254780967

254780967

probable multidrug resistance transporter protein

GeneID in NCBI database:8209989Locus tag:CLIBASIA_04340
Protein GI in NCBI database:254780967Protein Accession:YP_003065380.1
Gene range:-(963946, 965142)Protein Length:398aa
Gene description:probable multidrug resistance transporter protein
COG prediction:[G] [E] [P] [R] Permeases of the major facilitator superfamily
KEGG prediction:probable multidrug resistance transporter protein; K07552 MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein
SEED prediction:Drug resistance transporter, Bcr/CflA family
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM11 TM-Helix
TOPPRED11 TM-Helix
HMMTOP12 TM-Helix
MEMSAT12 TM-Helix
MEMSAT_SVM12 TM-Helix
PHOBIUS12 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MEFVIVIAMLMAINSLGIDIILPCLPKISDSLHLSNENYGQHLISFYLIGYGIAQIFYGPLSDRFGRKIVMMFGLVIHIISTFIMVTINSFTGMLCMRLIQGIGGAAPRIITISIIRDIYDGRDMAKVLSIAMMIFMIMPILAPSIGQATVALSGGWIGIFVCMGVITTFITLWYYIRFPETLDPRDVRPLNLYAILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQLGNLFPIAFAVGGFAMSIASFINSRLVEKFGIRRVSHYSLLIFFMITGSWLLVQITSNHPIHLLIFIAFFFLASFQFGLINSNFSSISMEPFSHLAGTASSIFGFINTVISTILGIIIGQSFNGTTYPITIGFFGIAVSSFICILIVEKNQMFRKTELR
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccc
cHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHccc
MEFVIVIAMLMAINSLGidiilpclpkisdslhlsnenyGQHLISFYLIGYGIAqifygplsdrfGRKIVMMFGLVIHIISTFIMVTINSFTGMLCMRLIQGIGGAAPRIITISIIRDIYDGRDMAKVLSIAMMIFMIMpilapsigQATVALSGGWIGIFVCMGVITTFITLWYyirfpetldprdvrplNLYAILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQLGNLFPIAFAVGGFAMSIASFINSRLVEKFGIRRVSHYSLLIFFMITGSWLLVQITSNHPIHLLIFIAFFFLASFQfglinsnfssismepfshlagtaSSIFGFINTVISTILGIIigqsfngttypitIGFFGIAVSSFICILIVEKNQMFRKTELR
MEFVIVIAMLMAINSLGIDIILPCLPKISDSLHLSNENYGQHLISFYLIGYGIAQIFYGPLSDRFGRKIVMMFGLVIHIISTFIMVTINSFTGMLCMRLIQGIGGAAPRIITISIIRDIYDGRDMAKVLSIAMMIFMIMPILAPSIGQATVALSGGWIGIFVCMGVITTFITLWYYIRFPETLDPRDVRPLNLYAILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQLGNLFPIAFAVGGFAMSIASFINSRLVEKFGIRRVSHYSLLIFFMITGSWLLVQITSNHPIHLLIFIAFFFLASFQFGLINSNFSSISMEPFSHLAGTASSIFGFINTVISTILGIIIGQSFNGTTYPITIGFFGIAVSSFICILIVEknqmfrktelr
MEFVIVIAMLMAINSLGIDIILPCLPKISDSLHLSNENYGQHLISFYLIGYGIAQIFYGPLSDRFGRKIVMMFGLVIHIISTFIMVTINSFTGMLCMRLIQGIGGAAPRiitisiirdiYDGRDMAKVLSIAMMIFMIMPILAPSIGQATVALSGGWIGIFVCMGVITTFITLWYYIRFPETLDPRDVRPLNLYAILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQLGNLFPIAFAVGGFAMSIASFINSRLVEKFGIRRVSHYSLLIFFMITGSWLLVQITSNHPihllifiaffflasfqfgliNSNFSSISMEPFSHLAGTASSIFGFINTVISTILGIIIGQSFNGTTYPITIGFFGIAVSSFICILIVEKNQMFRKTELR
MEFVIVIAMLMAINSLGIDIILPCLPKISDSLHLSNENYGQHLISFYLIGYGIAQIFYGPLSDRFGRKIVMMFGLVIHIISTFIMVTINSFTGMLCMRLIQGIGGAAPRIITISIIRDIYDGRDMAKVLSIAMMIFMIMPILAPSIGQATVALSGGWIGIFVCMGVITTFITLWYYIRFPET*************ILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQLGNLFPIAFAVGGFAMSIASFINSRLVEKFGIRRVSHYSLLIFFMITGSWLLVQITSNHPIHLLIFIAFFFLASFQFGLINSNFSSISMEPFSHLAGTASSIFGFINTVISTILGIIIGQSFNGTTYPITIGFFGIAVSSFICILIV************
MEFVIVIAMLMAINSLGIDIILPCLPKISDSLHLSNENYGQHLISFYLIGYGIAQIFYGPLSDRFGRKIVMMFGLVIHIISTFIMVTINSFTGMLCMRLIQGIGGAAPRIITISIIRDIYDGRDMAKVLSIAMMIFMIMPILAPSIGQATVALSGGWIGIFVCMGVITTFITLWYYIRFPETLDPRDVRPLNLYAILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQLGNLFPIAFAVGGFAMSIASFINSRLVEKFGIRRVSHYSLLIFFMITGSWLLVQITSNHPIHLLIFIAFFFLASFQFGLINSNFSSISMEPFSHLAGTASSIFGFINTVISTILGIIIGQSFNGTTYPITIGFFGIAVSSFICILIVEKNQMFRKTELR
MEFVIVIAMLMAINSLGIDIILPCLPKISDSLHLSNENYGQHLISFYLIGYGIAQIFYGPLSDRFGRKIVMMFGLVIHIISTFIMVTINSFTGMLCMRLIQGIGGAAPRIITISIIRDIYDGRDMAKVLSIAMMIFMIMPILAPSIGQATVALSGGWIGIFVCMGVITTFITLWYYIRFPETLDPRDVRPLNLYAILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQLGNLFPIAFAVGGFAMSIASFINSRLVEKFGIRRVSHYSLLIFFMITGSWLLVQITSNHPIHLLIFIAFFFLASFQFGLINSNFSSISMEPFSHLAGTASSIFGFINTVISTILGIIIGQSFNGTTYPITIGFFGIAVSSFICILIVEKNQ********
oooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFVIVIAMLMAINSLGIDIILPCLPKISDSLHLSNENYGQHLISFYLIGYGIAQIFYGPLSDRFGRKIVMMFGLVIHIISTFIMVTINSFTGMLCMRLIQGIGGAAPRIITISIIRDIYDGRDMAKVLSIAMMIFMIMPILAPSIGQATVALSGGWIGIFVCMGVITTFITLWYYIRFPETLDPRDVRPLNLYAILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQLGNLFPIAFAVGGFAMSIASFINSRLVEKFGIRRVSHYSLLIFFMITGSWLLVQITSNHPIHLLIFIAFFFLASFQFGLINSNFSSISMEPFSHLAGTASSIFGFINTVISTILGIIIGQSFNGTTYPITIGFFGIAVSSFICILIVEKNQMFRKTELR
MEFVIVIAMLMAINSLGIDIILPCLPKISDSLHLSNENYGQHLISFYLIGYGIAQIFYGPLSDRFGRKIVMMFGLVIHIISTFIMVTINSFTGMLCMRLIQGIGGAAPRIITISIIRDIYDGRDMAKVLSIAMMIFMIMPILAPSIGQATVALSGGWIGIFVCMGVITTFITLWYYIRFPETLDPRDVRPLNLYAILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQLGNLFPIAFAVGGFAMSIASFINSRLVEKFGIRRVSHYSLLIFFMITGSWLLVQITSNHPIHLLIFIAFFFLASFQFGLINSNFSSISMEPFSHLAGTASSIFGFINTVISTILGIIIGQSFNGTTYPITIGFFGIAVSSFICILIVEKNQMFRKTELR
MEFVIVIAMLMAINSLGIDIILPCLPKISDSLHLSNENYGQHLISFYLIGYGIAQIFYGPLSDRFGRKIVMMFGLVIHIISTFIMVTINSFTGMLCMRLIQGIGGAAPRIITISIIRDIYDGRDMAKVLSIAMMIFMIMPILAPSIGQATVALSGGWIGIFVCMGVITTFITLWYYIRFPETLDPRDVRPLNLYAILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQLGNLFPIAFAVGGFAMSIASFINSRLVEKFGIRRVSHYSLLIFFMITGSWLLVQITSNHPIHLLIFIAFFFLASFQFGLINSNFSSISMEPFSHLAGTASSIFGFINTVISTILGIIIGQSFNGTTYPITIGFFGIAVSSFICILIVEKNQMFRKTELR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target398 probable multidrug resistance transporter protein [Cand
315122615424 probable multidrug resistance transporter protein [Cand 1 1e-161
190891991401 multidrug resistance transporter protein [Rhizobium etl 1 1e-108
218680543408 drug resistance transporter, Bcr/CflA subfamily protein 1 1e-106
86357920401 Bcr/CflA subfamily drug resistance transporter [Rhizobi 1 1e-105
241204870401 drug resistance transporter, Bcr/CflA subfamily [Rhizob 1 1e-105
116252362415 transmembrane efflux protein [Rhizobium leguminosarum b 1 1e-105
209549534415 drug resistance transporter Bcr/CflA subfamily [Rhizobi 1 1e-104
222086144410 drug resistance transporter protein [Agrobacterium radi 1 1e-104
159184948402 MFS permease [Agrobacterium tumefaciens str. C58] Lengt 1 1e-104
325293255416 bicyclomycin resistance protein [Agrobacterium sp. H13- 1 1e-103
>gi|315122615|ref|YP_004063104.1| probable multidrug resistance transporter protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 424 Back     alignment and organism information
 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 294/395 (74%), Positives = 341/395 (86%)

Query: 1   MEFVIVIAMLMAINSLGIDIILPCLPKISDSLHLSNENYGQHLISFYLIGYGIAQIFYGP 60
           +EFV+VIAMLM INSLGIDIILPCLP+IS  L L N N+ QHLISFYLIGYGIAQIFYGP
Sbjct: 29  IEFVLVIAMLMGINSLGIDIILPCLPQISQFLGLKNVNHSQHLISFYLIGYGIAQIFYGP 88

Query: 61  LSDRFGRKIVMMFGLVIHIISTFIMVTINSFTGMLCMRLIQGIGGAAPRIITISIIRDIY 120
           L+DRFGRK VM+ GLVI+I+ST  MVT+ SF+GML MRLIQGIGGAAPRIITISIIRDIY
Sbjct: 89  LADRFGRKAVMISGLVIYILSTIAMVTVTSFSGMLSMRLIQGIGGAAPRIITISIIRDIY 148

Query: 121 DGRDMAKVLSIAMMIFMIMPILAPSIGQATVALSGGWIGIFVCMGVITTFITLWYYIRFP 180
           DG++MAKVLS+ MMIFM+MPI AP++GQAT++L G WI +F+ MG IT  I +WYYIRFP
Sbjct: 149 DGKEMAKVLSMTMMIFMVMPIFAPALGQATMSLLGDWIWVFIWMGAITFIIMMWYYIRFP 208

Query: 181 ETLDPRDVRPLNLYAILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQL 240
           ETL+PRDVRPLN+  ILHSFSLIF +R S  YNIANS  MGAILGFVNSSQQ+Y  +Y  
Sbjct: 209 ETLNPRDVRPLNISLILHSFSLIFINRLSIFYNIANSFMMGAILGFVNSSQQVYTQVYSF 268

Query: 241 GNLFPIAFAVGGFAMSIASFINSRLVEKFGIRRVSHYSLLIFFMITGSWLLVQITSNHPI 300
           GNLFP+AFA+GG A+++ASF+NS LV+KFGIR VSHYSLL   +ITG WLL+Q++S+ P+
Sbjct: 269 GNLFPLAFAIGGMAIALASFMNSHLVDKFGIRIVSHYSLLFLLLITGIWLLIQVSSDSPM 328

Query: 301 HLLIFIAFFFLASFQFGLINSNFSSISMEPFSHLAGTASSIFGFINTVISTILGIIIGQS 360
           +L IFI F FL+SFQFGLINSNFSSISMEPFSHLAGTASS+FGFINT+IST++GIIIGQS
Sbjct: 329 NLWIFILFVFLSSFQFGLINSNFSSISMEPFSHLAGTASSVFGFINTLISTLVGIIIGQS 388

Query: 361 FNGTTYPITIGFFGIAVSSFICILIVEKNQMFRKT 395
           FNGTTYPITIGFF +AV S+ICI I EK  MF K 
Sbjct: 389 FNGTTYPITIGFFALAVLSYICIFIAEKGVMFNKK 423


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190891991|ref|YP_001978533.1| multidrug resistance transporter protein [Rhizobium etli CIAT 652] Length = 401 Back     alignment and organism information
>gi|218680543|ref|ZP_03528440.1| drug resistance transporter, Bcr/CflA subfamily protein [Rhizobium etli CIAT 894] Length = 408 Back     alignment and organism information
>gi|86357920|ref|YP_469812.1| Bcr/CflA subfamily drug resistance transporter [Rhizobium etli CFN 42] Length = 401 Back     alignment and organism information
>gi|241204870|ref|YP_002975966.1| drug resistance transporter, Bcr/CflA subfamily [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 401 Back     alignment and organism information
>gi|116252362|ref|YP_768200.1| transmembrane efflux protein [Rhizobium leguminosarum bv. viciae 3841] Length = 415 Back     alignment and organism information
>gi|209549534|ref|YP_002281451.1| drug resistance transporter Bcr/CflA subfamily [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 415 Back     alignment and organism information
>gi|222086144|ref|YP_002544676.1| drug resistance transporter protein [Agrobacterium radiobacter K84] Length = 410 Back     alignment and organism information
>gi|159184948|ref|NP_354837.2| MFS permease [Agrobacterium tumefaciens str. C58] Length = 402 Back     alignment and organism information
>gi|325293255|ref|YP_004279119.1| bicyclomycin resistance protein [Agrobacterium sp. H13-3] Length = 416 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target398 probable multidrug resistance transporter protein [Cand
PRK11102377 PRK11102, PRK11102, bicyclomycin/multidrug efflux syste 2e-42
TIGR00710385 TIGR00710, efflux_Bcr_CflA, drug resistance transporter 7e-42
KOG2533495 KOG2533, KOG2533, KOG2533, Permease of the major facili 8e-10
COG2223417 COG2223, NarK, Nitrate/nitrite transporter [Inorganic i 5e-09
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (MFS) i 2e-13
PRK11652394 PRK11652, emrD, multidrug resistance protein D; Provisi 6e-26
PRK10473392 PRK10473, PRK10473, multidrug efflux system protein Mdt 2e-18
pfam07690345 pfam07690, MFS_1, Major Facilitator Superfamily 6e-17
TIGR00886366 TIGR00886, 2A0108, nitrite extrusion protein (nitrite f 4e-08
TIGR00881379 TIGR00881, 2A0104, phosphoglycerate transporter family 6e-05
PRK11043401 PRK11043, PRK11043, putative transporter; Provisional 3e-17
KOG1330493 KOG1330, KOG1330, KOG1330, Sugar transporter/spinster t 1e-08
TIGR00711485 TIGR00711, efflux_EmrB, drug resistance transporter, Em 4e-06
TIGR00895398 TIGR00895, 2A0115, benzoate transport 1e-05
COG2271448 COG2271, UhpC, Sugar phosphate permease [Carbohydrate t 1e-04
TIGR01299 742 TIGR01299, synapt_SV2, synaptic vesicle protein SV2 1e-04
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (MFS) i 9e-04
TIGR00880141 TIGR00880, 2_A_01_02, Multidrug resistance protein 9e-15
PRK15402406 PRK15402, PRK15402, multidrug efflux system translocase 5e-13
KOG2615451 KOG2615, KOG2615, KOG2615, Permease of the major facili 6e-06
KOG3764464 KOG3764, KOG3764, KOG3764, Vesicular amine transporter 3e-05
KOG0254513 KOG0254, KOG0254, KOG0254, Predicted transporter (major 1e-04
TIGR00898505 TIGR00898, 2A0119, cation transport protein 2e-04
pfam06609 598 pfam06609, TRI12, Fungal trichothecene efflux pump (TRI 5e-04
COG2814394 COG2814, AraJ, Arabinose efflux permease [Carbohydrate 6e-13
KOG0255521 KOG0255, KOG0255, KOG0255, Synaptic vesicle transporter 2e-10
KOG2532466 KOG2532, KOG2532, KOG2532, Permease of the major facili 3e-06
PRK15403413 PRK15403, PRK15403, multidrug efflux system protein Mdt 4e-09
pfam00083449 pfam00083, Sugar_tr, Sugar (and other) transporter 7e-05
PLN00028476 PLN00028, PLN00028, nitrate transmembrane transporter; 4e-04
KOG0252538 KOG0252, KOG0252, KOG0252, Inorganic phosphate transpor 0.003
TIGR00900365 TIGR00900, 2A0121, H+ Antiporter protein 0.004
>gnl|CDD|182964 PRK11102, PRK11102, bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>gnl|CDD|162006 TIGR00710, efflux_Bcr_CflA, drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>gnl|CDD|37744 KOG2533, KOG2533, KOG2533, Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|32405 COG2223, NarK, Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|183259 PRK11652, emrD, multidrug resistance protein D; Provisional Back     alignment and domain information
>gnl|CDD|182486 PRK10473, PRK10473, multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>gnl|CDD|148990 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|162090 TIGR00886, 2A0108, nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>gnl|CDD|162086 TIGR00881, 2A0104, phosphoglycerate transporter family protein Back     alignment and domain information
>gnl|CDD|182924 PRK11043, PRK11043, putative transporter; Provisional Back     alignment and domain information
>gnl|CDD|36544 KOG1330, KOG1330, KOG1330, Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|129794 TIGR00711, efflux_EmrB, drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>gnl|CDD|162095 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|32452 COG2271, UhpC, Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130366 TIGR01299, synapt_SV2, synaptic vesicle protein SV2 Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|162085 TIGR00880, 2_A_01_02, Multidrug resistance protein Back     alignment and domain information
>gnl|CDD|185300 PRK15402, PRK15402, multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>gnl|CDD|37826 KOG2615, KOG2615, KOG2615, Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|38968 KOG3764, KOG3764, KOG3764, Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|35475 KOG0254, KOG0254, KOG0254, Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|162097 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
>gnl|CDD|115279 pfam06609, TRI12, Fungal trichothecene efflux pump (TRI12) Back     alignment and domain information
>gnl|CDD|32643 COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|35476 KOG0255, KOG0255, KOG0255, Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|37743 KOG2532, KOG2532, KOG2532, Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|185301 PRK15403, PRK15403, multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>gnl|CDD|143864 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|177665 PLN00028, PLN00028, nitrate transmembrane transporter; Provisional Back     alignment and domain information
>gnl|CDD|35473 KOG0252, KOG0252, KOG0252, Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162098 TIGR00900, 2A0121, H+ Antiporter protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 398 probable multidrug resistance transporter protein [Cand
PRK10473392 multidrug efflux system protein MdtL; Provisional 100.0
PRK11652394 emrD multidrug resistance protein D; Provisional 100.0
PRK11043401 inner membrane transport protein YdhC; Provisional 100.0
TIGR00710400 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA s 100.0
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 100.0
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT; Pro 100.0
PRK10091389 MFS transport protein AraJ; Provisional 100.0
PRK03545390 sugar efflux transporter; Provisional 100.0
PRK10504471 multidrug efflux system protein MdtE; Provisional 100.0
PRK11663434 regulatory protein UhpC; Provisional 100.0
PRK09874406 drug efflux system protein MdtG; Provisional 100.0
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisional 100.0
PRK11646400 multidrug resistance protein MdtH; Provisional 100.0
PRK05122395 major facilitator superfamily transporter; Provisional 100.0
PRK12382393 hypothetical protein; Provisional 100.0
PRK10054395 putative MFS-type transporter YdeE; Provisional 100.0
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transport a 100.0
pfam00083449 Sugar_tr Sugar (and other) transporter. 100.0
PRK10642490 proline/glycine betaine transporter; Provisional 100.0
PRK09952438 shikimate transporter; Provisional 100.0
PRK10406432 alpha-ketoglutarate transporter; Provisional 100.0
PRK09705393 cynX putative cyanate transporter; Provisional 100.0
PRK10489416 enterobactin exporter EntS; Provisional 100.0
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion transpo 100.0
PRK03633381 putative MFS family transporter protein; Provisional 100.0
TIGR00898557 2A0119 cation transport protein; InterPro: IPR004749 Or 100.0
TIGR00894514 2A0114euk Na(+)-dependent inorganic phosphate cotranspo 100.0
pfam05977 524 DUF894 Bacterial protein of unknown function (DUF894). 100.0
pfam03825400 Nuc_H_symport Nucleoside H+ symporter. 99.97
COG2807395 CynX Cyanate permease [Inorganic ion transport and meta 99.97
KOG2504509 consensus 99.97
PRK11902402 ampG muropeptide transporter; Reviewed 99.96
PRK11128383 putative 3-phenylpropionic acid transporter; Provisiona 99.95
TIGR00899377 2A0120 sugar efflux transporter; InterPro: IPR004750 Th 99.95
TIGR00712468 glpT glycerol-3-phosphate transporter; InterPro: IPR005 99.94
PRK11195415 major facilitator family transporter; Provisional 99.94
TIGR00890429 2A0111 Oxalate/Formate Antiporter; InterPro: IPR004741 99.94
PRK09528418 lacY galactoside permease; Reviewed 99.94
PRK08633 1150 2-acyl-glycerophospho-ethanolamine acyltransferase; Val 99.93
PRK11010490 ampG muropeptide transporter; Validated 99.91
KOG2563480 consensus 99.88
KOG0253528 consensus 99.85
KOG4686459 consensus 99.76
TIGR00902388 2A0127 MFS transporter, phenyl propionate permease (PPP 99.72
TIGR00882397 2A0105 oligosaccharide:H+ symporter; InterPro: IPR00057 99.68
TIGR00903368 2A0129 major facilitator 4 family protein; InterPro: IP 99.63
TIGR00889435 2A0110 nucleoside transporter; InterPro: IPR004740 This 99.54
TIGR02718391 sider_RhtX_FptX siderophore transporter, RhtX/FptX fami 99.46
PRK12307426 putative sialic acid transporter; Provisional 100.0
TIGR00711501 efflux_EmrB drug resistance MFS transporter, drug:H+ an 100.0
PRK03893486 putative sialic acid transporter; Provisional 100.0
COG2814394 AraJ Arabinose efflux permease [Carbohydrate transport 100.0
TIGR00895413 2A0115 MFS transporter, aromatic acid:H+ symporter (AAH 100.0
PRK10213394 nepI ribonucleoside transporter; Reviewed 100.0
PRK03699394 hypothetical protein; Provisional 100.0
pfam07690345 MFS_1 Major Facilitator Superfamily. 100.0
PRK09556463 uhpT sugar phosphate antiporter; Reviewed 100.0
TIGR00893427 2A0114 d-galactonate transporter; InterPro: IPR004744 D 100.0
TIGR00881404 2A0104 phosphoglycerate transporter family protein; Int 100.0
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a large 100.0
pfam06609598 TRI12 Fungal trichothecene efflux pump (TRI12). This fa 100.0
PRK10077486 xylE D-xylose transporter XylE; Provisional 100.0
KOG2532466 consensus 100.0
KOG1330493 consensus 100.0
PRK10133438 L-fucose transporter; Provisional 100.0
TIGR00883413 2A0106 MFS transporter, metabolite:H+ symporter (MHS) f 100.0
COG0738422 FucP Fucose permease [Carbohydrate transport and metabo 100.0
KOG0255521 consensus 99.97
TIGR00900387 2A0121 H+ Antiporter protein; InterPro: IPR004751 Drug 99.97
KOG0254513 consensus 99.97
TIGR00896372 CynX cyanate transporter; InterPro: IPR004747 This fami 99.97
KOG3764464 consensus 99.97
TIGR00879572 SP MFS transporter, sugar porter (SP) family; InterPro: 99.97
TIGR00891453 2A0112 MFS transporter, sialate:H+ symporter (SHS) fami 99.96
KOG0569485 consensus 99.96
TIGR00892475 2A0113 monocarboxylate transporter; InterPro: IPR004743 99.96
pfam01306413 LacY_symp LacY proton/sugar symporter. This family is c 99.95
PRK06814 1139 acylglycerophosphoethanolamine acyltransferase; Provisi 99.92
PRK09584500 tppB putative tripeptide transporter permease; Reviewed 99.91
PRK10429473 melibiose:sodium symporter; Provisional 99.89
PRK09669442 putative symporter YagG; Provisional 99.89
TIGR00897411 2A0118 polyol permease; InterPro: IPR004748 Proteins in 99.89
TIGR02332412 HpaX 4-hydroxyphenylacetate permease; InterPro: IPR0127 99.88
TIGR00885427 fucP L-fucose:H+ symporter permease; InterPro: IPR00527 99.84
PRK11462460 putative transporter; Provisional 99.84
COG2211467 MelB Na+/melibiose symporter and related transporters [ 99.83
PRK09848457 glucuronide transporter; Provisional 99.81
pfam03209402 PUCC PUCC protein. This protein is required for high-le 99.81
KOG2816463 consensus 99.77
TIGR00792470 gph sugar (Glycoside-Pentoside-Hexuronide) transporter; 99.77
pfam03092425 BT1 BT1 family. Members of this family are transmembran 99.7
pfam01770410 Folate_carrier Reduced folate carrier. The reduced fola 99.33
KOG4332454 consensus 99.25
pfam06963433 FPN1 Ferroportin1 (FPN1). This family represents a cons 99.23
KOG3574510 consensus 98.82
KOG3810433 consensus 98.22
TIGR00806542 rfc reduced folate carrier; InterPro: IPR002666 The red 96.96
KOG2533495 consensus 100.0
TIGR00886472 2A0108 nitrite transporter; InterPro: IPR004737 This fa 99.97
pfam03137582 OATP Organic Anion Transporter Polypeptide (OATP) famil 99.84
KOG2325488 consensus 99.77
pfam05631354 DUF791 Protein of unknown function (DUF791). This famil 99.73
KOG3626 735 consensus 99.67
TIGR00805 723 oat sodium-independent organic anion transporter; Inter 99.42
KOG0637498 consensus 98.9
pfam03219491 TLC TLC ATP/ADP transporter. 98.52
COG3202509 ATP/ADP translocase [Energy production and conversion] 97.66
KOG2615451 consensus 99.96
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid transpor 99.83
KOG3098461 consensus 99.32
TIGR00880148 2_A_01_02 Multidrug resistance protein; InterPro: IPR00 99.95
PRK10054395 putative MFS-type transporter YdeE; Provisional 99.65
PRK10489416 enterobactin exporter EntS; Provisional 99.61
PRK03893486 putative sialic acid transporter; Provisional 99.61
PRK03545390 sugar efflux transporter; Provisional 99.61
PRK11646400 multidrug resistance protein MdtH; Provisional 99.6
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a large 99.54
TIGR00924501 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H 99.53
PRK10091389 MFS transport protein AraJ; Provisional 99.53
TIGR00883413 2A0106 MFS transporter, metabolite:H+ symporter (MHS) f 99.35
COG2814394 AraJ Arabinose efflux permease [Carbohydrate transport 99.25
TIGR00890429 2A0111 Oxalate/Formate Antiporter; InterPro: IPR004741 99.24
COG2270438 Permeases of the major facilitator superfamily [General 99.22
pfam05977524 DUF894 Bacterial protein of unknown function (DUF894). 99.19
KOG0569485 consensus 99.14
pfam00854372 PTR2 POT family. The POT (proton-dependent oligopeptide 98.94
pfam06813248 Nodulin-like Nodulin-like. This family represents a con 98.92
KOG4686 459 consensus 98.8
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2; InterPro: IPR0 98.8
TIGR00901 531 2A0125 AmpG-related permease; InterPro: IPR004752 The s 98.68
pfam02487409 CLN3 CLN3 protein. This is a family of proteins from th 98.63
TIGR00889435 2A0110 nucleoside transporter; InterPro: IPR004740 This 98.46
KOG1237 571 consensus 97.95
TIGR00926 781 2A1704 Oligopeptide transporter (Peptide:H+ symporter); 97.86
PRK03612516 spermidine synthase; Provisional 97.82
TIGR00788 594 fbt folate/biopterin transporter; InterPro: IPR004324 M 96.65
KOG3880409 consensus 95.37
KOG2601503 consensus 92.04
KOG0252538 consensus 99.89
pfam11700477 ATG22 Vacuole effluxer Atg22 like. Autophagy is a major 99.87
COG2270438 Permeases of the major facilitator superfamily [General 99.81
TIGR00887557 2A0109 phosphate:H+ symporter; InterPro: IPR004738 In y 99.72
PRK10207490 inner membrane transporter YhiP; Provisional 99.88
PRK12382393 hypothetical protein; Provisional 99.85
PRK09874406 drug efflux system protein MdtG; Provisional 99.85
PRK05122395 major facilitator superfamily transporter; Provisional 99.82
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT; Pro 99.76
PRK03633381 putative MFS family transporter protein; Provisional 99.72
PRK10642490 proline/glycine betaine transporter; Provisional 99.69
KOG2504509 consensus 99.37
COG0477338 ProP Permeases of the major facilitator superfamily [Ca 99.34
PRK08633 1150 2-acyl-glycerophospho-ethanolamine acyltransferase; Val 99.3
PRK11010490 ampG muropeptide transporter; Validated 99.27
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion transpo 99.26
TIGR00892475 2A0113 monocarboxylate transporter; InterPro: IPR004743 99.16
TIGR00899377 2A0120 sugar efflux transporter; InterPro: IPR004750 Th 99.13
PRK06814 1139 acylglycerophosphoethanolamine acyltransferase; Provisi 99.0
TIGR00897411 2A0118 polyol permease; InterPro: IPR004748 Proteins in 98.82
PRK12307426 putative sialic acid transporter; Provisional 99.65
PRK11663434 regulatory protein UhpC; Provisional 99.54
PRK10504471 multidrug efflux system protein MdtE; Provisional 99.43
PRK11128383 putative 3-phenylpropionic acid transporter; Provisiona 99.41
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.21
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.19
PRK11043401 inner membrane transport protein YdhC; Provisional 99.08
KOG3762 618 consensus 98.86
KOG2532466 consensus 98.41
PRK11462460 putative transporter; Provisional 98.28
KOG2325488 consensus 97.95
KOG2816463 consensus 97.93
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid transpor 97.75
PTZ00207 591 hypothetical protein; Provisional 99.6
TIGR00711501 efflux_EmrB drug resistance MFS transporter, drug:H+ an 98.95
pfam05978157 UNC-93 Ion channel regulatory protein UNC-93. This fami 97.93
pfam01306413 LacY_symp LacY proton/sugar symporter. This family is c 99.51
PRK09528418 lacY galactoside permease; Reviewed 99.46
PRK09705393 cynX putative cyanate transporter; Provisional 99.46
KOG2563 480 consensus 96.7
pfam01733305 Nucleoside_tran Nucleoside transporter. This is a famil 96.24
pfam02487409 CLN3 CLN3 protein. This is a family of proteins from th 95.03
PRK09556463 uhpT sugar phosphate antiporter; Reviewed 99.43
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.22
PRK11652394 emrD multidrug resistance protein D; Provisional 99.2
PRK11195415 major facilitator family transporter; Provisional 98.97
pfam06609598 TRI12 Fungal trichothecene efflux pump (TRI12). This fa 98.72
pfam07690 345 MFS_1 Major Facilitator Superfamily. 99.43
pfam03825400 Nuc_H_symport Nucleoside H+ symporter. 99.41
TIGR00886472 2A0108 nitrite transporter; InterPro: IPR004737 This fa 98.61
KOG2533495 consensus 98.38
PRK10133438 L-fucose transporter; Provisional 98.34
KOG2615 451 consensus 98.18
KOG0252 538 consensus 97.54
PRK03699394 hypothetical protein; Provisional 99.42
PRK11902402 ampG muropeptide transporter; Reviewed 99.41
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisional 99.41
TIGR00895 413 2A0115 MFS transporter, aromatic acid:H+ symporter (AAH 99.27
TIGR00710 400 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA s 98.88
KOG3764 464 consensus 98.81
pfam06813248 Nodulin-like Nodulin-like. This family represents a con 98.44
TIGR00894 514 2A0114euk Na(+)-dependent inorganic phosphate cotranspo 97.28
KOG3762618 consensus 99.24
TIGR00881 404 2A0104 phosphoglycerate transporter family protein; Int 98.89
PTZ00207591 hypothetical protein; Provisional 98.24
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transport a 99.11
TIGR00879 572 SP MFS transporter, sugar porter (SP) family; InterPro: 99.03
TIGR00893 427 2A0114 d-galactonate transporter; InterPro: IPR004744 D 98.94
TIGR00900 387 2A0121 H+ Antiporter protein; InterPro: IPR004751 Drug 98.82
TIGR00880148 2_A_01_02 Multidrug resistance protein; InterPro: IPR00 98.63
TIGR00898 557 2A0119 cation transport protein; InterPro: IPR004749 Or 98.55
KOG0255 521 consensus 98.48
TIGR00891 453 2A0112 MFS transporter, sialate:H+ symporter (SHS) fami 98.47
TIGR00712 468 glpT glycerol-3-phosphate transporter; InterPro: IPR005 97.75
TIGR00887 557 2A0109 phosphate:H+ symporter; InterPro: IPR004738 In y 97.14
PRK03612 516 spermidine synthase; Provisional 96.97
TIGR00924501 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H 96.78
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2; InterPro: IPR0 92.51
TIGR01272322 gluP glucose/galactose transporter WARNING; InterPro: I 99.04
COG2807395 CynX Cyanate permease [Inorganic ion transport and meta 98.96
pfam0677985 DUF1228 Protein of unknown function (DUF1228). This fam 98.85
PRK09584500 tppB putative tripeptide transporter permease; Reviewed 98.68
PRK10207490 inner membrane transporter YhiP; Provisional 98.49
TIGR00896372 CynX cyanate transporter; InterPro: IPR004747 This fami 98.71
pfam03137 582 OATP Organic Anion Transporter Polypeptide (OATP) famil 96.85
TIGR00882 397 2A0105 oligosaccharide:H+ symporter; InterPro: IPR00057 97.88
pfam07672265 MFS_Mycoplasma Mycoplasma MFS transporter. These protei 97.82
KOG3098461 consensus 96.81
pfam05631 354 DUF791 Protein of unknown function (DUF791). This famil 96.41
KOG0637498 consensus 95.76
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK11043 inner membrane transport protein YdhC; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily; InterPro: IPR004812 The drug resistance transporter Bcr/CflA proteins are predicted to have 12 membrane-spanning regions Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK03545 sugar efflux transporter; Provisional Back     alignment and domain information
>PRK10504 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK12382 hypothetical protein; Provisional Back     alignment and domain information
>PRK10054 putative MFS-type transporter YdeE; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam00083 Sugar_tr Sugar (and other) transporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein; InterPro: IPR004749 Organic cation transport proteins belong to this group Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter; InterPro: IPR004745 Na(+)-dependent inorganic phosphate cotransporter proteins belong to this group Back     alignment and domain information
>pfam05977 DUF894 Bacterial protein of unknown function (DUF894) Back     alignment and domain information
>pfam03825 Nuc_H_symport Nucleoside H+ symporter Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2504 consensus Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter; InterPro: IPR004750 This family of proteins is an efflux system for lactose, glucose, aromatic glucosides and galactosides, cellobiose, maltose, a-methyl glucoside and other sugar compounds Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter; InterPro: IPR005267 This family includes very hydrophobic proteins, predicted to span the membrane at least 8 times Back     alignment and domain information
>PRK11195 major facilitator family transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter; InterPro: IPR004741 Oxalate/formate antiporters and many, as yet, uncharacterised proteins belong to this group Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>KOG2563 consensus Back     alignment and domain information
>KOG0253 consensus Back     alignment and domain information
>KOG4686 consensus Back     alignment and domain information
>TIGR00902 2A0127 MFS transporter, phenyl propionate permease (PPP) family; InterPro: IPR005276 This family of proteins is involved in the uptake of 3-phenylpropionic acid Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter; InterPro: IPR000576 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein; InterPro: IPR005277 The MFS is a very old, large and diverse superfamily that includes several hundred sequenced members Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter; InterPro: IPR004740 This family of proteins transports nucleosides at a high affinity Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family; InterPro: IPR014090 RhtX from Sinorhizobium meliloti 1021 and FptX from Pseudomonas aeruginosa appear to be single polypeptide transporters, from the major facilitator family for import of siderophores as a means to import iron Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance MFS transporter, drug:H+ antiporter-1 (14 Spanner) (DHA2) family; InterPro: IPR004638 This subfamily of drug efflux proteins, a part of the major facilitator family, is predicted to have 14 potential membrane-spanning regions Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00895 2A0115 MFS transporter, aromatic acid:H+ symporter (AAHS) family; InterPro: IPR004746 Benzoate transport proteins belong to this group Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK03699 hypothetical protein; Provisional Back     alignment and domain information
>pfam07690 MFS_1 Major Facilitator Superfamily Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter; InterPro: IPR004744 D-galactonate transporters and other proteins that belong to the phthalate permease family are members of this group Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein; InterPro: IPR000849 Proteins in this group are involved in the transport system that mediates the uptake of a number of sugar phosphates as well as the regulatory components that are responsible for induction of this transport system by external glucose 6-phosphate Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>pfam06609 TRI12 Fungal trichothecene efflux pump (TRI12) Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>KOG2532 consensus Back     alignment and domain information
>KOG1330 consensus Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 MFS transporter, metabolite:H+ symporter (MHS) family protein; InterPro: IPR004736 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0255 consensus Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein; InterPro: IPR004751 Drug antiporters which use the proton motive force for the active efflux of the drug Back     alignment and domain information
>KOG0254 consensus Back     alignment and domain information
>TIGR00896 CynX cyanate transporter; InterPro: IPR004747 This family of proteins is involved in active transport of cyanate Back     alignment and domain information
>KOG3764 consensus Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family; InterPro: IPR003663 The sugar transporters belong to a superfamily of membrane proteins responsible for the binding and transport of various carbohydrates, organic alcohols, and acids in a wide range of prokaryotic and eukaryotic organisms Back     alignment and domain information
>TIGR00891 2A0112 MFS transporter, sialate:H+ symporter (SHS) family; InterPro: IPR004742 The sugar transporters belong to a family of membrane proteins responsible for the transport of various sugars in a wide range of prokaryotic and eukaryotic organisms Back     alignment and domain information
>KOG0569 consensus Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter; InterPro: IPR004743 Proton-linked monocarboxylate transporters catalyse the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate Back     alignment and domain information
>pfam01306 LacY_symp LacY proton/sugar symporter Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease; InterPro: IPR004748 Proteins in this entry are mostly known or predicted polyol transporters Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease; InterPro: IPR012707 Among the different families of transporter only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease; InterPro: IPR005275 This family describes the L-fucose permease in bacteria Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>pfam03209 PUCC PUCC protein Back     alignment and domain information
>KOG2816 consensus Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter; InterPro: IPR001927 It has been shown that integral membrane proteins that mediate the intake of a wide variety of molecules with the concomitant uptake of sodium ions (sodium symporters) can be grouped, on the basis of sequence and functional similarities into a number of distinct families Back     alignment and domain information
>pfam03092 BT1 BT1 family Back     alignment and domain information