254780962

254780962

hypothetical protein CLIBASIA_04315

GeneID in NCBI database:8209984Locus tag:CLIBASIA_04315
Protein GI in NCBI database:254780962Protein Accession:YP_003065375.1
Gene range:+(960391, 960540)Protein Length:49aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:GCN5-related N-acetyltransferase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
90% MSAconservation map
  
--------10--------20--------30--------40--------5
MAIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLRREYG
ccccccccEEEEEEEccccHHHccccccHHHHHHHHHHHHHHHHHHccc
ccccccccEEEEEEcccccccccccccHHHHcHHHHHHHHHHHHHHHcc
maiknsgaEFVLIDaksdgykhlgfkkpifknnIMENMIGRMSLRREYG
maiknsgaefvlidaksdgykhlgfkkpifknnimeNMIGRMSLRREYG
MAIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLRREYG
******G*EFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLR****
MAIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLRREYG
*****SGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLRR**G
ooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooo
oohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLRREYG
MAIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLRREYG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target49 hypothetical protein CLIBASIA_04315 [Candidatus Liberib
254780989185 GCN5-related N-acetyltransferase [Candidatus Liber 4e-18
>gi|254780989|ref|YP_003065402.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Back     alignment
 Score = 80.9 bits (198), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/68 (64%), Positives = 46/68 (67%), Gaps = 20/68 (29%)

Query: 1   MAIKNSGAEFVLIDAKSDGYKHLGFKKP--------------------IFKNNIMENMIG 40
           MAIKNSGAEFVLIDAK D +KHLGFKKP                    IFKNNIMENMIG
Sbjct: 117 MAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIG 176

Query: 41  RMSLRREY 48
           +MSLRREY
Sbjct: 177 KMSLRREY 184

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target49 hypothetical protein CLIBASIA_04315 [Candidatus Liberib
254780989185 GCN5-related N-acetyltransferase [Candidatus Liberibact 1 5e-14
>gi|254780989|ref|YP_003065402.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Back     alignment and organism information
 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/68 (64%), Positives = 46/68 (67%), Gaps = 20/68 (29%)

Query: 1   MAIKNSGAEFVLIDAKSDGYKHLGFKKP--------------------IFKNNIMENMIG 40
           MAIKNSGAEFVLIDAK D +KHLGFKKP                    IFKNNIMENMIG
Sbjct: 117 MAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIG 176

Query: 41  RMSLRREY 48
           +MSLRREY
Sbjct: 177 KMSLRREY 184


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00