254780964

254780964

ribonucleotide-diphosphate reductase subunit beta

GeneID in NCBI database:8209986Locus tag:CLIBASIA_04325
Protein GI in NCBI database:254780964Protein Accession:YP_003065377.1
Gene range:-(961463, 962521)Protein Length:352aa
Gene description:ribonucleotide-diphosphate reductase subunit beta
COG prediction:[F] Ribonucleotide reductase, beta subunit
KEGG prediction:ribonucleotide-diphosphate reductase subunit beta (EC:1.17.4.1)
SEED prediction:Ribonucleotide reductase of class Ia (aerobic), beta subunit (EC 1.17.4.1)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Ribonucleotide reduction
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD
ccccccccHHHcccccccHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccccccccccccHHHcccccc
ccccccccccccccccccccccHHHccccccEEEEcccHHHHHHHHHHHHHccccHHHccccHcHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccHHHEcccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHccccccccHHHHHHHHccccccccc
manntglspiqagekrvnvddkrmlnarsdvnqllplkYGWAWEKYLSACnnhwmptevpmqdDLALwkskngltddeRLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITslgldegelfnmyrevpsITAKANWALQytqtlsspsfttgtkdADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVInqikienphlwtKEFQQKSRTMLHEATLLEIAYAHetmpkgfvglnapsCEQYMQFIANrrchqigleplfkytenpfpwmsEVIDLKKEKNFFETRVTEYQQGAELKWD
manntglspiqagekrvnvDDKRMlnarsdvnqllPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEyqqgaelkwd
MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD
************************LNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA*L***
MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD
***************RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD
MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD
MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target352 ribonucleotide-diphosphate reductase subunit beta [Cand
254780845352 ribonucleotide-diphosphate reductase subunit beta 0.0
254781006125 ribonucleotide-diphosphate reductase subunit beta 1e-73
254780136125 ribonucleotide-diphosphate reductase subunit beta 1e-73
25478115330 hypothetical protein CLIBASIA_05300 [Candidatus Li 2e-09
>gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Back     alignment
 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/352 (100%), Positives = 352/352 (100%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP
Sbjct: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ
Sbjct: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD
Sbjct: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID
Sbjct: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA
Sbjct: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD
Sbjct: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352

>gi|254781006|ref|YP_003065419.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Back     alignment
 Score =  268 bits (684), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 125/125 (100%), Positives = 125/125 (100%)

Query: 228 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL 287
           MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL
Sbjct: 1   MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL 60

Query: 288 NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA
Sbjct: 61  NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 120

Query: 348 ELKWD 352
           ELKWD
Sbjct: 121 ELKWD 125

>gi|254780136|ref|YP_003064549.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Back     alignment
 Score =  268 bits (684), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 125/125 (100%), Positives = 125/125 (100%)

Query: 228 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL 287
           MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL
Sbjct: 1   MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL 60

Query: 288 NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA
Sbjct: 61  NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 120

Query: 348 ELKWD 352
           ELKWD
Sbjct: 121 ELKWD 125

>gi|254781153|ref|YP_003065566.1| hypothetical protein CLIBASIA_05300 [Candidatus Liberibacter asiaticus str. psy62] Length = 30 Back     alignment
 Score = 54.7 bits (130), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 25/25 (100%)

Query: 1  MANNTGLSPIQAGEKRVNVDDKRML 25
          MANNTGLSPIQAGEKRVNVDDKR+L
Sbjct: 1  MANNTGLSPIQAGEKRVNVDDKRIL 25

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target352 ribonucleotide-diphosphate reductase subunit beta [Cand
254780845352 ribonucleotide-diphosphate reductase subunit beta [Cand 1 0.0
315122301372 ribonucleotide-diphosphate reductase subunit beta [Cand 1 1e-170
72163401354 ribonucleotide-diphosphate reductase subunit beta [Ther 1 1e-168
110635036369 ribonucleotide-diphosphate reductase subunit beta [Meso 1 1e-166
209885874377 ribonucleoside-diphosphate reductase, beta subunit [Oli 1 1e-166
92119123416 ribonucleotide-diphosphate reductase subunit beta [Nitr 1 1e-165
85714830389 ribonucleotide reductase [Nitrobacter sp. Nb-311A] Leng 1 1e-165
226227154371 ribonucleoside-diphosphate reductase beta subunit [Gemm 1 1e-164
299134880373 Ribonucleoside-diphosphate reductase [Afipia sp. 1NLS2] 1 1e-164
75677068391 ribonucleotide-diphosphate reductase subunit beta [Nitr 1 1e-164
>gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Back     alignment and organism information
 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/352 (100%), Positives = 352/352 (100%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP
Sbjct: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ
Sbjct: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD
Sbjct: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID
Sbjct: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA
Sbjct: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD
Sbjct: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122301|ref|YP_004062790.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 372 Back     alignment and organism information
>gi|72163401|ref|YP_291058.1| ribonucleotide-diphosphate reductase subunit beta [Thermobifida fusca YX] Length = 354 Back     alignment and organism information
>gi|110635036|ref|YP_675244.1| ribonucleotide-diphosphate reductase subunit beta [Mesorhizobium sp. BNC1] Length = 369 Back     alignment and organism information
>gi|209885874|ref|YP_002289731.1| ribonucleoside-diphosphate reductase, beta subunit [Oligotropha carboxidovorans OM5] Length = 377 Back     alignment and organism information
>gi|92119123|ref|YP_578852.1| ribonucleotide-diphosphate reductase subunit beta [Nitrobacter hamburgensis X14] Length = 416 Back     alignment and organism information
>gi|85714830|ref|ZP_01045816.1| ribonucleotide reductase [Nitrobacter sp. Nb-311A] Length = 389 Back     alignment and organism information
>gi|226227154|ref|YP_002761260.1| ribonucleoside-diphosphate reductase beta subunit [Gemmatimonas aurantiaca T-27] Length = 371 Back     alignment and organism information
>gi|299134880|ref|ZP_07028072.1| Ribonucleoside-diphosphate reductase [Afipia sp. 1NLS2] Length = 373 Back     alignment and organism information
>gi|75677068|ref|YP_319489.1| ribonucleotide-diphosphate reductase subunit beta [Nitrobacter winogradskyi Nb-255] Length = 391 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target352 ribonucleotide-diphosphate reductase subunit beta [Cand
PRK07209369 PRK07209, PRK07209, ribonucleotide-diphosphate reductas 0.0
PTZ00211330 PTZ00211, PTZ00211, ribonucleoside-diphosphate reductas 4e-40
KOG1567344 KOG1567, KOG1567, KOG1567, Ribonucleotide reductase, be 4e-39
PLN02492324 PLN02492, PLN02492, ribonucleoside-diphosphate reductas 9e-37
COG0208348 COG0208, NrdF, Ribonucleotide reductase, beta subunit [ 7e-87
cd01049288 cd01049, RNRR2, Ribonucleotide Reductase, R2/beta subun 5e-84
PRK09614324 PRK09614, nrdF, ribonucleotide-diphosphate reductase su 1e-56
pfam00268281 pfam00268, Ribonuc_red_sm, Ribonucleotide reductase, sm 5e-34
PRK12759410 PRK12759, PRK12759, bifunctional gluaredoxin/ribonucleo 1e-27
PRK09101376 PRK09101, nrdB, ribonucleotide-diphosphate reductase su 8e-11
PRK13967322 PRK13967, nrdF1, ribonucleotide-diphosphate reductase s 7e-10
PRK13966324 PRK13966, nrdF2, ribonucleotide-diphosphate reductase s 2e-09
cd07911280 cd07911, RNRR2_Rv0233_like, Ribonucleotide Reductase R2 3e-06
PRK13965335 PRK13965, PRK13965, ribonucleotide-diphosphate reductas 9e-06
PRK08326311 PRK08326, PRK08326, ribonucleotide-diphosphate reductas 1e-06
>gnl|CDD|180886 PRK07209, PRK07209, ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|173476 PTZ00211, PTZ00211, ribonucleoside-diphosphate reductase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|36780 KOG1567, KOG1567, KOG1567, Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178110 PLN02492, PLN02492, ribonucleoside-diphosphate reductase Back     alignment and domain information
>gnl|CDD|30557 COG0208, NrdF, Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|153108 cd01049, RNRR2, Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain Back     alignment and domain information
>gnl|CDD|181991 PRK09614, nrdF, ribonucleotide-diphosphate reductase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|144013 pfam00268, Ribonuc_red_sm, Ribonucleotide reductase, small chain Back     alignment and domain information
>gnl|CDD|139206 PRK12759, PRK12759, bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|181647 PRK09101, nrdB, ribonucleotide-diphosphate reductase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|140023 PRK13967, nrdF1, ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|140022 PRK13966, nrdF2, ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|153120 cd07911, RNRR2_Rv0233_like, Ribonucleotide Reductase R2-like protein, Mn/Fe-binding domain Back     alignment and domain information
>gnl|CDD|184425 PRK13965, PRK13965, ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|181390 PRK08326, PRK08326, ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 352 ribonucleotide-diphosphate reductase subunit beta [Cand
PRK07209391 ribonucleotide-diphosphate reductase subunit beta; Vali 100.0
PTZ00211330 ribonucleotide reductase small subunit; Provisional 100.0
COG0208348 NrdF Ribonucleotide reductase, beta subunit [Nucleotide 100.0
PRK09101376 nrdB ribonucleotide-diphosphate reductase subunit beta; 100.0
PRK09614325 nrdF ribonucleotide-diphosphate reductase subunit beta; 100.0
KOG1567344 consensus 100.0
PRK12759410 bifunctional gluaredoxin/ribonucleoside-diphosphate red 100.0
PRK13966324 nrdF2 ribonucleotide-diphosphate reductase subunit beta 100.0
PRK13965337 ribonucleotide-diphosphate reductase subunit beta; Prov 100.0
PRK13967322 nrdF1 ribonucleotide-diphosphate reductase subunit beta 100.0
cd01049288 RNRR2 Ribonucleotide Reductase, R2/beta subunit, ferrit 100.0
pfam00268281 Ribonuc_red_sm Ribonucleotide reductase, small chain. 100.0
cd07911280 RNRR2_Rv0233_like Ribonucleotide Reductase R2-like prot 100.0
PRK08326318 ribonucleotide-diphosphate reductase subunit beta; Vali 100.0
cd01054296 consensus 98.1
pfam11583295 AurF P-aminobenzoate N-oxygenase AurF. AurF is a metall 97.92
pfam02332233 Phenol_Hydrox Methane/Phenol/Toluene Hydroxylase. Bacte 98.08
cd00657130 Ferritin_like Ferritin-like superfamily of diiron-conta 96.05
cd01057 465 AAMH_A Aromatic and Alkene Monooxygenase Hydroxylase, s 98.01
pfam11266219 DUF3066 Protein of unknown function (DUF3066). This fam 97.86
PRK13778316 paaA phenylacetate-CoA oxygenase subunit PaaA; Provisio 95.91
COG3396265 Uncharacterized conserved protein [Function unknown] 95.69
PRK13654351 magnesium-protoporphyrin IX monomethyl ester cyclase; P 95.52
cd01047323 ACSF Aerobic Cyclase System Fe-containing subunit (ACSF 95.23
CHL00185349 ycf59 magnesium-protoporphyrin IX monomethyl ester cycl 94.99
TIGR02029344 AcsF magnesium-protoporphyrin IX monomethyl ester aerob 96.6
cd01050297 Acyl_ACP_Desat Acyl ACP desaturase, ferritin-like diiro 95.96
pfam04305250 DUF455 Protein of unknown function (DUF455). 92.79
cd01058304 AAMH_B Aromatic and Alkene Monooxygenase Hydroxylase, s 95.76
cd07911280 RNRR2_Rv0233_like Ribonucleotide Reductase R2-like prot 95.6
>PRK07209 ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information
>PTZ00211 ribonucleotide reductase small subunit; Provisional Back     alignment and domain information
>COG0208 NrdF Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09101 nrdB ribonucleotide-diphosphate reductase subunit beta; Reviewed Back     alignment and domain information
>PRK09614 nrdF ribonucleotide-diphosphate reductase subunit beta; Reviewed Back     alignment and domain information
>KOG1567 consensus Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PRK13966 nrdF2 ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PRK13965 ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PRK13967 nrdF1 ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>cd01049 RNRR2 Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain Back     alignment and domain information
>pfam00268 Ribonuc_red_sm Ribonucleotide reductase, small chain Back     alignment and domain information
>cd07911 RNRR2_Rv0233_like Ribonucleotide Reductase R2-like protein, ferritin-like diiron-binding domain Back     alignment and domain information
>PRK08326 ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information
>cd01054 consensus Back     alignment and domain information
>pfam11583 AurF P-aminobenzoate N-oxygenase AurF Back     alignment and domain information
>pfam02332 Phenol_Hydrox Methane/Phenol/Toluene Hydroxylase Back     alignment and domain information
>cd00657 Ferritin_like Ferritin-like superfamily of diiron-containing four-helix-bundle proteins Back     alignment and domain information
>cd01057 AAMH_A Aromatic and Alkene Monooxygenase Hydroxylase, subunit A, ferritin-like diiron-binding domain Back     alignment and domain information
>pfam11266 DUF3066 Protein of unknown function (DUF3066) Back     alignment and domain information
>PRK13778 paaA phenylacetate-CoA oxygenase subunit PaaA; Provisional Back     alignment and domain information
>COG3396 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13654 magnesium-protoporphyrin IX monomethyl ester cyclase; Provisional Back     alignment and domain information
>cd01047 ACSF Aerobic Cyclase System Fe-containing subunit (ACSF), ferritin-like diiron-binding domain Back     alignment and domain information
>CHL00185 ycf59 magnesium-protoporphyrin IX monomethyl ester cyclase; Provisional Back     alignment and domain information
>TIGR02029 AcsF magnesium-protoporphyrin IX monomethyl ester aerobic oxidative cyclase; InterPro: IPR008434 This family represents the oxidative cyclase responsible for forming the distinctive E-ring of the chlorin ring system under aerobic conditions Back     alignment and domain information
>cd01050 Acyl_ACP_Desat Acyl ACP desaturase, ferritin-like diiron-binding domain Back     alignment and domain information
>pfam04305 DUF455 Protein of unknown function (DUF455) Back     alignment and domain information
>cd01058 AAMH_B Aromatic and Alkene Monooxygenase Hydroxylase, subunit B, ferritin-like diiron-binding domain Back     alignment and domain information
>cd07911 RNRR2_Rv0233_like Ribonucleotide Reductase R2-like protein, ferritin-like diiron-binding domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target352 ribonucleotide-diphosphate reductase subunit beta [Cand
1syy_A346 Crystal Structure Of The R2 Subunit Of Ribonucleoti 3e-79
2ani_A346 Crystal Structure Of The F127y Mutant Of Ribonucleo 3e-79
1h0n_A390 Cobalt Substitution Of Mouse R2 Ribonucleotide Redu 2e-71
2uw2_A332 Crystal Structure Of Human Ribonucleotide Reductase 6e-68
3hf1_A351 Crystal Structure Of Human P53r2 Length = 351 2e-67
1jk0_A419 Ribonucleotide Reductase Y2y4 Heterodimer Length = 2e-67
1smq_A399 Structure Of The Ribonucleotide Reductase Rnr2 Homo 2e-66
2p1i_A349 Plasmodium Yoelii Ribonucleotide Reductase Subunit 2e-64
2vux_A326 Human Ribonucleotide Reductase, Subunit M2 B Length 1e-59
2o1z_A311 Plasmodium Vivax Ribonucleotide Reductase Subunit R 1e-54
1jk0_B345 Ribonucleotide Reductase Y2y4 Heterodimer Length = 4e-48
2rcc_A346 Crystal Structure Of Putative Class I Ribonucleotid 1e-43
1piy_A375 Ribonucleotide Reductase R2 Soaked With Ferrous Ion 6e-37
1pim_A375 Dithionite Reduced E. Coli Ribonucleotide Reductase 6e-37
1rsr_A375 Azide Complex Of The Diferrous F208a Mutant R2 Subu 2e-36
1xik_A375 Ribonucleoside-Diphosphate Reductase 1 Beta Chain L 2e-36
1mrr_A375 Substitution Of Manganese For Iron In Ribonucleotid 2e-36
1biq_B375 Ribonucleoside-Diphosphate Reductase 1 Beta Chain M 2e-36
1biq_A375 Ribonucleoside-Diphosphate Reductase 1 Beta Chain M 2e-36
1rnr_A375 Autocatalytic Generation Of Dopa In The Engineered 3e-36
1pm2_A339 Crystal Structure Of Manganese Substituted R2-D84e 3e-36
2xof_A375 Ribonucleotide Reductase Y122no2y Modified R2 Subun 3e-36
1yfd_A375 Crystal Structure Of The Y122h Mutant Of Ribonucleo 4e-36
2av8_A340 Y122f Mutant Of Ribonucleotide Reductase From Esche 6e-36
1av8_A340 Ribonucleotide Reductase R2 Subunit From E. Coli Le 6e-36
1pfr_A340 Ribonucleoside-Diphosphate Reductase 1 Beta Chain L 7e-36
2alx_A340 Ribonucleotide Reductase R2 From Escherichia Coli I 1e-35
1pj0_A375 Ribonucleotide Reductase R2-D84eW48F MUTANT SOAKED 6e-35
3n37_A319 Ribonucleotide Reductase Dimanganese(Ii)-Nrdf From 6e-32
1kgn_A329 R2f From Corynebacterium Ammoniagenes In Its Oxidis 2e-31
2r2f_A319 Ribonucleotide Reductase R2f Protein From Salmonell 2e-30
1uzr_A296 Crystal Structure Of The Class Ib Ribonucleotide Re 9e-29
3mjo_A296 Small Subunit (R2f) Of Native Ribonucleotide Reduct 3e-28
3ee4_A323 R2-Like Ligand Binding MnFE OXIDASE FROM M. TUBERCU 2e-12
gi|51247460|pdb|1SYY|A Chain A, Crystal Structure Of The R2 Subunit Of Ribonucleotide Reductase From Chlamydia Trachomatis Length = 346 Back     alignment and structure
 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 193/343 (56%), Positives = 258/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N    DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 125 HTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM+GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   ++  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 245 NPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +T+NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 305 LKPIY-HTKNPFPWMSETIDLNKEKNFFETRVIEYQHAASLTW 346


>gi|112489977|pdb|2ANI|A Chain A, Crystal Structure Of The F127y Mutant Of Ribonucleotide Reductase R2 From Chlamydia Trachomatis Length = 346 Back     alignment and structure
gi|22218698|pdb|1H0N|A Chain A, Cobalt Substitution Of Mouse R2 Ribonucleotide Reductase To Model The Reactive Diferrous State Length = 390 Back     alignment and structure
>gi|145580571|pdb|2UW2|A Chain A, Crystal Structure Of Human Ribonucleotide Reductase Subunit R2 Length = 332 Back     alignment and structure
gi|261278726|pdb|3HF1|A Chain A, Crystal Structure Of Human P53r2 Length = 351 Back     alignment and structure
>gi|15826569|pdb|1JK0|A Chain A, Ribonucleotide Reductase Y2y4 Heterodimer Length = 419 Back     alignment and structure
gi|52695523|pdb|1SMQ|A Chain A, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer From Saccharomyces Cerevisiae Length = 399 Back     alignment and structure
gi|145580416|pdb|2P1I|A Chain A, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2 (Py03671) Length = 349 Back     alignment and structure
>gi|194319980|pdb|2VUX|A Chain A, Human Ribonucleotide Reductase, Subunit M2 B Length = 326 Back     alignment and structure
>gi|122921307|pdb|2O1Z|A Chain A, Plasmodium Vivax Ribonucleotide Reductase Subunit R2 (Pv086155) Length = 311 Back     alignment and structure
gi|15826570|pdb|1JK0|B Chain B, Ribonucleotide Reductase Y2y4 Heterodimer Length = 345 Back     alignment and structure
>gi|158430770|pdb|2RCC|A Chain A, Crystal Structure Of Putative Class I Ribonucleotide Reductase (Np_241368.1) From Bacillus Halodurans At 1.90 A Resolution Length = 346 Back     alignment and structure
>gi|42543283|pdb|1PIY|A Chain A, Ribonucleotide Reductase R2 Soaked With Ferrous Ion At Neutral Ph Length = 375 Back     alignment and structure
>gi|33358114|pdb|1PIM|A Chain A, Dithionite Reduced E. Coli Ribonucleotide Reductase R2 Subunit, D84e Mutant Length = 375 Back     alignment and structure
>gi|40889712|pdb|1RSR|A Chain A, Azide Complex Of The Diferrous F208a Mutant R2 Subunit Of Ribonucleotide Reductase Length = 375 Back     alignment and structure
>gi|1942079|pdb|1XIK|A Chain A, Ribonucleoside-Diphosphate Reductase 1 Beta Chain Length = 375 Back     alignment and structure
>gi|494379|pdb|1MRR|A Chain A, Substitution Of Manganese For Iron In Ribonucleotide Reductase From Escherichia Coli. Spectroscopic And Crystallographic Characterization Length = 375 Back     alignment and structure
>gi|4389292|pdb|1BIQ|B Chain B, Ribonucleoside-Diphosphate Reductase 1 Beta Chain Mutant E238a Length = 375 Back     alignment and structure
>gi|4389291|pdb|1BIQ|A Chain A, Ribonucleoside-Diphosphate Reductase 1 Beta Chain Mutant E238a Length = 375 Back     alignment and structure
>gi|157879968|pdb|1RNR|A Chain A, Autocatalytic Generation Of Dopa In The Engineered Protein R2 F208y From Escherichia Coli Ribonucleotide Reductase And Crystal Structure Of The Dopa-208 Protein Length = 375 Back     alignment and structure
>gi|42543295|pdb|1PM2|A Chain A, Crystal Structure Of Manganese Substituted R2-D84e (D84e Mutant Of The R2 Subunit Of E. Coli Ribonucleotide Reductase) Length = 339 Back     alignment and structure
>gi|304445703|pdb|2XOF|A Chain A, Ribonucleotide Reductase Y122no2y Modified R2 Subunit Of E. Coli Length = 375 Back     alignment and structure
>gi|61680624|pdb|1YFD|A Chain A, Crystal Structure Of The Y122h Mutant Of Ribonucleotide Reductase R2 Protein From E. Coli Length = 375 Back     alignment and structure
>gi|3891570|pdb|2AV8|A Chain A, Y122f Mutant Of Ribonucleotide Reductase From Escherichia Coli Length = 340 Back     alignment and structure
>gi|3891582|pdb|1AV8|A Chain A, Ribonucleotide Reductase R2 Subunit From E. Coli Length = 340 Back     alignment and structure
>gi|1941986|pdb|1PFR|A Chain A, Ribonucleoside-Diphosphate Reductase 1 Beta Chain Length = 340 Back     alignment and structure
>gi|83754022|pdb|2ALX|A Chain A, Ribonucleotide Reductase R2 From Escherichia Coli In Space Group P6(1)22 Length = 340 Back     alignment and structure
>gi|42543287|pdb|1PJ0|A Chain A, Ribonucleotide Reductase R2-D84eW48F MUTANT SOAKED WITH Ferrous Ions At Neutral Ph Length = 375 Back     alignment and structure
gi|303325061|pdb|3N37|A Chain A, Ribonucleotide Reductase Dimanganese(Ii)-Nrdf From Escherichia Coli Length = 319 Back     alignment and structure
>gi|18158911|pdb|1KGN|A Chain A, R2f From Corynebacterium Ammoniagenes In Its Oxidised, Fe Containing, Form Length = 329 Back     alignment and structure
gi|4389108|pdb|2R2F|A Chain A, Ribonucleotide Reductase R2f Protein From Salmonella Typhimurium (Oxidized) Length = 319 Back     alignment and structure
>gi|51247866|pdb|1UZR|A Chain A, Crystal Structure Of The Class Ib Ribonucleotide Reductase R2f-2 Subunit From Mycobacterium Tuberculosis Length = 296 Back     alignment and structure
>gi|304445906|pdb|3MJO|A Chain A, Small Subunit (R2f) Of Native Ribonucleotide Reductase From Corynebacterium Ammoniagenes Length = 296 Back     alignment and structure
>gi|226438223|pdb|3EE4|A Chain A, R2-Like Ligand Binding MnFE OXIDASE FROM M. TUBERCULOSIS Length = 323 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target352 ribonucleotide-diphosphate reductase subunit beta [Cand
1syy_A346 Ribonucleoside-diphosphate reductase beta chain; DIIRON 3e-87
1jk0_A419 RNR Y2, ribonucleoside-diphosphate reductase small chai 1e-74
3dhz_A329 Ribonucleotide reductase subunit R2F; metal free, hydro 8e-74
1h0o_A390 Ribonucleoside-diphosphate reductase; oxidoreductase, r 1e-73
1jk0_B345 RNR Y4, ribonucleoside-diphosphate reductase small chai 1e-71
1mxr_A375 Ribonucleotide reductase R2; radical protein, DI iron, 6e-70
3n37_A319 Ribonucleoside-diphosphate reductase 2 subunit BE; ribo 3e-64
1r2f_A319 Protein (ribonucleotide reductase R2); nucleotide metab 6e-64
2p1i_A349 Ribonucleotide reductase, small chain; F222 twinning, p 7e-59
2rcc_A346 Ribonucleoside-diphosphate reductase subunit beta; NP_2 9e-56
3mjo_A296 Ribonucleotide reductase subunit R2F; Mn ribonucleotide 1e-54
2o1z_A311 Ribonucleotide reductase subunit R2; small subunit ribo 1e-52
3ee4_A323 Probable ribonucleoside-diphosphate reductase; manganes 3e-52
3ge3_A 500 Toluene-4-monooxygenase system protein A; DIIRON hydrox 7e-05
>1syy_A Ribonucleoside-diphosphate reductase beta chain; DIIRON, oxygen activation, iron coupled radical, immune evasion, replication; 1.70A {Chlamydia trachomatis} SCOP: a.25.1.2 PDB: 2ani_A Length = 346 Back     alignment and structure
 Score =  317 bits (812), Expect = 3e-87
 Identities = 193/343 (56%), Positives = 258/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 125 HTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM+GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   ++  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 245 NPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++  T+NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 305 LKPIYH-TKNPFPWMSETIDLNKEKNFFETRVIEYQHAASLTW 346


>1jk0_A RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1smq_A Length = 419 Back     alignment and structure
>3dhz_A Ribonucleotide reductase subunit R2F; metal free, hydrogen bond, metal binding protein; 1.63A {Corynebacterium ammoniagenes} SCOP: a.25.1.2 PDB: 1kgo_A 1kgp_A 1oqu_A 1kgn_A 1uzr_A* Length = 329 Back     alignment and structure
>1h0o_A Ribonucleoside-diphosphate reductase; oxidoreductase, ribonucleotide reductase, dinuclear metal-cluster; 2.2A {Mus musculus} SCOP: a.25.1.2 PDB: 1h0n_A 1w68_A 1w69_A 1xsm_A 2uw2_A 3hf1_A 2vux_A Length = 390 Back     alignment and structure
>1jk0_B RNR Y4, ribonucleoside-diphosphate reductase small chain 2; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1sms_A Length = 345 Back     alignment and structure
>1mxr_A Ribonucleotide reductase R2; radical protein, DI iron, oxidoreductase; 1.42A {Escherichia coli} SCOP: a.25.1.2 PDB: 1jpr_A 1jqc_A 1xik_A 1yfd_A 1piy_A 1r65_A 1biq_B* 1rsv_A 1piz_A 1piu_A 1pim_A 1rsr_A 1biq_A* 1rib_A 1mrr_A 1rnr_A* 1pj0_A 1pj1_A 1av8_A 1pfr_A ... Length = 375 Back     alignment and structure
>3n37_A Ribonucleoside-diphosphate reductase 2 subunit BE; ribonucleotide reductase, four-helix bundle, dimanganese CLU oxidoreductase; 1.65A {Escherichia coli} PDB: 3n38_A 3n39_B* 3n3a_B* 3n3b_B* 1r2f_A 2bq1_I* 2r2f_A Length = 319 Back     alignment and structure
>1r2f_A Protein (ribonucleotide reductase R2); nucleotide metabolism, oxidoreductase; 2.10A {Salmonella typhimurium} SCOP: a.25.1.2 PDB: 2bq1_I* 2r2f_A Length = 319 Back     alignment and structure
>2p1i_A Ribonucleotide reductase, small chain; F222 twinning, plasmodb PY03671, structural genomics consortium, SGC, oxidoreductase; 2.70A {Plasmodium yoelii yoelii str} Length = 349 Back     alignment and structure
>2rcc_A Ribonucleoside-diphosphate reductase subunit beta; NP_241368.1, putative class I ribonucleotide reductase, ribonucleotide reductase; HET: MSE PGE PG4; 1.90A {Bacillus halodurans c-125} Length = 346 Back     alignment and structure
>3mjo_A Ribonucleotide reductase subunit R2F; Mn ribonucleotide reductase, RNR, radical enzyme, split SIGN metallocofactor; 1.36A {Corynebacterium ammoniagenes} PDB: 1uzr_A* Length = 296 Back     alignment and structure
>2o1z_A Ribonucleotide reductase subunit R2; small subunit ribonucleotide reductase, oxidoreductase, DNA replication, iron, DIIRON, radical, R2 subunit; 2.40A {Plasmodium vivax} Length = 311 Back     alignment and structure
>3ee4_A Probable ribonucleoside-diphosphate reductase; manganese, iron, DIIRON, carboxylate, oxidase, ligand, cavity, monooxygenase; HET: MYR; 1.90A {Mycobacterium tuberculosis} Length = 323 Back     alignment and structure
>3ge3_A Toluene-4-monooxygenase system protein A; DIIRON hydroxylase, effector protein, T201A, aromatic hydrocarbons catabolism, FAD, flavoprotein; 1.52A {Pseudomonas mendocina} PDB: 3ge8_A 3dhi_A* 3dhh_A* 3dhg_A* 3i5j_A 3i63_A Length = 500 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target352 ribonucleotide-diphosphate reductase subunit beta [Cand
1syy_A346 Ribonucleoside-diphosphate reductase beta chain; DIIRON 100.0
2rcc_A346 Ribonucleoside-diphosphate reductase subunit beta; NP_2 100.0
1h0o_A390 Ribonucleoside-diphosphate reductase; oxidoreductase, r 100.0
1mxr_A375 Ribonucleotide reductase R2; radical protein, DI iron, 100.0
1jk0_A419 RNR Y2, ribonucleoside-diphosphate reductase small chai 100.0
2p1i_A349 Ribonucleotide reductase, small chain; F222 twinning, p 100.0
1jk0_B345 RNR Y4, ribonucleoside-diphosphate reductase small chai 100.0
3ee4_A323 Probable ribonucleoside-diphosphate reductase; manganes 100.0
3n37_A319 Ribonucleoside-diphosphate reductase 2 subunit BE; ribo 100.0
3dhz_A329 Ribonucleotide reductase subunit R2F; metal free, hydro 100.0
3mjo_A296 Ribonucleotide reductase subunit R2F; Mn ribonucleotide 100.0
2o1z_A311 Ribonucleotide reductase subunit R2; small subunit ribo 100.0
2inc_A 491 Toluene, O-xylene monooxygenase oxygenase subunit; DIIR 99.24
3ge3_A 500 Toluene-4-monooxygenase system protein A; DIIRON hydrox 98.88
1mty_D 512 Methane monooxygenase hydroxylase; dinuclear iron cente 98.6
2inp_A 494 Phenol hydroxylase component PHN; DIIRON, four-helix bu 98.32
2inp_C328 Phenol hydroxylase component PHL; DIIRON, four-helix bu 98.13
2oc5_A244 Hypothetical protein; NP_895059.1, structural genomics, 97.94
1mhy_B395 Methane monooxygenase hydroxylase; oxidoreductase, NADP 97.65
1mty_B384 Methane monooxygenase hydroxylase; dinuclear iron cente 97.65
2inc_B322 Toluene, O-xylene monooxygenase oxygenase subunit; DIIR 97.1
3ez0_A225 Uncharacterized protein with ferritin-like fold; YP_832 96.52
3chh_A336 P-aminobenzoate N-oxygenase; DI-iron oxygenase, oxidore 95.31
3ge3_B327 Toluene-4-monooxygenase system protein E; DIIRON hydrox 97.77
2uw1_A338 Desaturase, plastid delta4 multifunctional acyl-ACYL ca 97.76
1za0_A275 Possible acyl-[acyl-carrier protein] desaturase DESA2 ( 97.74
2fzf_A175 Hypothetical protein; structural genomics, southeast co 92.35
1vjx_A157 Putative ferritin-like DIIRON-carboxylate protein TM152 91.87
>1syy_A Ribonucleoside-diphosphate reductase beta chain; DIIRON, oxygen activation, iron coupled radical, immune evasion, replication; 1.70A {Chlamydia trachomatis} SCOP: a.25.1.2 PDB: 2ani_A Back     alignment and structure
Probab=100.00  E-value=0  Score=656.12  Aligned_cols=344  Identities=56%  Similarity=1.017  Sum_probs=331.5

Q ss_pred             CCCHHCCCCCCCCHHHCCCCCCCC-CCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             641000654578813374868899-8000178616799999999994579870367479899852026899899999999
Q gi|254780964|r    6 GLSPIQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKR   84 (352)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~-~~~~l~p~kY~~~~~ly~k~~~~fW~peEi~l~~D~~dw~t~~~Lt~~Ek~~~~~   84 (352)
                      +.+++++|+++++.++|||++|++ |+++++|+||||+|++|++++++||+|+|||+++|++||++ ++||++||+++++
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~g~~~~~~~l~PikYp~~~~~ykk~~~~fW~peEi~ls~D~~dw~~-~kL~~~er~~~~~   80 (346)
T 1syy_A            2 QADILDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELWKS-DRLSEDERRVILL   80 (346)
T ss_dssp             CCSSGGGGGGSCCGGGCCSSSCCSSCTTCCCSCCCHHHHHHHHHHHHTCCCGGGSCCHHHHHHHHS-SCSCHHHHHHHHH
T ss_pred             CCCHHCCCCCCCCCCCCEEECCCCCCHHHCCCCCCHHHHHHHHHHHHCCCCCHHCCCCCCHHHHHH-CCCCHHHHHHHHH
T ss_conf             741310545456711040258998765550898777999999999976998311075123988865-8999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999864333345566640133057799999999999999778999999997146469999999720018987788999
Q gi|254780964|r   85 NLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQ  164 (352)
Q Consensus        85 ~l~~~~~~D~~v~~~~~~~i~~~~~~~E~~~~l~~q~~~E~iH~~sYs~il~~l~~~~~e~f~~~~~~~~i~~k~~~~~~  164 (352)
                      +|++|+.+|++|+.+++..+++.++.||+++++++|+++|+||++||++++++++++++++|+++.++|.+++|++++.+
T Consensus        81 ~l~~~~~~D~~v~~~~~~~~~~~~~~~E~~~~~~~~~~~E~iHs~sYs~i~~~l~~d~~e~~~~~~~~~~i~~k~~~~~~  160 (346)
T 1syy_A           81 NLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHTHTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQME  160 (346)
T ss_dssp             HHHHHHHHHHHHHHHHHHTHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCHHHHTTHHHHCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999989889983079989988380999999999999999999999999998568889999998405999999999998


Q ss_pred             HHHHHCCCHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99740121010267774014999999997400014441147889989975980128999999985666669999999997
Q gi|254780964|r  165 YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ  244 (352)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~lEGi~Fys~Fa~~~~l~~~g~m~g~~~~i~~I~RDE~lH~~f~~~l~~~  244 (352)
                      +++............+..+.++++++++++++||++|||||+++++|+++|+|+|++++|++|+|||++|+.|++.++++
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lEgi~f~s~F~~~~~l~~~g~m~g~~~~i~~I~RDE~~H~~~~~~l~~~  240 (346)
T 1syy_A          161 ITGKVLDPNFRTDSVEGLQEFVKNLVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLING  240 (346)
T ss_dssp             TTSGGGSTTCCSSSHHHHHHHHHHHHHHHTTTTTTHHHHHHHHHHHHHHTTSSHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             66410033311023100899999999999999999999999999999877998544998778614578899999999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHH
Q ss_conf             65537542206789999999999998768868875188847999899999999999999997887988999888325789
Q gi|254780964|r  245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMS  324 (352)
Q Consensus       245 l~~E~p~l~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~yi~y~an~rL~~lG~~~~f~~~~nP~~W~~  324 (352)
                      +++|+|+++++++.+++++++++||++|++|++++|+.|++||+++++++||+|+||+||.+||++|+|++ +||+|||+
T Consensus       241 l~~e~~~~~~~~~~~~i~~l~~~ave~E~~~~~~~~~~~~~Gl~~~~~~~Yv~y~an~rL~~lG~~~~f~~-~nP~~w~~  319 (346)
T 1syy_A          241 IKEENPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIGLKPIYHT-KNPFPWMS  319 (346)
T ss_dssp             HHHHCGGGCCHHHHHHHHHHHHHHHHHHHHHHHHHCSSCBTTBCHHHHHHHHHHHHHHHHHHTTCCCSSCC-CCSCTTC-
T ss_pred             HHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCC-CCCHHHHH
T ss_conf             98519787568999999999999999999999985658878999999999999999999997799998999-99637899


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             971788675557667112210586778
Q gi|254780964|r  325 EVIDLKKEKNFFETRVTEYQQGAELKW  351 (352)
Q Consensus       325 ~~~~~~~~tnFFe~~~t~Y~k~~~~~~  351 (352)
                      +.++++++|||||+|||+|+|+|.++|
T Consensus       320 ~~~~~~~~~nFFe~r~~~Y~k~~~~~~  346 (346)
T 1syy_A          320 ETIDLNKEKNFFETRVIEYQHAASLTW  346 (346)
T ss_dssp             ---------------------------
T ss_pred             HHHCCCCCCCCCCCCHHCCCCCCCCCC
T ss_conf             863867776878897210454577889



>2rcc_A Ribonucleoside-diphosphate reductase subunit beta; NP_241368.1, putative class I ribonucleotide reductase, ribonucleotide reductase; HET: MSE PGE PG4; 1.90A {Bacillus halodurans c-125} Back     alignment and structure
>1h0o_A Ribonucleoside-diphosphate reductase; oxidoreductase, ribonucleotide reductase, dinuclear metal-cluster; 2.2A {Mus musculus} SCOP: a.25.1.2 PDB: 1h0n_A 1w68_A 1w69_A 1xsm_A 2uw2_A 3hf1_A 2vux_A Back     alignment and structure
>1mxr_A Ribonucleotide reductase R2; radical protein, DI iron, oxidoreductase; 1.42A {Escherichia coli} SCOP: a.25.1.2 PDB: 1jpr_A 1jqc_A 1xik_A 1yfd_A 1piy_A 1r65_A 1biq_B* 1rsv_A 1piz_A 1piu_A 1pim_A 1rsr_A 1biq_A* 1rib_A 1mrr_A 1rnr_A* 1pj0_A 1pj1_A 1av8_A 1pfr_A ... Back     alignment and structure
>1jk0_A RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1smq_A Back     alignment and structure
>2p1i_A Ribonucleotide reductase, small chain; F222 twinning, plasmodb PY03671, structural genomics consortium, SGC, oxidoreductase; 2.70A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1jk0_B RNR Y4, ribonucleoside-diphosphate reductase small chain 2; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1sms_A Back     alignment and structure
>3ee4_A Probable ribonucleoside-diphosphate reductase; manganese, iron, DIIRON, carboxylate, oxidase, ligand, cavity, monooxygenase; HET: MYR; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3n37_A Ribonucleoside-diphosphate reductase 2 subunit BE; ribonucleotide reductase, four-helix bundle, dimanganese CLU oxidoreductase; 1.65A {Escherichia coli} PDB: 3n38_A 3n39_B* 3n3a_B* 3n3b_B* 1r2f_A 2bq1_I* 2r2f_A Back     alignment and structure
>3dhz_A Ribonucleotide reductase subunit R2F; metal free, hydrogen bond, metal binding protein; 1.63A {Corynebacterium ammoniagenes} SCOP: a.25.1.2 PDB: 1kgo_A 1kgp_A 1oqu_A 1kgn_A 1uzr_A* Back     alignment and structure
>3mjo_A Ribonucleotide reductase subunit R2F; Mn ribonucleotide reductase, RNR, radical enzyme, split SIGN metallocofactor; 1.36A {Corynebacterium ammoniagenes} PDB: 1uzr_A* Back     alignment and structure
>2o1z_A Ribonucleotide reductase subunit R2; small subunit ribonucleotide reductase, oxidoreductase, DNA replication, iron, DIIRON, radical, R2 subunit; 2.40A {Plasmodium vivax} Back     alignment and structure
>2inc_A Toluene, O-xylene monooxygenase oxygenase subunit; DIIRON, 4-helix bundle, carboxylate bridge, metalloenzyme, oxidoreductase; HET: P6G; 1.85A {Pseudomonas stutzeri} SCOP: a.25.1.2 PDB: 2ind_A* 1t0q_A 1t0r_A 1t0s_A 2rdb_A* Back     alignment and structure
>3ge3_A Toluene-4-monooxygenase system protein A; DIIRON hydroxylase, effector protein, T201A, aromatic hydrocarbons catabolism, FAD, flavoprotein; 1.52A {Pseudomonas mendocina} PDB: 3ge8_A 3dhi_A* 3dhh_A* 3dhg_A* 3i5j_A 3i63_A Back     alignment and structure
>1mty_D Methane monooxygenase hydroxylase; dinuclear iron center monooxygenase; 1.70A {Methylococcus capsulatus str} SCOP: a.25.1.2 PDB: 1mmo_D 1xvb_A 1fyz_A 1fz0_A 1fz2_A 1fz3_A 1fz4_A 1fz5_A 1fz6_A 1fz7_A 1fz8_A 1fz9_A 1fzh_A 1fzi_A 1xmf_A 1xmg_A 1xmh_A 1xu3_A 1xu5_A 1fz1_A ... Back     alignment and structure
>2inp_A Phenol hydroxylase component PHN; DIIRON, four-helix bundle, regulatory protein, oxidoreductase; 2.30A {Pseudomonas stutzeri} PDB: 2inn_A Back     alignment and structure
>2inp_C Phenol hydroxylase component PHL; DIIRON, four-helix bundle, regulatory protein, oxidoreductase; 2.30A {Pseudomonas stutzeri} PDB: 2inn_C Back     alignment and structure
>2oc5_A Hypothetical protein; NP_895059.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: UNL; 1.68A {Prochlorococcus marinus str} SCOP: a.25.1.6 Back     alignment and structure
>1mhy_B Methane monooxygenase hydroxylase; oxidoreductase, NADP, one-carbon metabolism; 2.00A {Methylosinus trichosporium} SCOP: a.25.1.2 PDB: 1mhz_B Back     alignment and structure
>1mty_B Methane monooxygenase hydroxylase; dinuclear iron center monooxygenase; 1.70A {Methylococcus capsulatus str} SCOP: a.25.1.2 PDB: 1xvb_C 1fyz_C 1fz0_C 1fz2_C 1fz3_C 1fz4_C 1fz5_C 1fz6_C 1fz7_C 1fz8_C 1fz9_C 1fzh_C 1fzi_C 1xu3_C 1xu5_C 1fz1_C 1xvc_C 1xvd_C 1xve_C 1xvf_C ... Back     alignment and structure
>2inc_B Toluene, O-xylene monooxygenase oxygenase subunit; DIIRON, 4-helix bundle, carboxylate bridge, metalloenzyme, oxidoreductase; HET: P6G; 1.85A {Pseudomonas stutzeri} SCOP: a.25.1.2 PDB: 2rdb_B* 1t0r_B 1t0s_B 1t0q_B* 2ind_B* Back     alignment and structure
>3ez0_A Uncharacterized protein with ferritin-like fold; YP_832262.1, protein of unknown function with ferritin-like fold, structural genomics; HET: UNL TLA; 2.33A {Arthrobacter SP} Back     alignment and structure
>3chh_A P-aminobenzoate N-oxygenase; DI-iron oxygenase, oxidoreductase; 2.00A {Streptomyces thioluteus} PDB: 3chi_A 3cht_A* 3chu_A 2jcd_A Back     alignment and structure
>3ge3_B Toluene-4-monooxygenase system protein E; DIIRON hydroxylase, effector protein, T201A, aromatic hydrocarbons catabolism, FAD, flavoprotein; 1.52A {Pseudomonas mendocina} PDB: 3ge8_B 3i5j_B 3i63_B 3dhi_B* 3dhh_B* 3dhg_B* Back     alignment and structure
>2uw1_A Desaturase, plastid delta4 multifunctional acyl-ACYL carrier protein desaturase; electron transfer, four-helix bundle, oxidoreductase; HET: GVM; 1.95A {Hedera helix} PDB: 2uw1_B* 1oq4_A 1oq7_A 1oq9_A 1oqb_A 1afr_A 2j2f_A Back     alignment and structure
>1za0_A Possible acyl-[acyl-carrier protein] desaturase DESA2 (acyl-[ACP] desaturase) (stearoyl-ACP...; four-helix bundle; 2.00A {Mycobacterium tuberculosis H37RV} SCOP: a.25.1.2 Back     alignment and structure
>2fzf_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.70A {Pyrococcus furiosus} SCOP: a.25.1.1 Back     alignment and structure
>1vjx_A Putative ferritin-like DIIRON-carboxylate protein TM1526; structural genomics, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.25.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 352 ribonucleotide-diphosphate reductase subunit beta [Cand
d1syya_317 a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamydia tr 1e-76
d1mxra_339 a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia 9e-55
d1jk0a_334 a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeas 4e-53
d1w68a_281 a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus m 4e-46
d1jk0b_285 a.25.1.2 (B:) Ribonucleotide reductase R2 {Baker's yeas 2e-45
d1r2fa_283 a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmonella t 2e-44
d3dhza1284 a.25.1.2 (A:14-297) Ribonucleotide reductase R2 {Coryne 4e-44
d2inca1 491 a.25.1.2 (A:2-492) Toluene, o-xylene monooxygenase oxyg 1e-04
>d1syya_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamydia trachomatis [TaxId: 813]} Length = 317 Back     information, alignment and structure

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Ribonucleotide reductase R2
species: Chlamydia trachomatis [TaxId: 813]
 Score =  280 bits (717), Expect = 1e-76
 Identities = 172/315 (54%), Positives = 237/315 (75%), Gaps = 3/315 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 5   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 64

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 65  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 123

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 124 HTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 183

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM+GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 184 LVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEE 243

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   ++  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 244 NPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIG 303

Query: 309 LEPLFKYTENPFPWM 323
           L+P++  T+NPFPWM
Sbjct: 304 LKPIYH-TKNPFPWM 317


>d1mxra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]} Length = 339 Back     information, alignment and structure
>d1jk0a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]} Length = 334 Back     information, alignment and structure
>d1w68a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1jk0b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y4 [TaxId: 4932]} Length = 285 Back     information, alignment and structure
>d1r2fa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 90371]} Length = 283 Back     information, alignment and structure
>d3dhza1 a.25.1.2 (A:14-297) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 284 Back     information, alignment and structure
>d2inca1 a.25.1.2 (A:2-492) Toluene, o-xylene monooxygenase oxygenase subunit TouA {Pseudomonas stutzeri [TaxId: 316]} Length = 491 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target352 ribonucleotide-diphosphate reductase subunit beta [Cand
d1syya_317 Ribonucleotide reductase R2 {Chlamydia trachomatis [Tax 100.0
d1mxra_339 Ribonucleotide reductase R2 {Escherichia coli [TaxId: 5 100.0
d1jk0a_334 Ribonucleotide reductase R2 {Baker's yeast (Saccharomyc 100.0
d1w68a_281 Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxI 100.0
d1jk0b_285 Ribonucleotide reductase R2 {Baker's yeast (Saccharomyc 100.0
d3dhza1284 Ribonucleotide reductase R2 {Corynebacterium ammoniagen 100.0
d1r2fa_283 Ribonucleotide reductase R2 {Salmonella typhimurium [Ta 100.0
d2inca1 491 Toluene, o-xylene monooxygenase oxygenase subunit TouA 98.97
d1mtyd_ 512 Methane monooxygenase hydrolase alpha subunit {Methyloc 98.67
d2oc5a1222 Hypothetical protein PMT1231 {Prochlorococcus marinus [ 98.03
d1mtyb_384 Methane monooxygenase hydrolase beta subunit {Methyloco 97.78
d1mhyb_383 Methane monooxygenase hydrolase beta subunit {Methylosi 97.76
d2incb1322 Toluene, o-xylene monooxygenase oxygenase subunit TouE 97.46
d1za0a1267 Possible acyl-[acyl-carrier protein] desaturase {Mycoba 97.47
d1afra_345 delta 9-stearoyl-acyl carrier protein desaturase {Casto 96.92
d2fzfa1158 Hypothetical protein PF1190 {Archaeon Pyrococcus furios 94.59
>d1syya_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamydia trachomatis [TaxId: 813]} Back     information, alignment and structure
class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Ribonucleotide reductase R2
species: Chlamydia trachomatis [TaxId: 813]
Probab=100.00  E-value=0  Score=586.46  Aligned_cols=315  Identities=54%  Similarity=1.009  Sum_probs=302.8

Q ss_pred             CCHHCCCCCCCCHHHCCCCCCCC-CCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             41000654578813374868899-80001786167999999999945798703674798998520268998999999999
Q gi|254780964|r    7 LSPIQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRN   85 (352)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~-~~~~l~p~kY~~~~~ly~k~~~~fW~peEi~l~~D~~dw~t~~~Lt~~Ek~~~~~~   85 (352)
                      .+.+++|.++++..+|||++|++ |+++++|+||||+|++|++++++||+|+|||+++|++||++ ++|++.||++++++
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~p~kYp~~~~~yk~~~~~fW~peEi~ls~D~~dw~~-~kL~~~e~~~~~~~   80 (317)
T d1syya_           2 ADILDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELWKS-DRLSEDERRVILLN   80 (317)
T ss_dssp             CSSGGGGGGSCCGGGCCSSSCCSSCTTCCCSCCCHHHHHHHHHHHHTCCCGGGSCCHHHHHHHHS-SCSCHHHHHHHHHH
T ss_pred             CCHHHCCCCCCCCCCCEEECCCCCCHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHH-CCCCHHHHHHHHHH
T ss_conf             21321534456711140268998765551898777999999999976999510574013888865-88998999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99998643333455666401330577999999999999997789999999971464699999997200189877889999
Q gi|254780964|r   86 LGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQY  165 (352)
Q Consensus        86 l~~~~~~D~~v~~~~~~~i~~~~~~~E~~~~l~~q~~~E~iH~~sYs~il~~l~~~~~e~f~~~~~~~~i~~k~~~~~~~  165 (352)
                      |++|+.+|++|++++...+++.++.||+++++++|+++|+||++|||+++++++.|++|+|+++.++|.+++|++++.++
T Consensus        81 l~~~~~~d~~v~~~~~~~l~~~i~~pE~~~~~~~q~~~E~iH~~sYs~il~~l~~d~~e~~~~~~~~~~i~~k~~~~~~~  160 (317)
T d1syya_          81 LGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHTHTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEI  160 (317)
T ss_dssp             HHHHHHHHHHHHHHHHHTHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCHHHHTTHHHHCHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998886687540576401237859999999999999878999999999985677899999984299999999999997


Q ss_pred             HHHHCCCHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97401210102677740149999999974000144411478899899759801289999999856666699999999976
Q gi|254780964|r  166 TQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI  245 (352)
Q Consensus       166 ~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~lEGi~Fys~Fa~~~~l~~~g~m~g~~~~i~~I~RDE~lH~~f~~~l~~~l  245 (352)
                      +....+........+..+.++.+++++++++||++|||||+++++|+++|+|+|+|++|++|+|||++|+.|++.+++++
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lEgi~F~s~F~~~~~l~~~g~m~g~~~~i~~I~RDE~lH~~f~~~l~~~l  240 (317)
T d1syya_         161 TGKVLDPNFRTDSVEGLQEFVKNLVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGI  240 (317)
T ss_dssp             TSGGGSTTCCSSSHHHHHHHHHHHHHHHTTTTTTHHHHHHHHHHHHHHTTSSHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             75311434344644339999999999999999999977999999987335421089998999811887866999999998


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             553754220678999999999999876886887518884799989999999999999999788798899988832578
Q gi|254780964|r  246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWM  323 (352)
Q Consensus       246 ~~E~p~l~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~yi~y~an~rL~~lG~~~~f~~~~nP~~W~  323 (352)
                      ++|+|++++++..+++++++++||++|++|++++++.|++|||++++++||+|+||+||.+||++|+|++ +||+|||
T Consensus       241 ~~e~~e~~~~~~~~~i~el~~eav~~E~~~~~~~~~~~~~Gl~~~~l~~Yv~y~an~~L~~LG~~~~f~~-~NP~~wm  317 (317)
T d1syya_         241 KEENPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIGLKPIYHT-KNPFPWM  317 (317)
T ss_dssp             HHHCGGGCCHHHHHHHHHHHHHHHHHHHHHHHHHCSSCBTTBCHHHHHHHHHHHHHHHHHHTTCCCSSCC-CCSCTTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCC-CCCCCCC
T ss_conf             5505999863359999999999999999999998379878999999999999999999997799999989-9998979



>d1mxra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jk0a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]} Back     information, alignment and structure
>d1w68a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure