~~v~T~D~~~v~vd~~v~yrI~dp~~~~~~~~-----~~~~~~~~~l~~~~~~~lr~v~~~~  135 (302)
                      ++++..+|+|.++++.++.+++|+|+.++.+++++.|||.||..++..+.     .....++.+|.+.+.+++|+++|++
T Consensus         4 ~~~v~~~~~r~~~~~~~~~~v~T~D~~~i~v~~~~~~ri~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~lr~~~~~~   83 (143)
T 1win_A            4 GSSGQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTL   83 (143)
T ss_dssp             CCCCCSCCCSCEEECCCEEEEECSSSCEEEECCEEEEEECCCSSCCHHHHHHHSSSCHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             CCCCEEEEEEEEEECCCCCEEECCCCCEEEEEEEEEEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             87415865167874488716787899889999999999848089998877643246588999999999999999986216


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             20000012100158999999988742214431000000111101244554311289999
Q gi|254780959|r  136 RFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERL  194 (302)
Q Consensus       136 ~~~e~l~~~R~~i~~~v~~~l~~~~~~~GI~I~~V~I~~i~~p~~i~~ai~~~~~ae~~  194 (302)
                      +++++++ +|+++++.+++.|++.+.+|||+|.+|.|++++||+++.+++.+++.|+++
T Consensus        84 ~~~~~~~-~r~~i~~~v~~~l~~~l~~~Gi~i~~v~i~~i~~p~e~~~ai~~~~~Ae~~  141 (143)
T 1win_A           84 TVEQIYQ-DRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTSGPS  141 (143)
T ss_dssp             CHHHHHH-THHHHHHHHHHHHHHHHTTTTEEEEEEECCCEECTTCHHHHHCCCCCCCCC
T ss_pred             CHHHHHH-CHHHHHHHHHHHHHHHHHHHCEEEEEEEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             6677760-899999999999999996500588899999638849999999999986443



>2rpb_A (A:) Hypothetical membrane protein; SPFH domain; NMR {Pyrococcus horikoshii} Back     alignment and structure
>3bk6_A (A:1-114) PH stomatin; archaea, trimer, coiled- coil, flotillin, SPFH, membrane fusion, trafficking, transmembrane, membrane protein; 3.20A {Pyrococcus horikoshii} Back     alignment and structure