254780961

254780961

hypothetical protein CLIBASIA_04310

GeneID in NCBI database:8209983Locus tag:CLIBASIA_04310
Protein GI in NCBI database:254780961Protein Accession:YP_003065374.1
Gene range:+(959588, 960190)Protein Length:200aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSWT
cccHHHHHHHHHHHHHHHHHHHHHEEcccHHHHcccHHHHHHHccHHHHHccccccEEEEEEccccccEEEEEEEcccEEcHHHHHHHHHHccccccccEEEccHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHccccccccccccccEEEEEEEcccccHHHHHHHHHHccccEEEccccEEEEccccccccc
cccccEEEEEEccEEEEEccccEEEcccccccccccHHHcccccccccccccccccEEEEEEccccccEEEEEEEEcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHcccccccccHcccccEEEEEcccccHHHHHHHHHHHccccccEcccEEEEccccccccc
MKKTEIFRILKVIWIGLYVSVASFFvtspiyslspdlikyhqqssmssdlldqeEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWhskqsidmdpQLFDFLWEIQqyfsvpeyIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKavdfyipgvsLRSLYKIAIRLKrggvgyyskflhidvgrvrswt
MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSsmssdlldqEEVRTLKIYVVstgskaivtfkrgsqynqEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKiarksqhvlgkavdfyipgvsLRSLYKIAIRLkrggvgyyskflhidvgrvrswt
MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHqqssmssdlldqEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSWT
********ILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNK************SQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSW*
MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSWT
**KTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSW*
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSWT
MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSWT
MKKTEIFRILKVIWIGLYVSVASFFVTSPIYSLSPDLIKYHQQSSMSSDLLDQEEVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGVGYYSKFLHIDVGRVRSWT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target200 hypothetical protein CLIBASIA_04310 [Candidatus Liberib
150397880 608 hypothetical protein Smed_2682 [Sinorhizobium medicae W 1 3e-40
332716496 624 hypothetical protein AGROH133_12131 [Agrobacterium sp. 1 3e-40
159185889 587 hypothetical protein Atu3763 [Agrobacterium tumefaciens 1 4e-40
307300416 605 protein of unknown function DUF882 [Sinorhizobium melil 1 2e-39
227823367 620 hypothetical protein NGR_c28400 [Sinorhizobium fredii N 1 5e-39
15966547 562 hypothetical protein SMc04010 [Sinorhizobium meliloti 1 1 8e-39
218463502 613 hypothetical protein RetlK5_30543 [Rhizobium etli Kim 5 1 4e-38
86358784 454 hypothetical protein RHE_CH03184 [Rhizobium etli CFN 42 1 4e-38
222087064 646 hypothetical protein Arad_3804 [Agrobacterium radiobact 1 4e-38
327190399 468 hypothetical protein RHECNPAF_430014 [Rhizobium etli CN 1 6e-38
>gi|150397880|ref|YP_001328347.1| hypothetical protein Smed_2682 [Sinorhizobium medicae WSM419] Length = 608 Back     alignment and organism information
 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 74/149 (49%), Positives = 105/149 (70%), Gaps = 4/149 (2%)

Query: 55  EVRTLKIYVVSTGSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEI 114
           + RTLK+Y + T  KA +TFKR  +Y+Q+GL Q+NR L DW   +   MDP+L D +WE+
Sbjct: 53  QTRTLKLYFIHTKEKAQITFKRNGRYDQKGLQQINRFLRDWRRNEPTKMDPRLLDLVWEV 112

Query: 115 QQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIA 174
            Q     +YI+++S YR+  TN ML  R++ +A+KSQH+LGKA+DFYIP V L+SL +I 
Sbjct: 113 YQKSGSRDYIHVVSAYRSPATNGMLRSRSKGVAKKSQHMLGKAMDFYIPDVRLKSLREIG 172

Query: 175 IRLKRGGVGYY----SKFLHIDVGRVRSW 199
           ++ + GGVGYY    S F+H+DVG VR+W
Sbjct: 173 MKFQVGGVGYYPTSGSPFVHMDVGGVRAW 201


Species: Sinorhizobium medicae
Genus: Sinorhizobium
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332716496|ref|YP_004443962.1| hypothetical protein AGROH133_12131 [Agrobacterium sp. H13-3] Length = 624 Back     alignment and organism information
>gi|159185889|ref|NP_356859.2| hypothetical protein Atu3763 [Agrobacterium tumefaciens str. C58] Length = 587 Back     alignment and organism information
>gi|307300416|ref|ZP_07580196.1| protein of unknown function DUF882 [Sinorhizobium meliloti BL225C] Length = 605 Back     alignment and organism information
>gi|227823367|ref|YP_002827339.1| hypothetical protein NGR_c28400 [Sinorhizobium fredii NGR234] Length = 620 Back     alignment and organism information
>gi|15966547|ref|NP_386900.1| hypothetical protein SMc04010 [Sinorhizobium meliloti 1021] Length = 562 Back     alignment and organism information
>gi|218463502|ref|ZP_03503593.1| hypothetical protein RetlK5_30543 [Rhizobium etli Kim 5] Length = 613 Back     alignment and organism information
>gi|86358784|ref|YP_470676.1| hypothetical protein RHE_CH03184 [Rhizobium etli CFN 42] Length = 454 Back     alignment and organism information
>gi|222087064|ref|YP_002545599.1| hypothetical protein Arad_3804 [Agrobacterium radiobacter K84] Length = 646 Back     alignment and organism information
>gi|327190399|gb|EGE57495.1| hypothetical protein RHECNPAF_430014 [Rhizobium etli CNPAF512] Length = 468 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target200 hypothetical protein CLIBASIA_04310 [Candidatus Liberib
pfam05951153 pfam05951, Peptidase_M15_2, Bacterial protein of unknow 3e-45
COG3108185 COG3108, COG3108, Uncharacterized protein conserved in 6e-39
pfam08291110 pfam08291, Peptidase_M15_3, Peptidase M15 4e-08
>gnl|CDD|114660 pfam05951, Peptidase_M15_2, Bacterial protein of unknown function (DUF882) Back     alignment and domain information
>gnl|CDD|32922 COG3108, COG3108, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|116875 pfam08291, Peptidase_M15_3, Peptidase M15 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 200 hypothetical protein CLIBASIA_04310 [Candidatus Liberib
pfam05951153 Peptidase_M15_2 Bacterial protein of unknown function ( 100.0
COG3108185 Uncharacterized protein conserved in bacteria [Function 100.0
pfam08291110 Peptidase_M15_3 Peptidase M15. 99.92
pfam01085146 HH_signal Hedgehog amino-terminal signalling domain. Fo 95.57
TIGR01703 567 hybrid_clust hydroxylamine reductase; InterPro: IPR0100 90.31
pfam02557131 VanY D-alanyl-D-alanine carboxypeptidase. 97.01
>pfam05951 Peptidase_M15_2 Bacterial protein of unknown function (DUF882) Back     alignment and domain information
>COG3108 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam08291 Peptidase_M15_3 Peptidase M15 Back     alignment and domain information
>pfam01085 HH_signal Hedgehog amino-terminal signalling domain Back     alignment and domain information
>TIGR01703 hybrid_clust hydroxylamine reductase; InterPro: IPR010048 Hybrid cluster proteins (HCP, or Prismane) have been identified in bacteria, archaea and eukaryotic protozoa Back     alignment and domain information
>pfam02557 VanY D-alanyl-D-alanine carboxypeptidase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target200 hypothetical protein CLIBASIA_04310 [Candidatus Liberib
1lbu_A213 Hydrolase Metallo (Zn) Dd-Peptidase Length = 213 5e-10
>gi|157831772|pdb|1LBU|A Chain A, Hydrolase Metallo (Zn) Dd-Peptidase Length = 213 Back     alignment and structure
 Score = 68.4 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/126 (19%), Positives = 44/126 (34%), Gaps = 16/126 (12%)

Query: 85  LSQLNRLLYDWHSKQSIDMDPQ-----LFDFLWEIQQYFSVPEYIYILSGYRTQETNKML 139
            ++LNR   DW   +      +         L  ++      + I +  G+R+   N  +
Sbjct: 88  YAELNRCNSDWSGGKVSAATARANALVTMWKLQAMRHAMG-DKPITVNGGFRSVTCNSNV 146

Query: 140 SRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRG---GVGY--YSKFLHIDVG 194
                  A  S+H+ G A D         +L + A         G GY  ++   H+  G
Sbjct: 147 -----GGASNSRHMYGHAADLGAGSQGFCALAQAARNHGFTEILGPGYPGHNDHTHVAGG 201

Query: 195 RVRSWT 200
             R W+
Sbjct: 202 DGRFWS 207


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target200 hypothetical protein CLIBASIA_04310 [Candidatus Liberib
1lbu_A213 Muramoyl-pentapeptide carboxypeptidase; hydrolase, nucl 4e-13
>1lbu_A Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus G} SCOP: a.20.1.1 d.65.1.1 Length = 213 Back     alignment and structure
 Score = 69.5 bits (169), Expect = 4e-13
 Identities = 19/84 (22%), Positives = 32/84 (38%), Gaps = 10/84 (11%)

Query: 122 EYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRL---K 178
           + I +  G+R+   N  +       A  S+H+ G A D         +L + A      +
Sbjct: 129 KPITVNGGFRSVTCNSNVGG-----ASNSRHMYGHAADLGAGSQGFCALAQAARNHGFTE 183

Query: 179 RGGVGYY--SKFLHIDVGRVRSWT 200
             G GY   +   H+  G  R W+
Sbjct: 184 ILGPGYPGHNDHTHVAGGDGRFWS 207


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target200 hypothetical protein CLIBASIA_04310 [Candidatus Liberib
1lbu_A213 Muramoyl-pentapeptide carboxypeptidase; hydrolase, nucl 99.75
1xp2_A179 EAD500, PLY500, L-alanyl-D-glutamate peptidase; hydrola 97.76
2ibg_E150 Protein hedgehog, GH03927P; IHOG, fibronectin type III, 97.03
3n1f_A169 Indian hedgehog protein; binding sites, calcium, cell a 96.93
3n1g_B170 Desert hedgehog protein; binding sites, calcium, cell a 96.22
1r44_A202 D-alanyl-D-alanine dipeptidase; VANX, E.faecium, hydrol 95.05
>1lbu_A Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus G} SCOP: a.20.1.1 d.65.1.1 Back     alignment and structure
Probab=99.75  E-value=9.9e-18  Score=126.24  Aligned_cols=119  Identities=18%  Similarity=0.172  Sum_probs=93.1

Q ss_pred             CCCEECHHHHHHHHHHHCCCCCCCC-----------------------CCCCHHHHHHHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             3983489999999887265427985-----------------------36788999999999998099887899513688
Q gi|254780961|r   76 RGSQYNQEGLSQLNRLLYDWHSKQS-----------------------IDMDPQLFDFLWEIQQYFSVPEYIYILSGYRT  132 (200)
Q Consensus        76 ~~g~y~~~~l~~l~~~lRD~R~~~~-----------------------~~mDp~lld~L~~i~~~~g~~~Pi~I~SGYRs  132 (200)
                      .+|...+.-+.+|+-..++.-+...                       ....+++...|..++..++. .|+.|+|+|||
T Consensus        61 ~dG~~g~~T~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~L~~~r~~~g~-~pi~i~s~~Rs  139 (213)
T 1lbu_A           61 ADGIAGPATFNKIYQLQDDDCTPVNFTYAELNRCNSDWSGGKVSAATARANALVTMWKLQAMRHAMGD-KPITVNGGFRS  139 (213)
T ss_dssp             CSSCBCHHHHHHHHHHBCTTSSBTTCCTTTTCSSCSSCCSSSSCHHHHHHHHHHHHHHHHHHHHHTTS-CCCCEEECCCC
T ss_pred             CCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CEEEECCCCCC
T ss_conf             99849999999998665246655566778876404777888666442210068999999999997488-42630576238


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHCCCCEE---EEE--CCEEEEECCCCCCCC
Q ss_conf             56768986217888766731112899898289999999999996399847---873--884688669864479
Q gi|254780961|r  133 QETNKMLSRRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLKRGGV---GYY--SKFLHIDVGRVRSWT  200 (200)
Q Consensus       133 p~~N~~lr~~~~G~Ak~S~H~~G~A~Di~i~g~~~~~l~~~a~~~~~gGv---G~Y--s~FVHiD~gp~R~Wt  200 (200)
                      |.+|..+     +++++|+|+.|.|+||.+.+.+..++.+.++++++.|+   |+|  ++|||+|++|.|.|+
T Consensus       140 ~~~n~~v-----~ga~~S~H~~G~A~DI~i~~~~~~~l~~~a~~~g~~gi~g~g~~~~~~fiHiD~~~~r~W~  207 (213)
T 1lbu_A          140 VTCNSNV-----GGASNSRHMYGHAADLGAGSQGFCALAQAARNHGFTEILGPGYPGHNDHTHVAGGDGRFWS  207 (213)
T ss_dssp             HHHHHHH-----TCCTTCGGGGTCEEEECCTTTCHHHHHHHGGGTTCSEEECTTSTTCSSSEEEECSSSCEEE
T ss_pred             HHHHHHH-----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCEEEECCCCCCCCC
T ss_conf             8886764-----3688873235543314158869999999999769986502411799997881799987679



>2ibg_E Protein hedgehog, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: d.65.1.2 Back     alignment and structure
>3n1f_A Indian hedgehog protein; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3n1m_B 3n1o_A 3n1p_B 3d1m_A 3m1n_A 3mxw_A 3ho5_H 1vhh_A 2wg4_A 2wfx_A 3n1r_A 2wfq_A 2wfr_A 2wg3_A* Back     alignment and structure
>3n1g_B Desert hedgehog protein; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence, fibronectins; 1.90A {Homo sapiens} PDB: 3n1q_B Back     alignment and structure
>1r44_A D-alanyl-D-alanine dipeptidase; VANX, E.faecium, hydrolase; 2.25A {Enterococcus faecium} SCOP: d.65.1.4 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 200 hypothetical protein CLIBASIA_04310 [Candidatus Liberib
d1lbua2130 d.65.1.1 (A:84-213) Zn2+ DD-carboxypeptidase C-terminal 3e-17
>d1lbua2 d.65.1.1 (A:84-213) Zn2+ DD-carboxypeptidase C-terminal catalytic domain {Streptomyces albus G [TaxId: 1962]} Length = 130 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Hedgehog/DD-peptidase
superfamily: Hedgehog/DD-peptidase
family: Muramoyl-pentapeptide carboxypeptidase
domain: Zn2+ DD-carboxypeptidase C-terminal catalytic domain
species: Streptomyces albus G [TaxId: 1962]
 Score = 82.4 bits (203), Expect = 3e-17
 Identities = 25/125 (20%), Positives = 44/125 (35%), Gaps = 14/125 (11%)

Query: 85  LSQLNRLLYDWHSKQSIDMDPQL--FDFLWEIQQYFSV--PEYIYILSGYRTQETNKMLS 140
            ++LNR   DW   +      +      +W++Q        + I +  G+R+   N  + 
Sbjct: 5   YAELNRCNSDWSGGKVSAATARANALVTMWKLQAMRHAMGDKPITVNGGFRSVTCNSNVG 64

Query: 141 RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLK---RGGVGYY--SKFLHIDVGR 195
                    S+H+ G A D         +L + A         G GY   +   H+  G 
Sbjct: 65  GA-----SNSRHMYGHAADLGAGSQGFCALAQAARNHGFTEILGPGYPGHNDHTHVAGGD 119

Query: 196 VRSWT 200
            R W+
Sbjct: 120 GRFWS 124


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target200 hypothetical protein CLIBASIA_04310 [Candidatus Liberib
d1lbua2130 Zn2+ DD-carboxypeptidase C-terminal catalytic domain {S 99.94
d3d1ma1148 Sonic hedgehog {Mouse (Mus musculus) [TaxId: 10090]} 96.96
d2vo9a1148 L-alanyl-D-glutamate peptidase Ply {Listeria phage A500 97.6
>d1lbua2 d.65.1.1 (A:84-213) Zn2+ DD-carboxypeptidase C-terminal catalytic domain {Streptomyces albus G [TaxId: 1962]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Hedgehog/DD-peptidase
superfamily: Hedgehog/DD-peptidase
family: Muramoyl-pentapeptide carboxypeptidase
domain: Zn2+ DD-carboxypeptidase C-terminal catalytic domain
species: Streptomyces albus G [TaxId: 1962]
Probab=99.94  E-value=1.8e-28  Score=189.73  Aligned_cols=110  Identities=23%  Similarity=0.306  Sum_probs=97.6

Q ss_pred             HHHHHHHHCCCCCCCCCCCCHHH-----HHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCCCCCCCCCCEEEEEE
Q ss_conf             99998872654279853678899-----9999999998099887899513688567689862178887667311128998
Q gi|254780961|r   85 LSQLNRLLYDWHSKQSIDMDPQL-----FDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVD  159 (200)
Q Consensus        85 l~~l~~~lRD~R~~~~~~mDp~l-----ld~L~~i~~~~g~~~Pi~I~SGYRsp~~N~~lr~~~~G~Ak~S~H~~G~A~D  159 (200)
                      +.||+.+.+||+.+.+..++++.     +..|+.+++.+| .+||.|+||||||++|+.+     |+|++|+|++|+|+|
T Consensus         5 ~~El~~~~~~~~~~~~~~~~~~~n~l~~~~~L~~lR~~~G-~~Pi~ItSgYRsp~~N~~v-----gga~~S~H~~G~A~D   78 (130)
T d1lbua2           5 YAELNRCNSDWSGGKVSAATARANALVTMWKLQAMRHAMG-DKPITVNGGFRSVTCNSNV-----GGASNSRHMYGHAAD   78 (130)
T ss_dssp             TTTTCSSCSSCCSSSSCHHHHHHHHHHHHHHHHHHHHHTT-SCCCCEEECCCCHHHHHHH-----TCCTTCGGGGTCEEE
T ss_pred             HHHHCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHC-CCCEEEEEEEECHHHHHHH-----CCCCCCCCCCCEEEE
T ss_conf             8998666720215998801467769999999999999958-9747999888688898875-----367877566856889


Q ss_pred             EECCCCCHHHHHHHHHHCCCC---EEEEE--CCEEEEECCCCCCCC
Q ss_conf             982899999999999963998---47873--884688669864479
Q gi|254780961|r  160 FYIPGVSLRSLYKIAIRLKRG---GVGYY--SKFLHIDVGRVRSWT  200 (200)
Q Consensus       160 i~i~g~~~~~l~~~a~~~~~g---GvG~Y--s~FVHiD~gp~R~Wt  200 (200)
                      |.++|.+..++.++++++++.   |+|+|  ++|||||++|.|.||
T Consensus        79 i~v~g~~~~~~~~~a~~~gf~~~~g~G~~~~~~fvHvD~~~~r~Ws  124 (130)
T d1lbua2          79 LGAGSQGFCALAQAARNHGFTEILGPGYPGHNDHTHVAGGDGRFWS  124 (130)
T ss_dssp             ECCTTTCHHHHHHHGGGTTCSEEECTTSTTCSSSEEEECSSSCEEE
T ss_pred             EECCCCCHHHHHHHHHHCCCCCCCEEEECCCCCEEEECCCCCCCCC
T ss_conf             9617999999999999769982435500799997887899997458



>d3d1ma1 d.65.1.2 (A:41-188) Sonic hedgehog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vo9a1 d.65.1.5 (A:1-148) L-alanyl-D-glutamate peptidase Ply {Listeria phage A500 [TaxId: 40522]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 200 hypothetical protein CLIBASIA_04310 [Candidatus Li
1lbu_A_91-213123 (A:91-213) Muramoyl-pentapeptide carboxypeptidase; 4e-26
>1lbu_A (A:91-213) Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus G}Length = 123 Back     alignment and structure
 Score =  112 bits (281), Expect = 4e-26
 Identities = 25/123 (20%), Positives = 40/123 (32%), Gaps = 16/123 (13%)

Query: 88  LNRLLYDWH-----SKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRR 142
           LNR   DW      +  +          L  ++      + I +  G+R+   N      
Sbjct: 1   LNRCNSDWSGGKVSAATARANALVTMWKLQAMRHAMGD-KPITVNGGFRSVTCNSN---- 55

Query: 143 NRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLK---RGGVGYY--SKFLHIDVGRVR 197
               A  S+H+ G A D         +L + A         G GY   +   H+  G  R
Sbjct: 56  -VGGASNSRHMYGHAADLGAGSQGFCALAQAARNHGFTEILGPGYPGHNDHTHVAGGDGR 114

Query: 198 SWT 200
            W+
Sbjct: 115 FWS 117


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target200 hypothetical protein CLIBASIA_04310 [Candidatus Liberib
1lbu_A_91-213123 Muramoyl-pentapeptide carboxypeptidase; hydrolase, 99.98
2vo9_A_179 The Enzymatically Active Domain of Endolysin {List 97.83
1vhh_A_162 Sonic hedgehog, HHG-1, VHH-1; signalling protein; 97.14
1r44_A_202 D-alanyl-D-alanine dipeptidase; VANX, E.faecium, h 96.87
>1lbu_A (A:91-213) Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus G} Back     alignment and structure
Probab=99.98  E-value=1.2e-33  Score=223.39  Aligned_cols=107  Identities=23%  Similarity=0.266  Sum_probs=100.3

Q ss_pred             HHHHHCCCCCC-----CCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCCCCCCCCCCEEEEEEEEC
Q ss_conf             98872654279-----8536788999999999998099887899513688567689862178887667311128998982
Q gi|254780961|r   88 LNRLLYDWHSK-----QSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFYI  162 (200)
Q Consensus        88 l~~~lRD~R~~-----~~~~mDp~lld~L~~i~~~~g~~~Pi~I~SGYRsp~~N~~lr~~~~G~Ak~S~H~~G~A~Di~i  162 (200)
                      ||||||||+.+     +++.||++|+++|+.+++.+|. +||.|+||||||++|+.+     |+|++|+|++|+|+||.+
T Consensus         1 l~~~~RD~~~~~~~~~~~~~~~~~l~~~L~~lr~~~g~-~pi~I~SgyRs~~~N~~v-----Gga~~S~H~~G~A~Di~~   74 (123)
T 1lbu_A            1 LNRCNSDWSGGKVSAATARANALVTMWKLQAMRHAMGD-KPITVNGGFRSVTCNSNV-----GGASNSRHMYGHAADLGA   74 (123)
T ss_dssp             TCSSCSSCCSSSSCHHHHHHHHHHHHHHHHHHHHHTTS-CCCCEEECCCCHHHHHHH-----TCCTTCGGGGTCEEEECC
T ss_pred             HHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CEEEECCCCCCHHHHHHH-----CCCCCCCCCCCCCCCCCC
T ss_conf             76404777888666442210068999999999997488-426305762388886764-----368887323554331415


Q ss_pred             CCCCHHHHHHHHHHCCC---CEEEEE--CCEEEEECCCCCCCC
Q ss_conf             89999999999996399---847873--884688669864479
Q gi|254780961|r  163 PGVSLRSLYKIAIRLKR---GGVGYY--SKFLHIDVGRVRSWT  200 (200)
Q Consensus       163 ~g~~~~~l~~~a~~~~~---gGvG~Y--s~FVHiD~gp~R~Wt  200 (200)
                      ++.+..++.++|+++++   +|+|+|  ++|||||++|.|+|+
T Consensus        75 ~~~~~~~l~~~a~~~~~~~~~g~g~y~~~~fvHiD~~~~r~W~  117 (123)
T 1lbu_A           75 GSQGFCALAQAARNHGFTEILGPGYPGHNDHTHVAGGDGRFWS  117 (123)
T ss_dssp             TTTCHHHHHHHGGGTTCSEEECTTSTTCSSSEEEECSSSCEEE
T ss_pred             CCCCHHHHHHHHHHCCCCEEEEEECCCCCCEEEECCCCCCCCC
T ss_conf             8869999999999769986502411799997881799987679



>2vo9_A (A:) The Enzymatically Active Domain of Endolysin {Listeria Monocytogenes Bacteriophage 500} Back     alignment and structure
>1vhh_A (A:) Sonic hedgehog, HHG-1, VHH-1; signalling protein; 1.70A {Mus musculus} Back     alignment and structure
>1r44_A (A:) D-alanyl-D-alanine dipeptidase; VANX, E.faecium, hydrolase; 2.25A {Enterococcus faecium} Back     alignment and structure