254780960

254780960

phosphoserine phosphatase SerB

GeneID in NCBI database:8209982Locus tag:CLIBASIA_04295
Protein GI in NCBI database:254780960Protein Accession:YP_003065373.1
Gene range:-(957481, 958374)Protein Length:297aa
Gene description:phosphoserine phosphatase SerB
COG prediction:[E] Phosphoserine phosphatase
KEGG prediction:phosphoserine phosphatase SerB; K01079 phosphoserine phosphatase [EC:3.1.3.3]
SEED prediction:Phosphoserine phosphatase (EC 3.1.3.3)
Pathway involved in KEGG:Methane metabolism [PATH:las00680]
Glycine, serine and threonine metabolism [PATH:las00260]
Subsystem involved in SEED:Glycine and Serine Utilization;
Serine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------
MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKILSIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNGEIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIAVGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEIVKSP
ccEEEEEEEccccccccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccccEEEEEcccccccHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHccccccccEEEEEccEEccccccccccccHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHccccEEEcccHHHHHHccHHHHcccHHHHHHHHcccHHHHHHcc
ccHHHHHHcccccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEccccccccEEEEcHHHHHEcccHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHcccccEHHHHHHHHHHcccEcccHHHHHHHHHHcccEEEEEEEEEHHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHcccHHHEEEEEccHHHHHHHHHccEEEEEcccHHHHccccEEEccccHHHHHEEEcccHHHHcccc
MALIATLithrshpilNISLVKQIMQIVNSSIFYWLADSiacdiilplegmidhHRSKILSIiadkpidlIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARamngeipfqdSLRERISLFKGTSTKIIDSLLEKkitynpggYELVHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANrfiekddrltgqvmepiidgTAKSQILLEAIQKLqinpedtiavgdgnndlDMLRVAgygvafhakpalaKQAKIRIDHSDLEALLYIQGykkdeivksp
MALIATLithrshpiLNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKILSIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARamngeipfqdslRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIAVGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYiqgykkdeivksp
MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKILSIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNGEIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIAVGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEIVKSP
MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKILSIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNGEIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIAVGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDE**K**
MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKILSIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNGEIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIAVGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEIVKSP
MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKILSIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNGEIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIAVGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEIVKS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKILSIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNGEIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIAVGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEIVKSP
MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKILSIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNGEIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIAVGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEIVKSP
MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKILSIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNGEIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIAVGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEIVKSP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target297 phosphoserine phosphatase SerB [Candidatus Liberibacter
315122497297 phosphoserine phosphatase SerB [Candidatus Liberibacter 1 1e-133
209550120296 phosphoserine phosphatase SerB [Rhizobium leguminosarum 1 3e-86
241205501296 phosphoserine phosphatase SerB [Rhizobium leguminosarum 1 1e-85
15889327296 phosphoserine phosphatase [Agrobacterium tumefaciens st 1 1e-85
325293408296 Phosphoserine phosphatase [Agrobacterium sp. H13-3] Len 1 3e-85
13471469336 phosphoserine phosphatase [Mesorhizobium loti MAFF30309 1 2e-84
148559262299 phosphoserine phosphatase SerB [Brucella ovis ATCC 2584 1 4e-84
116252993296 phosphoserine phosphatase [Rhizobium leguminosarum bv. 1 5e-84
86358398296 phosphoserine phosphatase protein [Rhizobium etli CFN 4 1 6e-84
225627844302 phosphoserine phosphatase SerB [Brucella ceti str. Cudo 1 6e-84
>gi|315122497|ref|YP_004062986.1| phosphoserine phosphatase SerB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 297 Back     alignment and organism information
 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/295 (78%), Positives = 265/295 (89%)

Query: 1   MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKIL 60
           MALIATLITHRS+ ILN SLVKQIMQ VNSS+FYWLADSI+C+IILP  G IDH++ KIL
Sbjct: 1   MALIATLITHRSNSILNNSLVKQIMQTVNSSMFYWLADSISCEIILPPHGTIDHYKQKIL 60

Query: 61  SIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNG 120
           SIIADKPIDL+IHRHENRRK LLIADMDSTMIEQECIDELAD IGIKE+VS +T+RAMNG
Sbjct: 61  SIIADKPIDLVIHRHENRRKILLIADMDSTMIEQECIDELADTIGIKEQVSRLTSRAMNG 120

Query: 121 EIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSI 180
           E+ FQDSLRER+SL KG STKII SL+EK+ITY PGGYELV+TMK+NGA TLLV+GGF+I
Sbjct: 121 EMSFQDSLRERVSLLKGISTKIIYSLIEKRITYTPGGYELVNTMKKNGAFTLLVSGGFTI 180

Query: 181 FARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIA 240
           FA  IAQHLGF+ Y+AN  IEK++ LTG+V+EPI+D  +KS+ILLE  + LQINPED IA
Sbjct: 181 FAHVIAQHLGFNHYHANNLIEKNEILTGEVLEPILDRESKSKILLETTKNLQINPEDAIA 240

Query: 241 VGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEIVK 295
           VGDG NDLDM+++AGYGVAFHAKPALA+QAKIRIDHSDLE+LLYIQGYK+ EIVK
Sbjct: 241 VGDGINDLDMIKLAGYGVAFHAKPALAEQAKIRIDHSDLESLLYIQGYKQHEIVK 295


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209550120|ref|YP_002282037.1| phosphoserine phosphatase SerB [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 296 Back     alignment and organism information
>gi|241205501|ref|YP_002976597.1| phosphoserine phosphatase SerB [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 296 Back     alignment and organism information
>gi|15889327|ref|NP_355008.1| phosphoserine phosphatase [Agrobacterium tumefaciens str. C58] Length = 296 Back     alignment and organism information
>gi|325293408|ref|YP_004279272.1| Phosphoserine phosphatase [Agrobacterium sp. H13-3] Length = 296 Back     alignment and organism information
>gi|13471469|ref|NP_103035.1| phosphoserine phosphatase [Mesorhizobium loti MAFF303099] Length = 336 Back     alignment and organism information
>gi|148559262|ref|YP_001259287.1| phosphoserine phosphatase SerB [Brucella ovis ATCC 25840] Length = 299 Back     alignment and organism information
>gi|116252993|ref|YP_768831.1| phosphoserine phosphatase [Rhizobium leguminosarum bv. viciae 3841] Length = 296 Back     alignment and organism information
>gi|86358398|ref|YP_470290.1| phosphoserine phosphatase protein [Rhizobium etli CFN 42] Length = 296 Back     alignment and organism information
>gi|225627844|ref|ZP_03785881.1| phosphoserine phosphatase SerB [Brucella ceti str. Cudo] Length = 302 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target297 phosphoserine phosphatase SerB [Candidatus Liberibacter
TIGR00338219 TIGR00338, serB, phosphoserine phosphatase SerB 2e-54
PRK11133322 PRK11133, serB, phosphoserine phosphatase; Provisional 2e-51
KOG1615227 KOG1615, KOG1615, KOG1615, Phosphoserine phosphatase [A 9e-39
TIGR01491201 TIGR01491, HAD-SF-IB-PSPlk, HAD-superfamily, subfamily- 2e-10
pfam00702190 pfam00702, Hydrolase, haloacid dehalogenase-like hydrol 8e-10
COG0546220 COG0546, Gph, Predicted phosphatases [General function 2e-06
TIGR02137203 TIGR02137, HSK-PSP, phosphoserine phosphatase/homoserin 9e-04
COG0637221 COG0637, COG0637, Predicted phosphatase/phosphohexomuta 0.001
COG0560212 COG0560, SerB, Phosphoserine phosphatase [Amino acid tr 4e-56
TIGR01488177 TIGR01488, HAD-SF-IB, Haloacid Dehalogenase superfamily 5e-24
PLN02954224 PLN02954, PLN02954, phosphoserine phosphatase 2e-23
COG4359220 COG4359, COG4359, Uncharacterized conserved protein [Fu 9e-05
TIGR01490202 TIGR01490, HAD-SF-IB-hyp1, HAD-superfamily subfamily IB 3e-11
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydrolase 6e-09
COG2217713 COG2217, ZntA, Cation transport ATPase [Inorganic ion t 7e-07
KOG0207 951 KOG0207, KOG0207, KOG0207, Cation transport ATPase [Ino 3e-06
PRK13582205 PRK13582, thrH, phosphoserine phosphatase; Provisional 5e-05
TIGR01454205 TIGR01454, AHBA_synth_RP, 3-amino-5-hydroxybenoic acid 2e-04
TIGR01525556 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-t 3e-04
TIGR01511562 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocat 6e-04
TIGR01494499 TIGR01494, ATPase_P-type, ATPase, P-type (transporting) 0.003
TIGR00099256 TIGR00099, Cof-subfamily, Cof subfamily of IIB subfamil 6e-08
PRK01158230 PRK01158, PRK01158, phosphoglycolate phosphatase; Provi 1e-07
pfam08282254 pfam08282, Hydrolase_3, haloacid dehalogenase-like hydr 2e-07
COG0561264 COG0561, Cof, Predicted hydrolases of the HAD superfami 3e-07
TIGR01482225 TIGR01482, SPP-subfamily, Sucrose-phosphate phosphatase 1e-06
TIGR01487215 TIGR01487, SPP-like, sucrose-phosphate phosphatase-like 4e-06
TIGR01484204 TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, subfa 1e-04
PLN02887580 PLN02887, PLN02887, hydrolase family protein 6e-04
PRK10513270 PRK10513, PRK10513, sugar phosphate phosphatase; Provis 0.003
COG2216 681 COG2216, KdpB, High-affinity K+ transport system, ATPas 2e-04
TIGR01497 675 TIGR01497, kdpB, K+-transporting ATPase, B subunit 0.001
>gnl|CDD|161826 TIGR00338, serB, phosphoserine phosphatase SerB Back     alignment and domain information
>gnl|CDD|182988 PRK11133, serB, phosphoserine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|36828 KOG1615, KOG1615, KOG1615, Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162388 TIGR01491, HAD-SF-IB-PSPlk, HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>gnl|CDD|144342 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|30892 COG0546, Gph, Predicted phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|162723 TIGR02137, HSK-PSP, phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>gnl|CDD|30982 COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>gnl|CDD|30906 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162386 TIGR01488, HAD-SF-IB, Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>gnl|CDD|178540 PLN02954, PLN02954, phosphoserine phosphatase Back     alignment and domain information
>gnl|CDD|34074 COG4359, COG4359, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|162387 TIGR01490, HAD-SF-IB-hyp1, HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>gnl|CDD|32399 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|35428 KOG0207, KOG0207, KOG0207, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184163 PRK13582, thrH, phosphoserine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|130521 TIGR01454, AHBA_synth_RP, 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>gnl|CDD|162399 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|130575 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|162389 TIGR01494, ATPase_P-type, ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>gnl|CDD|161707 TIGR00099, Cof-subfamily, Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>gnl|CDD|179236 PRK01158, PRK01158, phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|116866 pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|30907 COG0561, Cof, Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|162384 TIGR01482, SPP-subfamily, Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>gnl|CDD|130551 TIGR01487, SPP-like, sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>gnl|CDD|162385 TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>gnl|CDD|178475 PLN02887, PLN02887, hydrolase family protein Back     alignment and domain information
>gnl|CDD|182509 PRK10513, PRK10513, sugar phosphate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|32398 COG2216, KdpB, High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130561 TIGR01497, kdpB, K+-transporting ATPase, B subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 297 phosphoserine phosphatase SerB [Candidatus Liberibacter
PRK11133322 serB phosphoserine phosphatase; Provisional 100.0
TIGR01522 856 ATPase-IIA2_Ca calcium-transporting P-type ATPase, PMR1 99.97
TIGR01511545 ATPase-IB1_Cu copper-translocating P-type ATPase; Inter 99.96
TIGR01494478 ATPase_P-type ATPase, P-type (transporting), HAD superf 99.95
TIGR01523 1001 ATPase-IID_K-Na potassium/sodium efflux P-type ATPase, 99.91
TIGR00099270 Cof-subfamily Cof-like hydrolase; InterPro: IPR000150 T 99.89
TIGR01524 892 ATPase-IIIB_Mg magnesium-translocating P-type ATPase; I 99.89
PRK10976266 putative sugar phosphatase; Provisional 99.87
PRK10530272 phosphotransferase; Provisional 99.87
pfam08282254 Hydrolase_3 haloacid dehalogenase-like hydrolase. This 99.85
PRK10513270 sugar phosphatase; Provisional 99.85
COG0561264 Cof Predicted hydrolases of the HAD superfamily [Genera 99.77
TIGR01487223 SPP-like SPP-like hydrolase, Archaeal; InterPro: IPR006 99.58
TIGR00338223 serB phosphoserine phosphatase SerB; InterPro: IPR00446 100.0
COG0560212 SerB Phosphoserine phosphatase [Amino acid transport an 100.0
PRK13582205 thrH phosphoserine phosphatase; Provisional 100.0
KOG1615227 consensus 100.0
TIGR01512494 ATPase-IB2_Cd cadmium-translocating P-type ATPase; Inte 99.93
TIGR01490204 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, 99.88
TIGR01491203 HAD-SF-IB-PSPlk Phosphoserine phosphatase-like hydrolas 99.85
PRK13223272 phosphoglycolate phosphatase; Provisional 99.74
PRK13226221 phosphoglycolate phosphatase; Provisional 99.55
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosphotra 99.55
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.5
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-ph 99.49
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.49
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade of s 99.44
PRK09484186 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; P 99.42
COG1778170 Low specificity phosphatase (HAD superfamily) [General 99.12
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.1
PRK13225273 phosphoglycolate phosphatase; Provisional 99.1
PRK11590211 hypothetical protein; Provisional 98.93
COG0637221 Predicted phosphatase/phosphohexomutase [General functi 98.87
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphat 98.86
PRK08238 481 hypothetical protein; Validated 98.67
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomocyste 98.66
PRK09456199 phosphatase; Provisional 97.24
KOG2914222 consensus 97.23
KOG3085237 consensus 96.8
TIGR01116 800 ATPase-IIA1_Ca calcium-translocating P-type ATPase, SER 99.97
COG0474 917 MgtA Cation transport ATPase [Inorganic ion transport a 99.96
TIGR01517 885 ATPase-IIB_Ca calcium-translocating P-type ATPase, PMCA 99.96
TIGR01647 835 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPa 99.96
PRK10517 900 magnesium-transporting ATPase MgtA; Provisional 99.95
PRK10671834 copA copper exporting ATPase; Provisional 99.95
PRK01122 684 potassium-transporting ATPase subunit B; Provisional 99.95
COG2217713 ZntA Cation transport ATPase [Inorganic ion transport a 99.94
TIGR01525639 ATPase-IB_hvy heavy metal translocating P-type ATPase; 99.94
KOG0202 972 consensus 99.94
PRK11033739 zntA zinc/cadmium/mercury/lead-transporting ATPase; Pro 99.93
KOG0207 951 consensus 99.91
TIGR01497 675 kdpB K+-transporting ATPase, B subunit; InterPro: IPR00 99.9
KOG0204 1034 consensus 99.88
COG2216 681 KdpB High-affinity K+ transport system, ATPase chain B 99.82
KOG0203 1019 consensus 99.82
KOG0205 942 consensus 99.71
PRK13227228 consensus 99.66
TIGR01106 998 ATPase-IIC_X-K Na,H/K antiporter P-type ATPase, alpha s 99.65
PRK13222228 phosphoglycolate phosphatase; Provisional 99.62
PRK13229234 consensus 99.59
PRK13288214 pyrophosphatase PpaX; Provisional 99.55
PRK13228232 consensus 99.55
COG0546220 Gph Predicted phosphatases [General function prediction 99.5
TIGR01652 1249 ATPase-Plipid phospholipid-translocating P-type ATPase, 99.39
KOG0209 1160 consensus 99.38
KOG0206 1151 consensus 99.31
PRK11587218 putative phosphatase; Provisional 99.31
PRK13224216 consensus 99.3
COG4087152 Soluble P-type ATPase [General function prediction only 99.29
TIGR01449230 PGP_bact phosphoglycolate phosphatase, bacterial; Inter 99.2
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.18
KOG0210 1051 consensus 99.15
KOG0208 1140 consensus 99.06
COG4030315 Uncharacterized protein conserved in archaea [Function 98.95
PRK09449225 nucleotidase; Provisional 98.72
TIGR02253244 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR0225 98.65
PRK10748238 flavin mononucleotide phosphatase; Provisional 98.29
pfam05822246 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1). This family 97.44
PRK06769175 hypothetical protein; Validated 97.22
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validated 97.18
KOG3128298 consensus 94.94
TIGR00213178 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase; Int 92.17
TIGR02471241 sucr_syn_bact_C sucrose phosphate synthase, sucrose pho 90.64
TIGR01488204 HAD-SF-IB HAD-superfamily hydrolase, subfamily IB (PSPa 99.86
TIGR01657 1350 P-ATPase-V P-type ATPase of unknown pump specificity (t 99.45
pfam06888234 Put_Phosphatase Putative Phosphatase. This family conta 99.32
KOG3120256 consensus 99.14
TIGR01489207 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane p 98.99
COG4359220 Uncharacterized conserved protein [Function unknown] 98.88
PRK10725188 fructose-1-phosphatase; Provisional 98.83
TIGR01990190 bPGM beta-phosphoglucomutase; InterPro: IPR010972 This 98.1
TIGR02009211 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase; 97.99
TIGR01549151 HAD-SF-IA-v1 HAD-superfamily hydrolase, subfamily IA, v 97.88
TIGR01428207 HAD_type_II haloacid dehalogenase, type II; InterPro: I 97.6
TIGR01509156 HAD-SF-IA-v3 HAD-superfamily hydrolase, subfamily IA, v 97.28
TIGR01544287 HAD-SF-IE HAD-superfamily (subfamily IE) hydrolase, TIG 97.12
TIGR01668196 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phospha 96.18
TIGR01656208 Histidinol-ppas histidinol-phosphate phosphatase family 96.17
TIGR01672248 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR 95.61
TIGR01663 526 PNK-3'Pase polynucleotide kinase 3'-phosphatase; InterP 94.91
TIGR01545210 YfhB_g-proteo HAD superfamily (subfamily IF) hydrolase, 94.86
TIGR01684323 viral_ppase viral phosphatase; InterPro: IPR007827 This 92.22
TIGR01685183 MDP-1 magnesium-dependent phosphatase-1; InterPro: IPR0 91.26
PRK01158226 phosphoglycolate phosphatase; Provisional 99.81
PRK00192275 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.77
pfam05116247 S6PP Sucrose-6F-phosphate phosphohydrolase. This family 99.74
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 96.25
PRK10444248 UMP phosphatase; Provisional 95.09
COG3769274 Predicted hydrolase (HAD superfamily) [General function 94.41
pfam02358235 Trehalose_PPase Trehalose-phosphatase. This family cons 90.89
pfam00702190 Hydrolase haloacid dehalogenase-like hydrolase. This fa 99.44
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. The hal 99.16
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.67
COG1011229 Predicted hydrolase (HAD superfamily) [General function 98.11
TIGR02254233 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIG 97.9
TIGR01662171 HAD-SF-IIIA hydrolase, HAD-superfamily, subfamily IIIA; 97.53
COG2179175 Predicted hydrolase of the HAD superfamily [General fun 97.47
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidinol pho 97.2
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta subun 97.16
TIGR01993205 Pyr-5-nucltdase pyrimidine 5'-nucleotidase; InterPro: I 96.85
COG0241181 HisB Histidinol phosphatase and related phosphatases [A 96.5
TIGR01485257 SPP_plant-cyano sucrose phosphatase; InterPro: IPR01284 96.21
TIGR01548245 HAD-SF-IA-hyp1 HAD superfamily (subfamily IA) hydrolase 96.08
TIGR01454206 AHBA_synth_RP AHBA synthesis associated protein; InterP 95.84
COG3700237 AphA Acid phosphatase (class B) [General function predi 95.52
pfam09419166 DUF2010 Protein of unknown function. This is a family o 95.33
pfam11019251 DUF2608 Protein of unknown function (DUF2608). This fam 95.21
PRK11009235 aphA acid phosphatase/phosphotransferase; Provisional 94.59
TIGR01261165 hisB_Nterm histidinol-phosphatase; InterPro: IPR005954 94.51
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharomyces 93.9
pfam03767230 Acid_phosphat_B HAD superfamily, subfamily IIIB (Acid p 93.01
pfam08645158 PNK3P Polynucleotide kinase 3 phosphatase. Polynucleoti 92.29
TIGR02252224 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydro 92.16
TIGR02247228 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like ph 91.86
pfam08235156 LNS2 LNS2 (Lipin/Ned1/Smp2). This domain is found in Sa 91.18
KOG3109244 consensus 90.39
TIGR01482247 SPP-subfamily Sucrose-phosphate phosphatase subfamily; 99.15
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.26
TIGR01484261 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB; In 97.89
TIGR02461248 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase; 97.48
TIGR02463224 MPGP_rel mannosyl-3-phosphoglycerate phosphatase homolo 97.02
PRK10530272 phosphotransferase; Provisional 96.64
PRK10513 270 sugar phosphatase; Provisional 95.89
COG0561264 Cof Predicted hydrolases of the HAD superfamily [Genera 95.85
PRK10976 266 putative sugar phosphatase; Provisional 94.91
pfam06941191 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic typ 91.45
PRK01158226 phosphoglycolate phosphatase; Provisional 95.21
pfam05116247 S6PP Sucrose-6F-phosphate phosphohydrolase. This family 94.52
PRK00192275 mannosyl-3-phosphoglycerate phosphatase; Reviewed 94.48
cd0487184 ACT_PSP_2 ACT domains found N-terminal of phosphoserine 91.02
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca calcium-transporting P-type ATPase, PMR1-type; InterPro: IPR006413 This family describes the P-type ATPase responsible for translocating calcium ions across the golgi membrane of fungi and animals , , and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-translocating P-type ATPase; InterPro: IPR006403 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC; InterPro: IPR001757 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium/sodium efflux P-type ATPase, fungal-type; InterPro: IPR006414 Initially described as a calcium efflux ATPase , more recent work has shown that the Schizosaccharomyces pombe CTA3 gene is in fact a potassium ion efflux pump Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof-like hydrolase; InterPro: IPR000150 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase; InterPro: IPR006415 This group describes the magnesium translocating P-type ATPase found in a limited number of bacterial species and best described in Salmonella typhimurium, which contains two isoforms Back     alignment and domain information
>PRK10976 putative sugar phosphatase; Provisional Back     alignment and domain information
>PRK10530 phosphotransferase; Provisional Back     alignment and domain information
>pfam08282 Hydrolase_3 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PRK10513 sugar phosphatase; Provisional Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01487 SPP-like SPP-like hydrolase, Archaeal; InterPro: IPR006382 This group of Archaeal sequences is most closely related to the sucrose-phosphate phosphatases (SPP) from plants and cyanobacteria Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB; InterPro: IPR004469 Phosphoserine phosphatase (SerB), (3 Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>KOG1615 consensus Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd cadmium-translocating P-type ATPase; InterPro: IPR006404 These sequences describe the P-type ATPase primarily responsible for translocating cadmium ions (and other closely-related divalent heavy metals such as cobalt, mercury, lead and zinc) across biological membranes Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490; InterPro: IPR006385 This group of sequences belong to the IB subfamily of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk Phosphoserine phosphatase-like hydrolase, archaeal; InterPro: IPR006386 This group of sequences belong to the IB subfamily of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein; InterPro: IPR011863 This protein is has been characterised as both a phosphoserine phosphatase and a phosphoserine:homoserine phosphotransferase Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family; InterPro: IPR010023 This entry is a part of the haloacid dehalogenase (HAD) superfamily of hydrolases from beta, gamma and epsilon proteobacteria, Aquifex, Fusobacterium, Porphyromonas and Methanosarcina Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PRK09456 phosphatase; Provisional Back     alignment and domain information
>KOG2914 consensus Back     alignment and domain information
>KOG3085 consensus Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca calcium-translocating P-type ATPase, SERCA-type; InterPro: IPR005782 This model describes Ca2+ ATPases (3 Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca calcium-translocating P-type ATPase, PMCA-type; InterPro: IPR006408 This family describes the P-type ATPase responsible for translocating calcium ions across the plasma membrane of eukaryotes , out of the cell Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase; InterPro: IPR006534 These sequences represent the plasma membrane proton efflux P-type ATPase found in plants, fungi, protozoa, slime molds and archaea Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase; InterPro: IPR006416 This group encompasses the copper and cadmium-type heavy metal transporting P-type ATPases as well as those which cannot be assigned to one or other of the groups Back     alignment and domain information
>KOG0202 consensus Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit; InterPro: IPR006391 These sequences describe the P-type ATPase subunit of the complex responsible for translocating potassium ions across biological membranes in microbes Back     alignment and domain information
>KOG0204 consensus Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0203 consensus Back     alignment and domain information
>KOG0205 consensus Back     alignment and domain information
>PRK13227 consensus Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K Na,H/K antiporter P-type ATPase, alpha subunit; InterPro: IPR005775 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13229 consensus Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK13228 consensus Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase; InterPro: IPR006539 These sequences represent the P-type ATPase responsible for transporting phospholipids from one leaflet of bilayer membranes to the other Back     alignment and domain information
>KOG0209 consensus Back     alignment and domain information
>KOG0206 consensus Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK13224 consensus Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR01449 PGP_bact phosphoglycolate phosphatase, bacterial; InterPro: IPR006346 This family of sequences represent 2-phosphoglycolate phosphatase which is limited to the prokaryotes Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>KOG0210 consensus Back     alignment and domain information
>KOG0208 consensus Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK09449 nucleotidase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253; InterPro: IPR011950 This family of sequences from archaea and metazoans includes the human uncharacterised protein CTE7 Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>pfam05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1) Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>KOG3128 consensus Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase; InterPro: IPR004446 In a number of species, including Escherichia coli, the histidine biosynthetic enzymes imidazole glycerol phosphate dehydratase and histidinol phosphatase are found together in the bifunctional protein HisB Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain; InterPro: IPR012821 Sucrose phosphate synthase (SPS) and sucrose phosphate phosphatase (SPP) are the last two enzymes of sucrose biosynthesis Back     alignment and domain information
>TIGR01488 HAD-SF-IB HAD-superfamily hydrolase, subfamily IB (PSPase-like); InterPro: IPR006383 This group represents a subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V); InterPro: IPR006544 These P-type ATPases form a distinct clade but the substrate of their pumping activity has yet to be determined Back     alignment and domain information
>pfam06888 Put_Phosphatase Putative Phosphatase Back     alignment and domain information
>KOG3120 consensus Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase; InterPro: IPR006384 This group of sequences belong to the IB subfamily of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10725 fructose-1-phosphatase; Provisional Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase; InterPro: IPR010972 This model represents the beta-phosphoglucomutase enzyme which catalyses the interconversion of beta-D-glucose-1-phosphate and beta-D-glucose-6-phosphate Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase; InterPro: IPR010976 Phosphoglucomutases interconvert D-glucose 1-phosphate and D-glucose 6-phosphate, a reaction which is important for energy metabolism in many organisms and for cell wall biosynthesis in bacteria , Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 HAD-superfamily hydrolase, subfamily IA, variant 1; InterPro: IPR006439 This family represents part of one structural subfamily of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>TIGR01428 HAD_type_II haloacid dehalogenase, type II; InterPro: IPR006328 These proteins catalyze the hydrolytic dehalogenation of small L-2-haloalkanoic acids to yield the corresponding D-2-hydroxyalkanoic acids Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 HAD-superfamily hydrolase, subfamily IA, variant 3; InterPro: IPR006402 This group of sequences represent part of one structural subfamily of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>TIGR01544 HAD-SF-IE HAD-superfamily (subfamily IE) hydrolase, TIGR01544; InterPro: IPR006434 This family is a small group of metazoan sequences with one sequence from Arabidopsis thaliana Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain; InterPro: IPR006543 This is a group of authentic histidinol-phosphate phosphatases which are sometimes found as stand-alone entities and sometimes as fusions with imidazoleglycerol-phosphate dehydratase Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672; InterPro: IPR010025 This family of proteins is a member of the IIIB subfamily (IPR001001 from INTERPRO) of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide kinase 3'-phosphatase; InterPro: IPR006550 These sequences represent the metazoan 5'-polynucleotide-kinase-3'-phosphatase, PNKP, which is believed to be involved in repair of oxidative DNA damage Back     alignment and domain information
>TIGR01545 YfhB_g-proteo HAD superfamily (subfamily IF) hydrolase, YfhB; InterPro: IPR006435 This group describes a clade of sequences limited to the gamma proteobacteria Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase; InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>pfam05116 S6PP Sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>pfam02358 Trehalose_PPase Trehalose-phosphatase Back     alignment and domain information
>pfam00702 Hydrolase haloacid dehalogenase-like hydrolase Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254; InterPro: IPR011951 This family consists of uncharacterised proteobacterial and Gram-positive bacterial sequences including YjjG from Escherichia coli and YfnB from Bacillus subtilis Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA hydrolase, HAD-superfamily, subfamily IIIA; InterPro: IPR006549 This group of proteins is a part of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit; InterPro: IPR014098 Members of this protein family are the delta subunit of phenylphosphate carboxylase Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase; InterPro: IPR010237 This family of proteins includes the SDT1/SSM1 gene from yeast, which has been shown to code for a pyrimidine (UMP/CMP) 5'nucleotidase Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose phosphatase; InterPro: IPR012847 This entry describes the sucrose phosphate phosphohydrolase from plants and cyanobacteria (SPP) Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 HAD superfamily (subfamily IA) hydrolase, TIGR01548; InterPro: IPR006438 This entry represents a small and phylogenetically curious clade of sequences Back     alignment and domain information
>TIGR01454 AHBA_synth_RP AHBA synthesis associated protein; InterPro: IPR006351 The enzymes in this family are all located in the operons for the biosynthesis of 3-amino-5-hydroxybenzoic acid (AHBA), which is a precursor of several antibiotics including ansatrienin , naphthomycin , rifamycin and mitomycin Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>pfam09419 DUF2010 Protein of unknown function Back     alignment and domain information
>pfam11019 DUF2608 Protein of unknown function (DUF2608) Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase; InterPro: IPR005954 This entry describes a histidinol phosphatase domain Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>pfam03767 Acid_phosphat_B HAD superfamily, subfamily IIIB (Acid phosphatase) Back     alignment and domain information
>pfam08645 PNK3P Polynucleotide kinase 3 phosphatase Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase; InterPro: IPR011949 This family of proteins includes uncharacterised sequences from eukaryotes, cyanobacteria and Leptospira as well as the DREG-2 protein from Drosophila melanogaster which has been identified as a rhythmically (diurnally) regulated gene Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase; InterPro: IPR011945 This entry represents a small clade of sequences from the metazoa and bacteria Back     alignment and domain information
>pfam08235 LNS2 LNS2 (Lipin/Ned1/Smp2) Back     alignment and domain information
>KOG3109 consensus Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily; InterPro: IPR006378 This family of sequences includes both the members of the sucrose-phosphate phosphatase (SPP) family, encompassing plants and cyanobacteria, as well as those archaeal sequences which are the closest relatives Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB; InterPro: IPR006379 This subfamily falls within the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase; InterPro: IPR012813 Members of this family are mannosyl-3-phosphoglycerate phosphatase (3 Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase homolog; InterPro: IPR012815 This family consists of members of the HAD superfamily, subfamily IIB Back     alignment and domain information
>PRK10530 phosphotransferase; Provisional Back     alignment and domain information
>PRK10513 sugar phosphatase; Provisional Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK10976 putative sugar phosphatase; Provisional Back     alignment and domain information
>pfam06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C) Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>pfam05116 S6PP Sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target297 phosphoserine phosphatase SerB [Candidatus Liberibacter
3p96_A415 Crystal Structure Of Phosphoserine Phosphatase Serb 6e-38
1f5s_A211 Crystal Structure Of Phosphoserine Phosphatase From 2e-33
1j97_A211 Phospho-Aspartyl Intermediate Analogue Of Phosphose 2e-32
3n28_A335 Crystal Structure Of Probable Phosphoserine Phospha 9e-32
1l7m_A211 High Resolution Liganded Structure Of Phosphoserine 4e-31
1l7o_A211 Crystal Structure Of Phosphoserine Phosphatase In A 3e-30
3m1y_A217 Crystal Structure Of A Phosphoserine Phosphatase (S 7e-23
1l8l_A225 Molecular Basis For The Local Confomational Rearran 9e-18
1nnl_A225 Crystal Structure Of Human Phosphoserine Phosphatas 1e-17
1mhs_A 920 Model Of Neurospora Crassa Proton Atpase Length = 9 8e-11
3a1c_A287 Crystal Structure Of The P- And N-Domains Of Copa, 5e-16
3a1e_A287 Crystal Structure Of The P- And N-Domains Of His462 7e-16
2b8e_A273 Copa Atp Binding Domain Length = 273 3e-15
>gi|311772289|pdb|3P96|A Chain A, Crystal Structure Of Phosphoserine Phosphatase Serb From Mycobacterium Avium, Native Form Length = 415 Back     alignment and structure
 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 87/298 (29%), Positives = 156/298 (52%), Gaps = 7/298 (2%)

Query: 2   ALIATLITHRSHPILNISLVKQIMQI-VNSSIFYWLA--DSIACDIILPLEGMID-HHRS 57
                ++          ++ +++  + VN  +   ++    I  ++ + +    D   R+
Sbjct: 101 THTIFVLGRPITAAAFGAVAREVAALGVNIDLIRGVSDYPVIGLELRVSVPPGADEALRT 160

Query: 58  KILSIIADKPIDLIIHRH--ENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITA 115
            +  + +++ +D+ +  +  E R K L++ D+DST+++ E I+ LA   G + +V+ IT 
Sbjct: 161 ALNRVSSEEHVDVAVEDYTLERRAKRLIVFDVDSTLVQGEVIEMLAAKAGAEGQVAAITD 220

Query: 116 RAMNGEIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVT 175
            AM GE+ F  SL++R++   G    +ID  +  ++   PG    + T+++ G +  +V+
Sbjct: 221 AAMRGELDFAQSLQQRVATLAGLPATVIDE-VAGQLELMPGARTTLRTLRRLGYACGVVS 279

Query: 176 GGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINP 235
           GGF      +A+ L  D   AN     D  LTG+V+ PIID   K+  L E  Q+  +  
Sbjct: 280 GGFRRIIEPLAEELMLDYVAANELEIVDGTLTGRVVGPIIDRAGKATALREFAQRAGVPM 339

Query: 236 EDTIAVGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEI 293
             T+AVGDG ND+DML  AG G+AF+AKPAL + A   + H  L+ +L++ G  + EI
Sbjct: 340 AQTVAVGDGANDIDMLAAAGLGIAFNAKPALREVADASLSHPYLDTVLFLLGVTRGEI 397


gi|14719642|pdb|1F5S|A Chain A, Crystal Structure Of Phosphoserine Phosphatase From Methanococcus Jannaschii Length = 211 Back     alignment and structure
>gi|15826095|pdb|1J97|A Chain A, Phospho-Aspartyl Intermediate Analogue Of Phosphoserine Phosphatase Length = 211 Back     alignment and structure
>gi|300508730|pdb|3N28|A Chain A, Crystal Structure Of Probable Phosphoserine Phosphatase From Vibrio Cholerae, Unliganded Form Length = 335 Back     alignment and structure
>gi|20151215|pdb|1L7M|A Chain A, High Resolution Liganded Structure Of Phosphoserine Phosphatase (Pi Complex) Length = 211 Back     alignment and structure
>gi|21730680|pdb|1L7O|A Chain A, Crystal Structure Of Phosphoserine Phosphatase In Apo Form Length = 211 Back     alignment and structure
>gi|291463734|pdb|3M1Y|A Chain A, Crystal Structure Of A Phosphoserine Phosphatase (Serb) From Helicobacter Pylori Length = 217 Back     alignment and structure
>gi|29726390|pdb|1L8L|A Chain A, Molecular Basis For The Local Confomational Rearrangement Of Human Phosphoserine Phosphatase Length = 225 Back     alignment and structure
>gi|31615696|pdb|1NNL|A Chain A, Crystal Structure Of Human Phosphoserine Phosphatase Length = 225 Back     alignment and structure
gi|24159070|pdb|1MHS|A Chain A, Model Of Neurospora Crassa Proton Atpase Length = 920 Back     alignment and structure
>gi|254574775|pdb|3A1C|A Chain A, Crystal Structure Of The P- And N-Domains Of Copa, A Copper- Transporting P-Type Atpase, Bound With Amppcp-Mg Length = 287 Back     alignment and structure
>gi|254574779|pdb|3A1E|A Chain A, Crystal Structure Of The P- And N-Domains Of His462gln Mutant Copa, A Copper-Transporting P-Type Atpase, Bound With Amppcp-Mg Length = 287 Back     alignment and structure
>gi|85544229|pdb|2B8E|A Chain A, Copa Atp Binding Domain Length = 273 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target297 phosphoserine phosphatase SerB [Candidatus Liberibacter
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, struct 2e-61
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural geno 5e-51
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phop 2e-40
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phosphose 1e-30
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-helix bu 3e-30
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspar 6e-28
3fvv_A232 Uncharacterized protein; unknown function, structural g 1e-27
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1- phosphate phos 6e-25
1y8a_A332 Hypothetical protein AF1437; structural genomics, prote 3e-24
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid, nia 4e-23
1l6r_A227 Hypothetical protein TA0175; structural genomics, putat 6e-14
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloacid d 2e-11
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD superfa 2e-11
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core domain, 4e-09
3dao_A283 Putative phosphatse; RER070207001050, structural genomi 9e-09
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; PF0511 4e-08
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD famil 8e-08
3dnp_A290 Stress response protein YHAX; structural genomics, PSI- 6e-07
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant 1; ssg 7e-07
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabolism, 1e-05
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; structur 3e-05
1o08_A221 Beta-phosphoglucomutase; haloacid dehalogenase superfam 1e-04
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A { 3e-04
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural geno 5e-04
2g09_A297 Cytosolic 5'-nucleotidase III; uniprot Q9D020, UMPH-1, 4e-13
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; I 7e-11
3mmz_A176 Putative HAD family hydrolase; structural genomics, pro 5e-08
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid 9e-07
1qyi_A384 ZR25, hypothetical protein; structural genomics, PSI, p 5e-06
3mn1_A189 Probable YRBI family phosphatase; structural genomics, 2e-05
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; structural 6e-05
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; stru 4e-04
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition state ana 4e-04
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphatase; s 0.003
3niw_A279 Haloacid dehalogenase-like hydrolase; structural genomi 4e-08
1nrw_A