peg_887

peg_887

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(958373, 958774)Protein Length:133aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:tRNA delta(2)-isopentenylpyrophosphate transferase (EC 2.5.1.8)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA processing
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MMMMFLSTHTKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQKSYSTGKWLRYAIKKIAEVQKTVFTYNSRWDRSLFSCINRSTLYYARNTYCNKRKDT
cccccccccccEEEEEccccccHHHHHHHHHHHcccEEEEccHHHHHcccccccccccHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccHHHHHHHHHccccccc
cHHHHHcccccEEEEEccccccHHHHHHHHHHHcccEEEEcccHHHEcccccccccccHHHHHcccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccHHHHHHHHHccccccc
MMMMFLSTHTKaifisgptasgkslCAVNLAHKFngaiinadsmqVYDTLRIltsrpsdqdmqsiphylygyvpaqksystgKWLRYAIKKIAEVQKTVFTYnsrwdrslfscinrstlyyarntycnkrkdt
MMMMFLSTHTKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSrpsdqdmqSIPHYLYGYVPAQKSYSTGKWLRYAIKKIAEVQKTVftynsrwdrslfscinrstlyyarntycnkrkdt
MMMMFLSTHTKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQKSYSTGKWLRYAIKKIAEVQKTVFTYNSRWDRSLFSCINRSTLYYARNTYCNKRKDT
*************FISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQKSYSTGKWLRYAIKKIAEVQKTVFTYNSRWDRSLFSCINRSTLYYARNTYCNKRKD*
********HTKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQKSYSTGKWLRYAIKKIAEVQKTVFTYNSRWDRSLFSCINRSTLYYARNTYCNKRKDT
MMM*FLSTHTKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQKSYSTGKWLRYAIKKIAEVQKTVFTYNSRWDRSLFSCINRSTLYYARNTYCNK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MMMMFLSTHTKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQKSYSTGKWLRYAIKKIAEVQKTVFTYNSRWDRSLFSCINRSTLYYARNTYCNKRKDT
MMMMFLSTHTKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQKSYSTGKWLRYAIKKIAEVQKTVFTYNSRWDRSLFSCINRSTLYYARNTYCNKRKDT
MMMMFLSTHTKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQKSYSTGKWLRYAIKKIAEVQKTVFTYNSRWDRSLFSCINRSTLYYARNTYCNKRKDT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target133
315122496 303 tRNA delta(2)-isopentenylpyrophosphate transferase [Can 1 9e-43
218674370 298 tRNA delta(2)-isopentenylpyrophosphate transferase [Rhi 1 1e-27
218458281213 tRNA delta(2)-isopentenylpyrophosphate transferase [Rhi 1 2e-27
190892521 297 tRNA delta(2)-isopentenylpyrophosphate transferase prot 1 2e-27
327189898 297 tRNA delta(2)-isopentenylpyrophosphate transferase prot 1 4e-27
86358397 297 tRNA delta(2)-isopentenylpyrophosphate transferase [Rhi 1 5e-27
116252992 297 tRNA delta(2)-isopentenylpyrophosphate transferase [Rhi 1 7e-27
241205500 297 tRNA delta(2)-isopentenylpyrophosphate transferase [Rhi 1 8e-27
159185023 298 tRNA delta(2)-isopentenylpyrophosphate transferase [Agr 1 1e-26
209550119 297 tRNA delta(2)-isopentenylpyrophosphate transferase [Rhi 1 1e-26
>gi|315122496|ref|YP_004062985.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 303 Back     alignment and organism information
 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (92%)

Query: 2  MMMFLSTHTKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQD 61
          MMMFLST TKAI I+GPTASGKS+CA+ LA K NGAIINADSMQVYDTL+ILTSRPSDQD
Sbjct: 1  MMMFLSTDTKAILIAGPTASGKSMCALKLAQKLNGAIINADSMQVYDTLKILTSRPSDQD 60

Query: 62 MQSIPHYLYGYVPAQKSYSTGKWLRYAIKKIAEVQK 97
          MQSIPHYLYG+VPAQ++YSTGKWLR AIKKI EVQK
Sbjct: 61 MQSIPHYLYGHVPAQQAYSTGKWLRCAIKKITEVQK 96


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218674370|ref|ZP_03524039.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium etli GR56] Length = 298 Back     alignment and organism information
>gi|218458281|ref|ZP_03498372.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium etli Kim 5] Length = 213 Back     alignment and organism information
>gi|190892521|ref|YP_001979063.1| tRNA delta(2)-isopentenylpyrophosphate transferase protein [Rhizobium etli CIAT 652] Length = 297 Back     alignment and organism information
>gi|327189898|gb|EGE57029.1| tRNA delta(2)-isopentenylpyrophosphate transferase protein [Rhizobium etli CNPAF512] Length = 297 Back     alignment and organism information
>gi|86358397|ref|YP_470289.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium etli CFN 42] Length = 297 Back     alignment and organism information
>gi|116252992|ref|YP_768830.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium leguminosarum bv. viciae 3841] Length = 297 Back     alignment and organism information
>gi|241205500|ref|YP_002976596.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 297 Back     alignment and organism information
>gi|159185023|ref|NP_355007.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium tumefaciens str. C58] Length = 298 Back     alignment and organism information
>gi|209550119|ref|YP_002282036.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 297 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target133
PRK00091 307 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate 3e-30
TIGR00174 287 TIGR00174, miaA, tRNA isopentenyltransferase (miaA) 3e-20
KOG1384 348 KOG1384, KOG1384, KOG1384, tRNA delta(2)-isopentenylpyr 2e-19
PLN02840 421 PLN02840, PLN02840, tRNA dimethylallyltransferase 4e-16
PLN02165 334 PLN02165, PLN02165, adenylate isopentenyltransferase 4e-13
PLN02748 468 PLN02748, PLN02748, tRNA dimethylallyltransferase 1e-12
PRK14729 300 PRK14729, miaA, tRNA delta(2)-isopentenylpyrophosphate 1e-09
COG0324 308 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate t 2e-26
pfam01715 253 pfam01715, IPPT, IPP transferase 1e-12
PRK05800170 PRK05800, cobU, adenosylcobinamide kinase/adenosylcobin 8e-04
pfam02283166 pfam02283, CobU, Cobinamide kinase / cobinamide phospha 0.001
>gnl|CDD|178856 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>gnl|CDD|161743 TIGR00174, miaA, tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>gnl|CDD|36598 KOG1384, KOG1384, KOG1384, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178433 PLN02840, PLN02840, tRNA dimethylallyltransferase Back     alignment and domain information
>gnl|CDD|177823 PLN02165, PLN02165, adenylate isopentenyltransferase Back     alignment and domain information
>gnl|CDD|178349 PLN02748, PLN02748, tRNA dimethylallyltransferase Back     alignment and domain information
>gnl|CDD|173191 PRK14729, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>gnl|CDD|30672 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|145065 pfam01715, IPPT, IPP transferase Back     alignment and domain information
>gnl|CDD|180264 PRK05800, cobU, adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>gnl|CDD|145438 pfam02283, CobU, Cobinamide kinase / cobinamide phosphate guanyltransferase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 133
COG0324 308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 100.0
PRK00091 304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 100.0
TIGR00174 307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 100.0
KOG1384 348 consensus 100.0
pfam01745 232 IPT Isopentenyl transferase. Isopentenyl transferase / 99.87
TIGR00382 452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 98.15
PRK04220306 2-phosphoglycerate kinase; Provisional 97.94
PRK00300208 gmk guanylate kinase; Provisional 97.94
pfam00625182 Guanylate_kin Guanylate kinase. 97.8
PRK05342 411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 97.65
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 97.6
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 97.51
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 97.5
PRK12339197 2-phosphoglycerate kinase; Provisional 97.5
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 97.47
PRK07429 331 phosphoribulokinase; Provisional 97.44
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 97.38
PRK12337 492 2-phosphoglycerate kinase; Provisional 97.13
KOG0745 564 consensus 97.12
PRK05057172 aroK shikimate kinase I; Reviewed 97.1
PRK12338 320 hypothetical protein; Provisional 97.0
PRK03731172 aroL shikimate kinase II; Reviewed 96.96
PRK13946195 shikimate kinase; Provisional 96.84
COG1341 398 Predicted GTPase or GTP-binding protein [General functi 96.56
KOG0733 802 consensus 96.2
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 95.93
COG2087175 CobU Adenosyl cobinamide kinase/adenosyl cobinamide pho 95.91
PRK08084235 DNA replication initiation factor; Provisional 95.5
PRK00625173 shikimate kinase; Provisional 95.31
PRK06893229 DNA replication initiation factor; Validated 95.28
PRK06921265 hypothetical protein; Provisional 95.18
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 94.81
KOG0734 752 consensus 94.26
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 93.42
pfam01202158 SKI Shikimate kinase. 92.94
CHL00181 287 cbbX CbbX; Provisional 92.5
CHL00176 631 ftsH cell division protein; Validated 92.45
PTZ00202 664 tuzin; Provisional 92.44
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 92.26
KOG0731 774 consensus 91.85
pfam01591 223 6PF2K 6-phosphofructo-2-kinase. This enzyme occurs as a 90.72
pfam01715 253 IPPT IPP transferase. This is a family of IPP transfera 99.95
PRK05480209 uridine kinase; Provisional 98.19
PRK13948182 shikimate kinase; Provisional 97.55
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 97.55
PRK09270230 frcK putative fructose transport system kinase; Reviewe 97.52
KOG3308 225 consensus 97.49
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.47
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 97.44
PTZ00301210 uridine kinase; Provisional 97.34
TIGR01978 248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 97.25
COG0396 251 sufC Cysteine desulfurase activator ATPase [Posttransla 97.12
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 97.09
cd02025 220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 97.01
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 96.98
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 96.97
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 96.96
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 96.92
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 96.88
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 96.84
cd01918149 HprK_C HprK/P, the bifunctional histidine-containing pr 96.83
CHL00095 823 clpC Clp protease ATP binding subunit 96.77
TIGR02533 495 type_II_gspE general secretory pathway protein E; Inter 96.73
PRK13947171 shikimate kinase; Provisional 96.72
PRK10865 857 protein disaggregation chaperone; Provisional 96.71
PRK13949169 shikimate kinase; Provisional 96.63
TIGR02928 383 TIGR02928 orc1/cdc6 family replication initiation prote 96.6
COG1493308 HprK Serine kinase of the HPr protein, regulates carboh 96.59
TIGR02538 577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 96.55
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 96.47
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 96.44
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamide pho 96.41
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 96.37
TIGR01420 350 pilT_fam twitching motility protein; InterPro: IPR00632 96.17
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 96.07
pfam01121179 CoaE Dephospho-CoA kinase. This family catalyses the ph 96.07
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 96.05
cd02026 273 PRK Phosphoribulokinase (PRK) is an enzyme involved in 95.93
PRK06762166 hypothetical protein; Provisional 95.83
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 95.8
CHL00195 491 ycf46 Ycf46; Provisional 95.69
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate synthase 95.69
pfam07475171 Hpr_kinase_C HPr Serine kinase C-terminal domain. This 95.66
TIGR01526346 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransfe 95.52
pfam06309127 Torsin Torsin. This family consists of several eukaryot 95.35
PRK05642234 DNA replication initiation factor; Validated 95.35
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 95.25
KOG3220 225 consensus 95.23
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 95.19
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 95.04
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 94.82
pfam00308219 Bac_DnaA Bacterial dnaA protein. 94.71
COG1373 398 Predicted ATPase (AAA+ superfamily) [General function p 94.52
COG1484254 DnaC DNA replication protein [DNA replication, recombin 94.25
KOG0744423 consensus 94.24
PRK10536262 hypothetical protein; Provisional 94.09
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 94.06
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 94.0
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 93.79
PRK10867 453 signal recognition particle protein; Provisional 93.72
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB; Inte 93.39
COG0645170 Predicted kinase [General function prediction only] 93.13
PRK05428308 HPr kinase/phosphorylase; Provisional 93.12
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intracell 92.89
PRK07952242 DNA replication protein DnaC; Validated 92.51
PRK03333 394 coaE dephospho-CoA kinase/unknown domain fusion protein 92.5
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 92.49
TIGR02397 363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 92.33
COG0444 316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 92.03
TIGR00235220 udk uridine kinase; InterPro: IPR000764 Uridine kinase 91.95
KOG0079198 consensus 91.5
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 91.43
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 91.21
KOG2170 344 consensus 91.17
COG2262411 HflX GTPases [General function prediction only] 91.14
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 90.84
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 90.65
PRK08233182 hypothetical protein; Provisional 97.97
PRK05201 442 hslU ATP-dependent protease ATP-binding subunit; Provis 97.73
PRK08118167 topology modulation protein; Reviewed 97.62
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 97.61
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.61
PRK11545177 gntK gluconate kinase 1; Provisional 97.58
PRK07261171 topology modulation protein; Provisional 97.44
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.42
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.41
TIGR02640 265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 97.4
PRK07667190 uridine kinase; Provisional 97.36
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 97.34
PRK09825176 idnK D-gluconate kinase; Provisional 97.33
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Provisi 97.22
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 97.2
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.17
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.11
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 97.11
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.1
cd03115173 SRP The signal recognition particle (SRP) mediates the 97.07
pfam06068 395 TIP49 TIP49 C-terminus. This family consists of the C-t 97.03
PRK04195 403 replication factor C large subunit; Provisional 97.03
PRK00131175 aroK shikimate kinase; Reviewed 97.0
PRK00023225 cmk cytidylate kinase; Provisional 96.97
PRK06696227 uridine kinase; Validated 96.96
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 96.94
PRK06547184 hypothetical protein; Provisional 96.94
TIGR00390 463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 96.86
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 96.85
PRK06217185 hypothetical protein; Validated 96.85
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 96.79
PRK05541176 adenylylsulfate kinase; Provisional 96.78
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 96.78
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 96.74
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide-phosp 96.71
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 96.7
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 96.65
smart00382148 AAA ATPases associated with a variety of cellular activ 96.62
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 96.61
PRK09183258 transposase/IS protein; Provisional 96.59
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 96.55
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.47
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.43
PRK06620214 hypothetical protein; Validated 96.43
TIGR00017223 cmk cytidylate kinase; InterPro: IPR003136 This family 96.41
PRK08903227 hypothetical protein; Validated 96.4
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and metabol 96.4
COG1428216 Deoxynucleoside kinases [Nucleotide transport and metab 96.4
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 96.35
PRK06526254 transposase; Provisional 96.33
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S1; Pr 96.31
PRK08181269 transposase; Validated 96.28
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 96.27
PRK00081199 coaE dephospho-CoA kinase; Reviewed 96.25
PRK09087226 hypothetical protein; Validated 96.24
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 96.2
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 96.18
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 96.17
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 96.11
pfam00004131 AAA ATPase family associated with various cellular acti 96.08
PRK02496185 adk adenylate kinase; Provisional 96.07
pfam07726131 AAA_3 ATPase family associated with various cellular ac 96.05
TIGR02525 374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 96.03
PRK13768 253 GTPase; Provisional 96.03
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) ca 96.01
pfam02283166 CobU Cobinamide kinase / cobinamide phosphate guanyltra 96.0
PRK11860662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 95.99
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 95.98
PRK03839180 putative kinase; Provisional 95.97
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 95.95
PRK00349 944 uvrA excinuclease ABC subunit A; Reviewed 95.88
PRK06835330 DNA replication protein DnaC; Validated 95.83
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 95.8
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 95.8
PRK00279215 adk adenylate kinase; Reviewed 95.78
TIGR01192 592 chvA glucan exporter ATP-binding protein; InterPro: IPR 95.77
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 95.77
PRK03992 390 proteasome-activating nucleotidase; Provisional 95.76
PRK08727233 hypothetical protein; Validated 95.75
PRK13900332 type IV secretion system ATPase VirB11; Provisional 95.72
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) i 95.67
PRK04182178 cytidylate kinase; Provisional 95.66
PRK00635 1809 excinuclease ABC subunit A; Provisional 95.63
PRK13342 417 recombination factor protein RarA; Reviewed 95.62
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 95.57
KOG1942 456 consensus 95.53
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 95.52
PRK10246 1047 exonuclease subunit SbcC; Provisional 95.52
PRK03846198 adenylylsulfate kinase; Provisional 95.5
PRK12377248 putative replication protein; Provisional 95.47
PRK08116262 hypothetical protein; Validated 95.45
PRK13851343 type IV secretion system protein VirB11; Provisional 95.42
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 95.37
PRK00440 318 rfc replication factor C small subunit; Reviewed 95.37
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 95.34
KOG2004 906 consensus 95.22
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.22
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-i 95.2
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.19
PRK11784333 tRNA 2-selenouridine synthase; Provisional 95.19
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 95.18
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 95.16
PRK10522547 multidrug transporter membrane component/ATP-binding co 95.16
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.15
COG3172187 NadR Predicted ATPase/kinase involved in NAD metabolism 95.14
TIGR00618 1063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 95.13
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 95.11
PRK12402 337 replication factor C small subunit 2; Reviewed 95.1
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 94.98
PRK13657 585 cyclic beta-1,2-glucan ABC transporter; Provisional 94.97
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 94.97
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 94.91
PRK10789 569 putative multidrug transporter membrane\ATP-binding com 94.91
PTZ00088 225 adenylate kinase 1; Provisional 94.9
PRK13898 800 type IV secretion system ATPase VirB4; Provisional 94.89
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 94.88
PRK08099411 nicotinamide-nucleotide adenylyltransferase; Provisiona 94.88
PRK10790 593 putative multidrug transporter membrane\ATP-binding com 94.87
PRK00635 1809 excinuclease ABC subunit A; Provisional 94.87
PRK00411 394 cdc6 cell division control protein 6; Reviewed 94.82
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 94.82
PRK13830 818 conjugal transfer protein TrbE; Provisional 94.79
pfam07931174 CPT Chloramphenicol phosphotransferase-like protein. Th 94.76
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 94.75
KOG3354191 consensus 94.74
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 94.73
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 94.71
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phos 94.7
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 94.68
PRK00889175 adenylylsulfate kinase; Provisional 94.66
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 94.65
PRK01184183 hypothetical protein; Provisional 94.6
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 94.54
pfam00406186 ADK Adenylate kinase. 94.51
KOG3877 393 consensus 94.5
PRK10744257 phosphate transporter subunit; Provisional 94.5
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 94.47
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 94.45
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 94.44
cd00983 325 recA RecA is a bacterial enzyme which has roles in homo 94.42
PRK13833323 conjugal transfer protein TrbB; Provisional 94.39
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein super 94.35
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.34
KOG0741744 consensus 94.33
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 94.33
pfam08298 358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 94.32
COG0419 908 SbcC ATPase involved in DNA repair [DNA replication, re 94.31
COG4088 261 Predicted nucleotide kinase [Nucleotide transport and m 94.28
KOG1969 877 consensus 94.27
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction ATPas 94.27
pfam02456 370 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can in 94.25
PRK13853 789 type IV secretion system protein VirB4; Provisional 94.17
PRK03918 882 chromosome segregation protein; Provisional 94.14
TIGR01587 424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 94.14
COG4639168 Predicted kinase [General function prediction only] 94.13
TIGR00630 956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 94.13
PRK13894320 conjugal transfer ATPase TrbB; Provisional 94.12
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 94.11
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 94.07
cd03246173 ABCC_Protease_Secretion This family represents the ABC 94.05
KOG0737 386 consensus 94.04
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 94.03
KOG1970 634 consensus 94.03
PRK13873 815 conjugal transfer ATPase TrbE; Provisional 94.02
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 94.01
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 94.0
KOG1051 898 consensus 93.97
PRK11331 459 5-methylcytosine-specific restriction enzyme subunit Mc 93.93
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 93.88
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 93.88
pfam00154 322 RecA recA bacterial DNA recombination protein. RecA is 93.85
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 93.83
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.8
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 93.79
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 93.79
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.74
TIGR00635 305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 93.73
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 93.72
PRK13341 726 recombination factor protein RarA/unknown domain fusion 93.68
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 93.66
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.65
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 93.64
PRK13651 304 cobalt transporter ATP-binding subunit; Provisional 93.63
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 93.62
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 93.62
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 93.61
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 93.61
PRK10418 254 nikD nickel transporter ATP-binding protein; Provisiona 93.6
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 93.58
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 93.57
PRK13640 283 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.57
PRK13547 273 hmuV hemin importer ATP-binding subunit; Provisional 93.57
PRK10436 461 hypothetical protein; Provisional 93.56
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 93.52
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 93.52
PRK07471 363 DNA polymerase III subunit delta'; Validated 93.51
PRK09302 501 circadian clock protein KaiC; Reviewed 93.51
COG0470 325 HolB ATPase involved in DNA replication [DNA replicatio 93.5
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 93.49
COG0630312 VirB11 Type IV secretory pathway, VirB11 components, an 93.49
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 93.47
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 93.47
COG0593 408 DnaA ATPase involved in DNA replication initiation [DNA 93.4
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 93.39
PRK13634 276 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.39
COG0714 329 MoxR-like ATPases [General function prediction only] 93.39
PRK13891 852 conjugal transfer protein TrbE; Provisional 93.37
PRK09354 350 recA recombinase A; Provisional 93.37
PRK01156 895 chromosome segregation protein; Provisional 93.35
pfam10412 386 TrwB_AAD_bind Type IV secretion-system coupling protein 93.35
COG3265161 GntK Gluconate kinase [Carbohydrate transport and metab 93.34
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 93.31
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 93.28
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 93.23
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.23
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 93.22
pfam03029 234 ATP_bind_1 Conserved hypothetical ATP binding protein. 93.21
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 93.15
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 93.13
pfam06745231 KaiC KaiC. This family represents a conserved region wi 93.07
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a 93.05
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 93.02
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 92.99
pfam08433 266 KTI12 Chromatin associated protein KTI12. This is a fam 92.98
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 92.98
cd03271 261 ABC_UvrA_II The excision repair protein UvrA domain II; 92.97
PTZ00243 1560 ABC transporter; Provisional 92.94
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes ar 92.94
pfam00931 285 NB-ARC NB-ARC domain. 92.94
PRK04328250 hypothetical protein; Provisional 92.93
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 92.91
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 92.9
PRK13636 285 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.9
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 92.9
cd03234226 ABCG_White The White subfamily represents ABC transport 92.89
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 92.89
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 92.89
PRK00771 433 signal recognition particle protein Srp54; Provisional 92.86
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 92.85
PRK11022 327 dppD dipeptide transporter ATP-binding subunit; Provisi 92.85
smart00487201 DEXDc DEAD-like helicases superfamily. 92.84
PRK13647 273 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.83
PRK13650 276 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.83
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.83
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 92.82
PRK13632 273 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.82
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 92.81
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 92.78
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 92.77
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 92.74
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 92.71
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 92.68
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 92.65
pfam01935218 DUF87 Domain of unknown function DUF87. The function of 92.65
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 92.65
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 92.63
PRK09694 878 hypothetical protein; Provisional 92.62
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 92.58
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.57
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 92.55
PRK13641 286 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.49
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.47
PRK13633 281 cobalt transporter ATP-binding subunit; Provisional 92.45
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 92.44
PRK10419 266 nikE nickel transporter ATP-binding protein; Provisiona 92.44
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 92.41
PRK07940 395 DNA polymerase III subunit delta'; Validated 92.37
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.33
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 92.31
COG4987573 CydC ABC-type transport system involved in cytochrome b 92.31
PRK02224 880 chromosome segregation protein; Provisional 92.3
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 92.29
PRK10619 257 histidine/lysine/arginine/ornithine transporter subunit 92.27
pfam00519432 PPV_E1_C Papillomavirus helicase. This protein is a DNA 92.26
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.25
KOG1808 1856 consensus 92.24
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 92.22
PRK08058 329 DNA polymerase III subunit delta'; Validated 92.22
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 92.22
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 92.2
KOG3347176 consensus 92.2
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.2
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 92.16
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 92.13
PTZ00243 1560 ABC transporter; Provisional 92.13
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 92.12
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 92.11
COG1100219 GTPase SAR1 and related small G proteins [General funct 92.1
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 92.08
PRK11248 255 tauB taurine transporter ATP-binding subunit; Provision 92.07
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 92.05
KOG00541381 consensus 91.99
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 91.99
pfam04851103 ResIII Type III restriction enzyme, res subunit. 91.98
COG4988559 CydD ABC-type transport system involved in cytochrome b 91.98
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 91.98
PRK09112 352 DNA polymerase III subunit delta'; Validated 91.97
KOG0979 1072 consensus 91.94
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial con 91.94
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provisiona 91.89
KOG0735 952 consensus 91.88
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 91.88
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are 91.86
PRK08356195 hypothetical protein; Provisional 91.85
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 91.84
PRK13542224 consensus 91.81
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 91.78
TIGR00929 931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 91.74
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 91.74
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 91.71
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 91.67
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 91.66
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 91.66
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; Prov 91.65
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 91.61
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 91.6
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 91.6
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 91.54
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 91.53
COG4619223 ABC-type uncharacterized transport system, ATPase compo 91.53
KOG0738 491 consensus 91.52
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 91.5
PRK11144 352 modC molybdate transporter ATP-binding protein; Provisi 91.5
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 91.49
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 91.49
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 91.48
cd04105203 SR_beta Signal recognition particle receptor, beta subu 91.47
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Provisi 91.47
TIGR03600 421 phage_DnaB phage replicative helicase, DnaB family, HK0 91.42
PRK13808 297 adenylate kinase; Provisional 91.41
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 91.4
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 91.39
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 91.38
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 91.37
PRK06067241 flagellar accessory protein FlaH; Validated 91.35
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 91.29
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 91.28
COG3596 296 Predicted GTPase [General function prediction only] 91.26
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter; InterPro: I 91.26
PRK09536 409 btuD corrinoid ABC transporter ATPase; Reviewed 91.26
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; Provi 91.23
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 91.22
PRK05917 290 DNA polymerase III subunit delta'; Validated 91.22
KOG0953 700 consensus 91.12
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 91.12
COG3839 338 MalK ABC-type sugar transport systems, ATPase component 91.09
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 91.06
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 91.03
PRK10908222 cell division protein FtsE; Provisional 91.02
PRK10416499 cell division protein FtsY; Provisional 91.02
KOG3079195 consensus 90.99
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 90.99
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 90.98
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Transcript 90.97
PRK08769 319 DNA polymerase III subunit delta'; Validated 90.97
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 90.95
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 90.95
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 90.95
cd03116159 MobB Molybdenum is an essential trace element in the fo 90.94
cd00550 254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 90.9
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 90.86
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 90.8
PRK05748 448 replicative DNA helicase; Provisional 90.73
KOG0739 439 consensus 90.73
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 90.72
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 90.68
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 90.68
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 90.62
COG4240 300 Predicted kinase [General function prediction only] 90.55
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 90.5
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 90.46
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 90.41
CHL00175 279 minD septum-site determining protein; Validated 90.41
cd01124187 KaiC KaiC is a circadian clock protein primarily found 90.4
COG3451 796 VirB4 Type IV secretory pathway, VirB4 components [Intr 90.38
cd01394218 radB RadB. The archaeal protein radB shares similarity 90.36
COG2255 332 RuvB Holliday junction resolvasome, helicase subunit [D 90.33
PRK06761 281 hypothetical protein; Provisional 90.32
PRK09473 330 oppD oligopeptide transporter ATP-binding component; Pr 90.28
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 90.2
COG1117253 PstB ABC-type phosphate transport system, ATPase compon 90.2
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 90.18
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 90.16
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>TIGR00174 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; InterPro: IPR002627 tRNA isopentenyltransferases 2 Back     alignment and domain information
>KOG1384 consensus Back     alignment and domain information
>pfam01745 IPT Isopentenyl transferase Back     alignment and domain information
>TIGR00382 clpX ATP-dependent Clp protease, ATP-binding subunit ClpX; InterPro: IPR004487 ClpX is a member of the HSP (heat-shock protein) 100 family Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>pfam00625 Guanylate_kin Guanylate kinase Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>pfam00485 PRK Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>KOG0745 consensus Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>KOG0733 consensus Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>COG2087 CobU Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>pfam02562 PhoH PhoH-like protein Back     alignment and domain information
>KOG0734 consensus Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24; InterPro: IPR004582 To be effective as a mechanism that preserves genomic integrity, the DNA damage checkpoint must be extremely sensitive in its ability to detect DNA damage Back     alignment and domain information
>pfam01202 SKI Shikimate kinase Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0731 consensus Back     alignment and domain information
>pfam01591 6PF2K 6-phosphofructo-2-kinase Back     alignment and domain information
>pfam01715 IPPT IPP transferase Back     alignment and domain information
>PRK05480 uridine kinase; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK09270 frcK putative fructose transport system kinase; Reviewed Back     alignment and domain information
>KOG3308 consensus Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369 GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277 This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes Back     alignment and domain information
>COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB; InterPro: IPR013374 This model describes a protein involved in type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family; InterPro: IPR006001 This family of proteins includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E Back     alignment and domain information
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321 These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway) Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>pfam01121 CoaE Dephospho-CoA kinase Back     alignment and domain information
>pfam01695 IstB IstB-like ATP binding protein Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>pfam07475 Hpr_kinase_C HPr Serine kinase C-terminal domain Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase; InterPro: IPR006417 The NadR protein of Escherichia coli and closely related bacteria is both enzyme and regulatory protein Back     alignment and domain information
>pfam06309 Torsin Torsin Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3220 consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>pfam00308 Bac_DnaA Bacterial dnaA protein Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0744 consensus Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ATPase; InterPro: IPR010128 Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB; InterPro: IPR013363 Proteins in this entry are the DotB component of Dot/Icm secretion systems, as found in the obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK05428 HPr kinase/phosphorylase; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family; InterPro: IPR014324 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information