254780965

254780965

hypothetical protein CLIBASIA_04330

GeneID in NCBI database:8209987Locus tag:CLIBASIA_04330
Protein GI in NCBI database:254780965Protein Accession:YP_003065378.1
Gene range:+(962650, 963339)Protein Length:229aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MKYKIAIIILLVLVGVILAFYFQQSSTPQNHLLFFSEKAVWKGDSETYFQCKRAHEFDENFDNCIITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPTVGSHIIDINDSSVHQLYDSSPIAKDFVLRNPGVFPYSAGHFVKSSHKDGLIELIFSYPLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIRNDNAKYPMHFFI
ccEEEHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccEEEEHHHHHHHcccccEEEEEHHHcccHHHHHHHHHHHHHHcccccHHHHHccEEEEEEEEEccccccccccEEEEEccccEEEEEccHHHHHHHcccccccHHEEcccccccccccHHHHccccccccHHHHHcccccccccccccEEEEEEEEEcccEEEEEEEEEEEcccccccEEEcc
ccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcEEEEccccccEEEEccccccccccccEEEEEEcccccHHHHHHHHHHHHHHccccccccHHHHHEEEEEEEEccccccccccEEEEcccccEEEEEccccHHHcccccHcHHHHEEcccccccccccccEEccccccHEEEEEcccccccccccccccEEEEEHHcccccEEccEEEEEEccccccccEEEc
MKYKIAIIILLVLVGVILAFYfqqsstpqnhllfFSEKavwkgdsetyfQCKRahefdenfdncIITSIKKTGGTQEALRAAQYLEKylepgyvssyRKEALIGIVEvqypyranensgtlliptvgshiidindssvhqlydsspiakdfvlrnpgvfpysaghfvksshkdGLIELIfsyplrschgcedigfmDIAYKFttkgafigrkvfgirndnakypmhffi
MKYKIAIIILLVLVGVILAFYFQQSSTPQNHLLFFSEKAVWKGDSETYFQCKRAHEFDENFDNCIITSikktggtqEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPTVGSHIIDINDSSVHQLYDSSPIAKDFVLRNPGVFPYSAGHFVKSSHKDGLIELIFSYPLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIRNDNAKYPMHFFI
MKYKIAiiillvlvgvilAFYFQQSSTPQNHLLFFSEKAVWKGDSETYFQCKRAHEFDENFDNCIITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPTVGSHIIDINDSSVHQLYDSSPIAKDFVLRNPGVFPYSAGHFVKSSHKDGLIELIFSYPLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIRNDNAKYPMHFFI
**YKIAIIILLVLVGVILAFY************FFSEKAVWKGDSETYFQCKRAHEFDENFDNCIITSIKK****QE*LRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPTVGSHIIDINDSSVHQLYDSSPIAKDFVLRNPGVF**************GLIELIFSYPLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIRNDNAKYPMHFFI
MKYKIAIIILLVLVGVILAFYFQQSSTPQNHLLFFSEKAVWKGDSETYFQCKRAHEFDENFDNCIITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPTVGSHIIDINDSSVHQLYDSSPIAKDFVLRNPGVFPYSAGHFVKSSHKDGLIELIFSYPLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIRNDNAKYPMHFFI
MKYKIAIIILLVLVGVILAFYFQQSSTPQNHLLFFSEKAVWKGDSETYFQCKRAHEFDENFDNCIITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPTVGSHIIDINDSSVHQLYDSSPIAKDFVLRNPGVFPYSAGHFVKSSHKDGLIELIFSYPLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIRNDNAKYPMHFFI
iiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MKYKIAIIILLVLVGVILAFYFQQSSTPQNHLLFFSEKAVWKGDSETYFQCKRAHEFDENFDNCIITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPTVGSHIIDINDSSVHQLYDSSPIAKDFVLRNPGVFPYSAGHFVKSSHKDGLIELIFSYPLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIRNDNAKYPMHFFI
MKYKIAIIILLVLVGVILAFYFQQSSTPQNHLLFFSEKAVWKGDSETYFQCKRAHEFDENFDNCIITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPTVGSHIIDINDSSVHQLYDSSPIAKDFVLRNPGVFPYSAGHFVKSSHKDGLIELIFSYPLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIRNDNAKYPMHFFI
MKYKIAIIILLVLVGVILAFYFQQSSTPQNHLLFFSEKAVWKGDSETYFQCKRAHEFDENFDNCIITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPTVGSHIIDINDSSVHQLYDSSPIAKDFVLRNPGVFPYSAGHFVKSSHKDGLIELIFSYPLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIRNDNAKYPMHFFI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target229 hypothetical protein CLIBASIA_04330 [Candidatus Liberib
315122772213 hypothetical protein CKC_05135 [Candidatus Liberibacter 1 2e-25
194367068227 hypothetical protein Smal_3296 [Stenotrophomonas maltop 1 4e-23
190575727227 hypothetical protein Smlt3880 [Stenotrophomonas maltoph 1 9e-23
254523697227 hypothetical protein SSKA14_2831 [Stenotrophomonas sp. 1 2e-21
303246407212 conserved hypothetical protein [Desulfovibrio fructosov 1 1e-06
298571448188 hypothetical protein LW5_0300 [uncultured Nitrospirae b 2 3e-06
>gi|315122772|ref|YP_004063261.1| hypothetical protein CKC_05135 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 213 Back     alignment and organism information
 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/215 (35%), Positives = 113/215 (52%), Gaps = 17/215 (7%)

Query: 7   IIILLVLVGVILAFYFQQSSTPQNHLL-FFSEKAVWKGDSETYFQCKRAHEFDENFDNCI 65
           + I LVL+        ++ + P  H     +EK+VW  D     +C       E  D C+
Sbjct: 9   LFITLVLISCDKKNVQKKENAPPPHSASVINEKSVWHDDLAN--KCASY----ETRDICL 62

Query: 66  ITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPT 125
           I  I+K+G   EAL+A QYL K  E GYV S+RKE  IGI E++YP+RAN N+ TLLIP 
Sbjct: 63  IKEIEKSGSI-EALKAVQYLNKTREMGYVYSFRKEGPIGIAEIEYPFRANTNTTTLLIPP 121

Query: 126 VGSHIIDINDSSVHQLYD---SSPIAKDFVLRNPGVFPYSAGHFVKSSHKDGLIELIFSY 182
            G  I          +YD   +S +  DF  ++P      +   +K+   +  IE IFS+
Sbjct: 122 AGKPIY------TEDIYDDLLTSKVWLDFKKQHPYSNIQDSAVLMKTEKNNDDIEFIFSF 175

Query: 183 PLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIR 217
            + +CHGCE+   + I+YKFT +G FI   +  ++
Sbjct: 176 RVGTCHGCEETARVYISYKFTHEGVFIKNNILYVK 210


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|194367068|ref|YP_002029678.1| hypothetical protein Smal_3296 [Stenotrophomonas maltophilia R551-3] Length = 227 Back     alignment and organism information
>gi|190575727|ref|YP_001973572.1| hypothetical protein Smlt3880 [Stenotrophomonas maltophilia K279a] Length = 227 Back     alignment and organism information
>gi|254523697|ref|ZP_05135752.1| hypothetical protein SSKA14_2831 [Stenotrophomonas sp. SKA14] Length = 227 Back     alignment and organism information
>gi|303246407|ref|ZP_07332686.1| conserved hypothetical protein [Desulfovibrio fructosovorans JJ] Length = 212 Back     alignment and organism information
>gi|298571448|gb|ADI87788.1| hypothetical protein LW5_0300 [uncultured Nitrospirae bacterium MY4-5C] Length = 188 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00