254780958

254780958

HflK protein

GeneID in NCBI database:8209980Locus tag:CLIBASIA_04285
Protein GI in NCBI database:254780958Protein Accession:YP_003065371.1
Gene range:+(954362, 955429)Protein Length:355aa
Gene description:HflK protein
COG prediction:[O] Membrane protease subunits, stomatin/prohibitin homologs
KEGG prediction:HflK protein; K04088 membrane protease subunit HflK [EC:3.4.-.-]
SEED prediction:HflK protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Hfl operon
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----
MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS
cccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccEEEcccEEEEEEEccEEEccccccccEEEcccccEEEEEEccEEEEEEEEEEEEcccccccEEcccccEEEEEEEEEEEEccHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccEEEEEccccEEEEEEHHHHHHccccccccccccc
cccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccEEEEcccccEEEEEccccccccccccccccccccccEEEEEEEEEEEEEccEEEEEccccccEccccccEEEEEEEEEEEEccHHHHEEccccHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccEEEEEcccccEEEccHHHHHccccccHHHHHccc
msydknnsdwrptrlsgsngngdglppfdVEAIIRYIKDkfdlipffksYGSVYIILLLIGSFcafqsiyivhpderavelrfgkpkndvflpglhmmfwpiDQVEIVKVIERQQkiggrsasvgsnsgliltgdqnivGLHFSVLYvvtdprlylfnlenpgetlKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINtisiedaspprevadAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGqyvnaptllRKRIYLETMEGILKKAKKVIIDkkqsvmpylplneAFSRIQTKREIRWYQS
msydknnsdwrptrlsgsngngdglpPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIggrsasvgsnsGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAeqdedrfveesnkysnrvlgsargeashiressiaYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIdkkqsvmpylplneafsriqtkREIRWYQS
MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGilkkakkviidkkQSVMPYLPLNEAFSRIQTKREIRWYQS
MSYD****************************IIRY*************YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ*****************LTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ******EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYL********************
***********PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVL**********RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS
*****NNS****************LPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS
MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS
MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target355 HflK protein [Candidatus Liberibacter asiaticus str. ps
254780959302 putative hydrolase serine protease transmembrane p 0.003
>gi|254780959|ref|YP_003065372.1| putative hydrolase serine protease transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 302 Back     alignment
 Score = 34.3 bits (77), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 99/229 (43%), Gaps = 17/229 (7%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIVKVIERQQKIGGRSASVGS 126
           S +IV   ++A+  RFGK       PG++  M +    V+ VK +++Q         +  
Sbjct: 23  SFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQ------IMRLNL 76

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN----PGETLKQVSESAMREVVGRRF 182
           ++  +   D     +   + Y + DP L+  ++          L+   ++++R V G R 
Sbjct: 77  DNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRR 136

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA-DAFDEVQRAEQ 241
             D    QR+++ +EV   ++   D  K GI I  + +      +EV+   +D ++    
Sbjct: 137 FDDALSKQREKMMMEVCEDLR--YDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERL 194

Query: 242 DEDRFVEESNKYS-NRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            E  F+    +    + +  A  +A+ I   S A +D  I   +GEA+R
Sbjct: 195 AEAEFIRARGREEGQKRMSIADRKATQI--LSEARRDSEINYGKGEAER 241

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target355 HflK protein [Candidatus Liberibacter asiaticus str. ps
315122500356 HflK protein [Candidatus Liberibacter solanacearum CLso 1 1e-141
15965877362 putative membrane bound protease protein [Sinorhizobium 1 1e-111
150397219362 HflK protein [Sinorhizobium medicae WSM419] Length = 36 1 1e-111
222086377377 hydrolase serine protease transmembrane subunit K prote 1 1e-109
325293413373 hflK protein [Agrobacterium sp. H13-3] Length = 373 1 1e-108
227822572361 putative transmembrane serine protease [Sinorhizobium f 1 1e-108
222149081383 HFLK protein [Agrobacterium vitis S4] Length = 383 1 1e-107
159185025372 HFLK protein [Agrobacterium tumefaciens str. C58] Lengt 1 1e-102
190892525361 hydrolase serine protease transmembrane subunit K prote 1 1e-101
239832275382 HflK protein [Ochrobactrum intermedium LMG 3301] Length 1 1e-100
>gi|315122500|ref|YP_004062989.1| HflK protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 356 Back     alignment and organism information
 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 252/340 (74%), Positives = 286/340 (84%), Gaps = 2/340 (0%)

Query: 10  WRPTRLSGSNGNGDGLPPFDVEAII-RYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQS 68
           W P     ++ N +G PPFD +  I R I+     IP F +Y S+YI  L+  SFC FQS
Sbjct: 12  WGPRSTEFNHSNNNGSPPFDFDNFIARLIRKILGFIPSFYTYSSLYISALVAFSFCLFQS 71

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           IYIVHPDER VELRFGK KN++ LPGLH+MFWPIDQVEIVKVIERQ+ IG R  S  SN+
Sbjct: 72  IYIVHPDERGVELRFGKIKNEISLPGLHVMFWPIDQVEIVKVIERQENIG-RPVSSSSNN 130

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GLILTGDQNIV L FS+LYVV+DPR YLFNLENP + L+QV+ESAMREVVG R AVDIFR
Sbjct: 131 GLILTGDQNIVSLQFSILYVVSDPRSYLFNLENPRDILRQVAESAMREVVGGRIAVDIFR 190

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
           S+RQQIALEVR LIQKTMD YKSGILINTISIED SPPREVA AFDEVQRAEQDE+RF+E
Sbjct: 191 SKRQQIALEVRELIQKTMDSYKSGILINTISIEDVSPPREVASAFDEVQRAEQDEERFIE 250

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESNKY+N++LGSARGEAS IRESSIAYKDRIIQEA+GEADRFLS+YGQYVNAP LLR RI
Sbjct: 251 ESNKYTNQILGSARGEASRIRESSIAYKDRIIQEAKGEADRFLSVYGQYVNAPALLRSRI 310

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKR 348
           YLETMEGILK +KKV+ID+KQ+V+PYLPLNE FS +Q ++
Sbjct: 311 YLETMEGILKGSKKVVIDQKQTVIPYLPLNEMFSPVQKQQ 350


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15965877|ref|NP_386230.1| putative membrane bound protease protein [Sinorhizobium meliloti 1021] Length = 362 Back     alignment and organism information
>gi|150397219|ref|YP_001327686.1| HflK protein [Sinorhizobium medicae WSM419] Length = 362 Back     alignment and organism information
>gi|222086377|ref|YP_002544911.1| hydrolase serine protease transmembrane subunit K protein [Agrobacterium radiobacter K84] Length = 377 Back     alignment and organism information
>gi|325293413|ref|YP_004279277.1| hflK protein [Agrobacterium sp. H13-3] Length = 373 Back     alignment and organism information
>gi|227822572|ref|YP_002826544.1| putative transmembrane serine protease [Sinorhizobium fredii NGR234] Length = 361 Back     alignment and organism information
>gi|222149081|ref|YP_002550038.1| HFLK protein [Agrobacterium vitis S4] Length = 383 Back     alignment and organism information
>gi|159185025|ref|NP_355013.2| HFLK protein [Agrobacterium tumefaciens str. C58] Length = 372 Back     alignment and organism information
>gi|190892525|ref|YP_001979067.1| hydrolase serine protease transmembrane subunit K protein [Rhizobium etli CIAT 652] Length = 361 Back     alignment and organism information
>gi|239832275|ref|ZP_04680604.1| HflK protein [Ochrobactrum intermedium LMG 3301] Length = 382 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target355 HflK protein [Candidatus Liberibacter asiaticus str. ps
TIGR01933261 TIGR01933, hflK, HflK protein 3e-66
PRK10930419 PRK10930, PRK10930, FtsH protease regulator HflK; Provi 8e-45
COG0330291 COG0330, HflC, Membrane protease subunits, stomatin/pro 6e-41
cd03403215 cd03403, Band_7_stomatin_like, Band_7_stomatin_like: A 1e-14
TIGR01932317 TIGR01932, hflC, HflC protein 5e-06
cd03404266 cd03404, Band_7_HflK, Band_7_HflK: The band 7 domain of 2e-76
pfam01145177 pfam01145, Band_7, SPFH domain / Band 7 family 1e-21
smart00244160 smart00244, PHB, prohibitin homologues 9e-17
cd03401196 cd03401, Band_7_prohibitin, Band_7_prohibitin 3e-08
KOG2621288 KOG2621, KOG2621, KOG2621, Prohibitins and stomatins of 3e-07
KOG3090290 KOG3090, KOG3090, KOG3090, Prohibitin-like protein [Pos 1e-06
cd03405242 cd03405, Band_7_HflC, Band_7_HflC: The band 7 domain of 2e-15
KOG2620301 KOG2620, KOG2620, KOG2620, Prohibitins and stomatins of 2e-12
cd02106121 cd02106, Band_7, The band 7 domain of flotillin (reggie 2e-14
>gnl|CDD|130988 TIGR01933, hflK, HflK protein Back     alignment and domain information
>gnl|CDD|182847 PRK10930, PRK10930, FtsH protease regulator HflK; Provisional Back     alignment and domain information
>gnl|CDD|30678 COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48215 cd03403, Band_7_stomatin_like, Band_7_stomatin_like: A subgroup of the band 7 domain of flotillin (reggie) like proteins similar to stomatin and podicin (two lipid raft-associated integral membrane proteins) Back     alignment and domain information
>gnl|CDD|162612 TIGR01932, hflC, HflC protein Back     alignment and domain information
>gnl|CDD|48216 cd03404, Band_7_HflK, Band_7_HflK: The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>gnl|CDD|144658 pfam01145, Band_7, SPFH domain / Band 7 family Back     alignment and domain information
>gnl|CDD|128540 smart00244, PHB, prohibitin homologues Back     alignment and domain information
>gnl|CDD|48213 cd03401, Band_7_prohibitin, Band_7_prohibitin Back     alignment and domain information
>gnl|CDD|37832 KOG2621, KOG2621, KOG2621, Prohibitins and stomatins of the PID superfamily [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|38300 KOG3090, KOG3090, KOG3090, Prohibitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48217 cd03405, Band_7_HflC, Band_7_HflC: The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>gnl|CDD|37831 KOG2620, KOG2620, KOG2620, Prohibitins and stomatins of the PID superfamily [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|48210 cd02106, Band_7, The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 355 HflK protein [Candidatus Liberibacter asiaticus str. ps
PRK10930419 FtsH protease regulator HflK; Provisional 100.0
TIGR01933285 hflK HflK protein; InterPro: IPR010201 The accumulation 100.0
cd03404266 Band_7_HflK Band_7_HflK: The band 7 domain of flotillin 100.0
PRK11029334 FtsH protease regulator HflC; Provisional 100.0
cd03407262 Band_7_4 A subgroup of the band 7 domain of flotillin ( 100.0
cd03405242 Band_7_HflC Band_7_HflC: The band 7 domain of flotillin 100.0
COG0330291 HflC Membrane protease subunits, stomatin/prohibitin ho 100.0
cd03403215 Band_7_stomatin_like Band_7_stomatin_like: A subgroup o 100.0
TIGR01932345 hflC HflC protein; InterPro: IPR010200 HflK and HflC ar 100.0
KOG2620301 consensus 100.0
KOG2621288 consensus 99.97
KOG3090290 consensus 99.94
KOG3083271 consensus 99.86
KOG2962322 consensus 99.75
KOG2668428 consensus 99.39
cd03402219 Band_7_2 A subgroup of the band 7 domain of flotillin ( 100.0
smart00244160 PHB prohibitin homologues. prohibitin homologues 99.97
pfam01145177 Band_7 SPFH domain / Band 7 family. This family has bee 99.96
cd03406280 Band_7_3 A subgroup of the band 7 domain of flotillin ( 99.83
COG2268 548 Uncharacterized protein conserved in bacteria [Function 99.58
cd03408207 Band_7_5 A subgroup of the band 7 domain of flotillin ( 99.11
cd03401196 Band_7_prohibitin Band_7_prohibitin. A subgroup of the 100.0
cd02106121 Band_7 The band 7 domain of flotillin (reggie) like pro 99.64
cd03400124 Band_7_1 A subgroup of the band 7 domain of flotillin ( 99.54
cd03399128 Band_7_flotillin Band_7_flotillin: a subgroup of the ba 99.32
COG1580159 FliL Flagellar basal body-associated protein [Cell moti 97.28
PRK05696168 fliL flagellar basal body-associated protein FliL; Revi 96.16
pfam03748145 FliL Flagellar basal body-associated protein FliL. This 91.97
PRK12785167 fliL flagellar basal body-associated protein FliL; Revi 90.01
pfam1222146 HflK_N Bacterial membrane protein N terminal. This doma 98.53
PRK10930419 FtsH protease regulator HflK; Provisional 98.42
COG4260345 Membrane protease subunit, stomatin/prohibitin family [ 98.28
cd03405242 Band_7_HflC Band_7_HflC: The band 7 domain of flotillin 97.92
cd03404266 Band_7_HflK Band_7_HflK: The band 7 domain of flotillin 97.59
cd03407262 Band_7_4 A subgroup of the band 7 domain of flotillin ( 97.11
COG0330291 HflC Membrane protease subunits, stomatin/prohibitin ho 94.72
TIGR01933285 hflK HflK protein; InterPro: IPR010201 The accumulation 94.12
PRK11029334 FtsH protease regulator HflC; Provisional 97.58
PRK01558198 V-type ATP synthase subunit E; Provisional 97.19
PRK01005208 V-type ATP synthase subunit E; Provisional 97.01
PRK01558198 V-type ATP synthase subunit E; Provisional 96.86
PRK02292187 V-type ATP synthase subunit E; Provisional 96.3
PRK06231201 F0F1 ATP synthase subunit B; Validated 96.04
pfam05103131 DivIVA DivIVA protein. The Bacillus subtilis divIVA1 mu 95.49
PRK13428 445 F0F1 ATP synthase subunit delta; Provisional 95.41
PRK13428 445 F0F1 ATP synthase subunit delta; Provisional 94.74
KOG2668428 consensus 94.69
PRK03963198 V-type ATP synthase subunit E; Provisional 94.49
KOG2620301 consensus 94.34
COG2811108 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy 94.27
pfam05103131 DivIVA DivIVA protein. The Bacillus subtilis divIVA1 mu 93.91
PRK01194185 V-type ATP synthase subunit E; Provisional 93.9
TIGR0292685 AhaH ATP synthase archaeal, H subunit; InterPro: IPR014 92.51
TIGR03321246 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC a 91.95
PRK13460173 F0F1 ATP synthase subunit B; Provisional 91.17
PRK13455184 F0F1 ATP synthase subunit B; Provisional 90.4
PRK01005208 V-type ATP synthase subunit E; Provisional 97.08
TIGR01932345 hflC HflC protein; InterPro: IPR010200 HflK and HflC ar 96.75
pfam12127321 YdfA_immunity SigmaW regulon antibacterial. This protei 94.03
CHL00019184 atpF ATP synthase CF0 B subunit 94.0
>PRK10930 FtsH protease regulator HflK; Provisional Back     alignment and domain information
>TIGR01933 hflK HflK protein; InterPro: IPR010201 The accumulation of abnormal membrane proteins is something which must be avoided in order to maintain cell viability Back     alignment and domain information
>cd03404 Band_7_HflK Band_7_HflK: The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>PRK11029 FtsH protease regulator HflC; Provisional Back     alignment and domain information
>cd03407 Band_7_4 A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>cd03405 Band_7_HflC Band_7_HflC: The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>COG0330 HflC Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03403 Band_7_stomatin_like Band_7_stomatin_like: A subgroup of the band 7 domain of flotillin (reggie) like proteins similar to stomatin and podicin (two lipid raft-associated integral membrane proteins) Back     alignment and domain information
>TIGR01932 hflC HflC protein; InterPro: IPR010200 HflK and HflC are paralogs encoded by tandem genes in proteobacteria, spirochetes, and some other bacterial lineages Back     alignment and domain information
>KOG2620 consensus Back     alignment and domain information
>KOG2621 consensus Back     alignment and domain information
>KOG3090 consensus Back     alignment and domain information
>KOG3083 consensus Back     alignment and domain information
>KOG2962 consensus Back     alignment and domain information
>KOG2668 consensus Back     alignment and domain information
>cd03402 Band_7_2 A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>smart00244 PHB prohibitin homologues Back     alignment and domain information
>pfam01145 Band_7 SPFH domain / Band 7 family Back     alignment and domain information
>cd03406 Band_7_3 A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>COG2268 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd03408 Band_7_5 A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>cd03401 Band_7_prohibitin Band_7_prohibitin Back     alignment and domain information
>cd02106 Band_7 The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>cd03400 Band_7_1 A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>cd03399 Band_7_flotillin Band_7_flotillin: a subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>COG1580 FliL Flagellar basal body-associated protein [Cell motility and secretion] Back     alignment and domain information
>PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>pfam03748 FliL Flagellar basal body-associated protein FliL Back     alignment and domain information
>PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>pfam12221 HflK_N Bacterial membrane protein N terminal Back     alignment and domain information
>PRK10930 FtsH protease regulator HflK; Provisional Back     alignment and domain information
>COG4260 Membrane protease subunit, stomatin/prohibitin family [Amino acid transport and metabolism] Back     alignment and domain information
>cd03405 Band_7_HflC Band_7_HflC: The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>cd03404 Band_7_HflK Band_7_HflK: The band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>cd03407 Band_7_4 A subgroup of the band 7 domain of flotillin (reggie) like proteins Back     alignment and domain information
>COG0330 HflC Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01933 hflK HflK protein; InterPro: IPR010201 The accumulation of abnormal membrane proteins is something which must be avoided in order to maintain cell viability Back     alignment and domain information
>PRK11029 FtsH protease regulator HflC; Provisional Back     alignment and domain information
>PRK01558 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK01005 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK01558 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK02292 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK06231 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>pfam05103 DivIVA DivIVA protein Back     alignment and domain information
>PRK13428 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>PRK13428 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>KOG2668 consensus Back     alignment and domain information
>PRK03963 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>KOG2620 consensus Back     alignment and domain information
>COG2811 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion] Back     alignment and domain information
>pfam05103 DivIVA DivIVA protein Back     alignment and domain information
>PRK01194 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>TIGR02926 AhaH ATP synthase archaeal, H subunit; InterPro: IPR014275 A-ATPases (or A1A0-ATPase) (3 Back     alignment and domain information
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B Back     alignment and domain information
>PRK13460 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK13455 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK01005 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>TIGR01932 hflC HflC protein; InterPro: IPR010200 HflK and HflC are paralogs encoded by tandem genes in proteobacteria, spirochetes, and some other bacterial lineages Back     alignment and domain information
>pfam12127 YdfA_immunity SigmaW regulon antibacterial Back     alignment and domain information
>CHL00019 atpF ATP synthase CF0 B subunit Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target355 HflK protein [Candidatus Liberibacter asiaticus str. ps
2rpb_A113 Hypothetical membrane protein; SPFH domain; NMR {Pyroco 5e-13
1win_A143 Flotillin 2; BAND 7 domain, structural genomics, riken 6e-08
3bk6_A188 PH stomatin; archaea, trimer, coiled- coil, flotillin, 9e-12
>2rpb_A Hypothetical membrane protein; SPFH domain; NMR {Pyrococcus horikoshii} Length = 113 Back     alignment and structure
 Score = 70.4 bits (172), Expect = 5e-13
 Identities = 21/98 (21%), Positives = 47/98 (47%), Gaps = 3/98 (3%)

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           ++  D  +V +   V Y V DP   ++N+ +    + +++++ +R ++G     +   S 
Sbjct: 19  VICKDNVVVTVDAVVYYQVIDPVKAVYNVSDFLMAIVKLAQTNLRAIIGEMELDETL-SG 77

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
           R  I   +R  + K  D +  G+ I  + I+   PP++
Sbjct: 78  RDIINARLREELDKITDRW--GVKITRVEIQRIDPPKD 113


>1win_A Flotillin 2; BAND 7 domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, cell adhesion; NMR {Mus musculus} SCOP: d.43.2.1 Length = 143 Back     alignment and structure
>3bk6_A PH stomatin; archaea, trimer, coiled- coil, flotillin, SPFH, membrane fusion, trafficking, transmembrane, membrane protein; 3.20A {Pyrococcus horikoshii} Length = 188 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target355 HflK protein [Candidatus Liberibacter asiaticus str. ps
3bk6_A188 PH stomatin; archaea, trimer, coiled- coil, flotillin, 99.94
2rpb_A113 Hypothetical membrane protein; SPFH domain; NMR {Pyroco 99.79
1win_A143 Flotillin 2; BAND 7 domain, structural genomics, riken 99.69
2kk7_A52 V-type ATP synthase subunit E; A1AO ATP synthase, ATP s 92.21
>3bk6_A PH stomatin; archaea, trimer, coiled- coil, flotillin, SPFH, membrane fusion, trafficking, transmembrane, membrane protein; 3.20A {Pyrococcus horikoshii} Back     alignment and structure
Probab=99.94  E-value=1.6e-25  Score=187.68  Aligned_cols=176  Identities=19%  Similarity=0.317  Sum_probs=145.8

Q ss_pred             CCCEEEEEEEEEEEEEECCCCCCCCCCCEEEEECCCEEEEEEEEEEEEECCHHHHHHHHCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             53236872204899982672211476650366068418876344342215887853201298999988877767777530
Q gi|254780958|r  101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR  180 (355)
Q Consensus       101 pi~~v~~v~v~~~~~~~~~~~~~~~~~~~~mLT~D~n~V~v~~~V~yrI~Dp~~~~~~v~~~~~~l~~~~esalR~vvg~  180 (355)
                      -|+++.++|++.+.++++.+.         ++|+|++.|.++++|+|||+||.+|++++.++...+...+++++|+++|+
T Consensus         2 ii~~~~~vD~R~~~~~i~~q~---------v~T~D~~~v~v~~~v~yrI~dp~~~~~~~~~~~~~l~~~~~~~lr~~i~~   72 (188)
T 3bk6_A            2 IFEKAVIVDLRTQVLDVPVQE---------TITKDNVPVRVNAVVYFRVVDPVKAVTQVKNYIMATSQISQTTLRSVIGQ   72 (188)
T ss_dssp             CEEECCCCCSSCEEEEEEEEE---------EECTTSCEEEEEEEEEEEESCHHHHHHSSSCHHHHHHHHHHHHHHHHHHT
T ss_pred             EEEEEEEEEEEEEEEECCCCE---------EECCCCCEEEEEEEEEEEECCHHHHHHHCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             688638997257876179865---------77389998999899999989879998744799999999999999988501


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             10000015546788777999988863123461798753430156257899999999887889999999999999987768
Q gi|254780958|r  181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGS  260 (355)
Q Consensus       181 ~~~d~ilt~~R~~i~~~v~~~lq~~l~~y~~GI~V~~V~i~~v~~P~~v~~A~~~v~~A~qe~er~i~eAe~~a~~i~~~  260 (355)
                      +++++++++ |..+...+...+...++.|  ||+|.+|+|+++.||+++..||++++.|++++++.+.+|++++..  ++
T Consensus        73 ~~l~eil~~-r~~i~~~~~~~~~~~~~~~--Gi~v~~V~I~di~~p~~v~~ai~~~~~Ae~e~~a~~~~Ae~e~~~--ae  147 (188)
T 3bk6_A           73 AHLDELLSE-RDKLNMQLQRIIDEATDPW--GIKVTAVEIKDVELPAGMQKAMARQAEAERERRARITLAEAERQA--AE  147 (188)
T ss_dssp             SCHHHHHHC-HHHHHHHHHHHHHHHTGGG--TEEEEEEEEEEEEEETTHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HH
T ss_pred             CCHHHHHHH-HHHHHHHHHHHHHHHHHHC--CEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HH
T ss_conf             658999864-7777678999999888732--869999873467998779999999999999999999998999999--99


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCC
Q ss_conf             89999999977789999999972322999999999998699999999999999998379
Q gi|254780958|r  261 ARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKK  319 (355)
Q Consensus       261 A~geA~~i~~~Aeay~~~~i~~A~gea~rf~~i~~~Y~~ap~vt~~rlylet~~~vl~~  319 (355)
                      +.++|+++                            +..+|...+.| |+|||+++.++
T Consensus       148 ~~~~aa~~----------------------------~~e~~~a~~lr-~~q~i~~i~~~  177 (188)
T 3bk6_A          148 KLREAAEI----------------------------ISEHPMALQLR-TLQTISDVAGD  177 (188)
T ss_dssp             HHHHHHHH----------------------------HHHCTTHHHHH-HTTC-------
T ss_pred             HHHHHHHH----------------------------HHCCHHHHHHH-HHHHHHHHHHC
T ss_conf             99999999----------------------------85299999999-99999999716



>2rpb_A Hypothetical membrane protein; SPFH domain; NMR {Pyrococcus horikoshii} Back     alignment and structure
>1win_A Flotillin 2; BAND 7 domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, cell adhesion; NMR {Mus musculus} SCOP: d.43.2.1 Back     alignment and structure
>2kk7_A V-type ATP synthase subunit E; A1AO ATP synthase, ATP synthesis, hydrogen ION transport, ION transport, transport, hydrolase; NMR {Methanocaldococcus jannaschii} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 355 HflK protein [Candidatus Liberibacter asiaticus str. ps
d1wina_143 d.43.2.1 (A:) Flotillin-2 {Mouse (Mus musculus) [TaxId: 1e-07
>d1wina_ d.43.2.1 (A:) Flotillin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 143 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: EF-Ts domain-like
superfamily: Band 7/SPFH domain
family: Band 7/SPFH domain
domain: Flotillin-2
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 51.2 bits (122), Expect = 1e-07
 Identities = 18/121 (14%), Positives = 42/121 (34%), Gaps = 12/121 (9%)

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFN---------LENPGETLKQVSESAMREVVGRR 181
           + T +   + +       +   +  L           +++    + Q  E  +R ++G  
Sbjct: 24  VETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTL 83

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
               I++  R Q A  VR +    +     GI I + +I+D     +   +  + Q +  
Sbjct: 84  TVEQIYQ-DRDQFAKLVREVAAPDVGRM--GIEILSFTIKDVYDKVDYLSSLGKTQTSGP 140

Query: 242 D 242
            
Sbjct: 141 S 141


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target355 HflK protein [Candidatus Liberibacter asiaticus str. ps
d1wina_143 Flotillin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.65
>d1wina_ d.43.2.1 (A:) Flotillin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: EF-Ts domain-like
superfamily: Band 7/SPFH domain
family: Band 7/SPFH domain
domain: Flotillin-2
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.65  E-value=1.8e-17  Score=132.54  Aligned_cols=124  Identities=15%  Similarity=0.167  Sum_probs=106.4

Q ss_pred             EEEEEEEEEEEEEECCCCCCCCCCCEEEEECCCEEEEEEEEEEEEECCHHHHHH---------HHCCHHHHHHHHHHHHH
Q ss_conf             368722048999826722114766503660684188763443422158878532---------01298999988877767
Q gi|254780958|r  104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLF---------NLENPGETLKQVSESAM  174 (355)
Q Consensus       104 ~v~~v~v~~~~~~~~~~~~~~~~~~~~mLT~D~n~V~v~~~V~yrI~Dp~~~~~---------~v~~~~~~l~~~~esal  174 (355)
                      ++.+++.+.+.+++..+.+         +|+|+..|+|+++++|||.||.++++         ++.+++..++..++++|
T Consensus         6 s~~rislr~~~l~~~~q~v---------~TkD~v~v~V~a~v~~rV~~~~~~~~~a~~~~l~~~~~~~~~~i~~~~~~~l   76 (143)
T d1wina_           6 SGQRISLEIMTLQPRCEDV---------ETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHL   76 (143)
T ss_dssp             CCCSCCCSCEEECCCEEEE---------ECSSSCEEEECCEEEEEECCCSSCCHHHHHHHSSSCHHHHHHHHHHHHHHHH
T ss_pred             CEEEEEEEEEEECCCCCEE---------ECCCCCEEEEEEEEEEEECCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             5057652678615887367---------9789978999999999984808888888876503658899999999999999


Q ss_pred             HHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCHHHHHHHHHHHHHHH
Q ss_conf             77753010000015546788777999988863123461798753430156257899999999887
Q gi|254780958|r  175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA  239 (355)
Q Consensus       175 R~vvg~~~~d~ilt~~R~~i~~~v~~~lq~~l~~y~~GI~V~~V~i~~v~~P~~v~~A~~~v~~A  239 (355)
                      |+++|+++++++++ +|++|+.++++.+++.++.|  ||+|.+|+|+|++||+++.+|+...+.|
T Consensus        77 R~vig~~~l~el~~-~R~~i~~~v~~~i~~~l~~~--Gi~v~~v~I~dI~~~~~~~~a~~~~q~A  138 (143)
T d1wina_          77 RSILGTLTVEQIYQ-DRDQFAKLVREVAAPDVGRM--GIEILSFTIKDVYDKVDYLSSLGKTQTS  138 (143)
T ss_dssp             HHHHHHSCHHHHHH-THHHHHHHHHHHHHHHHTTT--TEEEEEEECCCEECTTCHHHHHCCCCCC
T ss_pred             HHHHCCCCHHHHHH-CHHHHHHHHHHHHHHHHHHH--CEEEEEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             98752366899985-79999999999999999973--8189899999618839999999999986



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 355 HflK protein [Candidatus Liberibacter asiaticus st
1win_A_143 (A:) Flotillin 2; BAND 7 domain, structural genomi 6e-15
2rpb_A_113 (A:) Hypothetical membrane protein; SPFH domain; N 2e-13
3bk6_A_1-114114 (A:1-114) PH stomatin; archaea, trimer, coiled- co 1e-10
>1win_A (A:) Flotillin 2; BAND 7 domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, cell adhesion; NMR {Mus musculus}Length = 143 Back     alignment and structure
 Score = 76.2 bits (187), Expect = 6e-15
 Identities = 18/151 (11%), Positives = 45/151 (29%), Gaps = 21/151 (13%)

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL- 159
                + + +     +              + T +   + +       +   +  L    
Sbjct: 3   SGSSGQRISLEIMTLQPRCED---------VETAEGVALTVTGVAQVKIMTEKELLAVAC 53

Query: 160 --------ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
                   ++    + Q  E  +R ++G      I++  R Q A  VR +    +     
Sbjct: 54  EQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQ-DRDQFAKLVREVAAPDVGRM-- 110

Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQD 242
           GI I + +I+D     +   +  + Q +   
Sbjct: 111 GIEILSFTIKDVYDKVDYLSSLGKTQTSGPS 141


>2rpb_A (A:) Hypothetical membrane protein; SPFH domain; NMR {Pyrococcus horikoshii}Length = 113 Back     alignment and structure
>3bk6_A (A:1-114) PH stomatin; archaea, trimer, coiled- coil, flotillin, SPFH, membrane fusion, trafficking, transmembrane, membrane protein; 3.20A {Pyrococcus horikoshii}Length = 114 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target355 HflK protein [Candidatus Liberibacter asiaticus str. ps
1win_A_143 Flotillin 2; BAND 7 domain, structural genomics, r 99.75
2rpb_A_113 Hypothetical membrane protein; SPFH domain; NMR {P 99.72
3bk6_A_1-114114 PH stomatin; archaea, trimer, coiled- coil, flotil 99.72
2kk7_A_52 V-type ATP synthase subunit E; A1AO ATP synthase, 92.15
>1win_A (A:) Flotillin 2; BAND 7 domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, cell adhesion; NMR {Mus musculus} Back     alignment and structure
Probab=99.75  E-value=2.6e-19  Score=147.32  Aligned_cols=132  Identities=14%  Similarity=0.123  Sum_probs=118.5

Q ss_pred             CCCCEEEEEEEEEEEEEECCCCCCCCCCCEEEEECCCEEEEEEEEEEEEECCHHHHHHH---------HCCHHHHHHHHH
Q ss_conf             75323687220489998267221147665036606841887634434221588785320---------129899998887
Q gi|254780958|r  100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN---------LENPGETLKQVS  170 (355)
Q Consensus       100 ppi~~v~~v~v~~~~~~~~~~~~~~~~~~~~mLT~D~n~V~v~~~V~yrI~Dp~~~~~~---------v~~~~~~l~~~~  170 (355)
                      +||+++.+++++.+.++++...+         +|+|+..+.+++++.|||.||..+++.         +.+++..|+..+
T Consensus         2 ~P~~~v~~~~~r~~~~~~~~~~v---------~T~D~~~i~v~~~~~~ri~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~   72 (143)
T 1win_A            2 SSGSSGQRISLEIMTLQPRCEDV---------ETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTL   72 (143)
T ss_dssp             CCCCCCCSCCCSCEEECCCEEEE---------ECSSSCEEEECCEEEEEECCCSSCCHHHHHHHSSSCHHHHHHHHHHHH
T ss_pred             CCCCCCEEEEEEEEEECCCCCEE---------ECCCCCEEEEEEEEEEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             98874158651678744887167---------878998899999999998480899988776432465889999999999


Q ss_pred             HHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             7767777530100000155467887779999888631234617987534301562578999999998878899
Q gi|254780958|r  171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDE  243 (355)
Q Consensus       171 esalR~vvg~~~~d~ilt~~R~~i~~~v~~~lq~~l~~y~~GI~V~~V~i~~v~~P~~v~~A~~~v~~A~qe~  243 (355)
                      ++++|+++|+++++++++ +|++++.++++.|++.++.|  ||+|.+|.|++++||+++.+|+++++.|++++
T Consensus        73 ~~~lr~~~~~~~~~~~~~-~r~~i~~~v~~~l~~~l~~~--Gi~i~~v~i~~i~~p~e~~~ai~~~~~Ae~~a  142 (143)
T 1win_A           73 EGHLRSILGTLTVEQIYQ-DRDQFAKLVREVAAPDVGRM--GIEILSFTIKDVYDKVDYLSSLGKTQTSGPSS  142 (143)
T ss_dssp             HHHHHHHHHHSCHHHHHH-THHHHHHHHHHHHHHHHTTT--TEEEEEEECCCEECTTCHHHHHCCCCCCCCCC
T ss_pred             HHHHHHHHCCCCHHHHHH-CHHHHHHHHHHHHHHHHHHH--CEEEEEEEEEECCCCHHHHHHHHHHHHHHHHC
T ss_conf             999999862166677760-89999999999999999650--05888999996388499999999999864434



>2rpb_A (A:) Hypothetical membrane protein; SPFH domain; NMR {Pyrococcus horikoshii} Back     alignment and structure
>3bk6_A (A:1-114) PH stomatin; archaea, trimer, coiled- coil, flotillin, SPFH, membrane fusion, trafficking, transmembrane, membrane protein; 3.20A {Pyrococcus horikoshii} Back     alignment and structure
>2kk7_A (A:) V-type ATP synthase subunit E; A1AO ATP synthase, ATP synthesis, hydrogen ION transport, ION transport, transport, hydrolase; NMR {Methanocaldococcus jannaschii} Back     alignment and structure