254780968

254780968

hypothetical protein CLIBASIA_04345

GeneID in NCBI database:8209990Locus tag:CLIBASIA_04345
Protein GI in NCBI database:254780968Protein Accession:YP_003065381.1
Gene range:-(965254, 965574)Protein Length:106aa
Gene description:hypothetical protein
COG prediction:[O] Glutaredoxin-related protein
KEGG prediction:hypothetical protein; K07390 monothiol glutaredoxin
SEED prediction:Uncharacterized monothiol glutaredoxin ycf64-like
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Glutathione: Redox cycle;
Glutaredoxins
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDRI
ccHHHHHHHHHHHHHccEEEEEcccccccccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHccccccEEEEccEEEccHHHHHHHHHcccHHHHHHHccc
ccHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHcccccEEEEccccHHHHHHHHHHcccccccEEEEcccEccHHHHHHHHHHcccHHHHHHcccc
MNSSVNSIIQNEIKKNDVVLfmkgtptsprcgfsgKVVQVLDSlgvsykgidVLADDALRQSIkeysnwptipqlyvkgdfiggcDIVCEMFesgelheilsidri
MNSSVNSIIQNEIKKNDVVLFMKGTptsprcgfsGKVVQVLDSLGVSYKGIDVLADDALRQSIKEysnwptipqlYVKGDFIGGCDIVCEMFEsgelheilsidri
MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDRI
*****NS*IQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSID**
MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDRI
*NSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDRI
MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDRI
MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDRI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target106 hypothetical protein CLIBASIA_04345 [Candidatus Liberib
315122614104 hypothetical protein CKC_04330 [Candidatus Liberibacter 1 1e-40
163759579110 putative glutaredoxin [Hoeflea phototrophica DFL-43] Le 1 2e-37
163868503110 hypothetical protein Btr_1355 [Bartonella tribocorum CI 1 4e-37
49474339110 hypothetical protein BQ07520 [Bartonella quintana str. 1 7e-37
15965534111 hypothetical protein SMc00538 [Sinorhizobium meliloti 1 1 8e-37
116252361111 glutaredoxin [Rhizobium leguminosarum bv. viciae 3841] 1 1e-36
161618799110 glutaredoxin-like protein [Brucella canis ATCC 23365] L 1 2e-36
190891990111 glutaredoxin protein [Rhizobium etli CIAT 652] Length = 1 2e-36
218462345111 glutaredoxin protein [Rhizobium etli Kim 5] Length = 11 1 2e-36
209549533111 glutaredoxin-like protein [Rhizobium leguminosarum bv. 1 2e-36
>gi|315122614|ref|YP_004063103.1| hypothetical protein CKC_04330 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 104 Back     alignment and organism information
 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 79/103 (76%), Positives = 89/103 (86%)

Query: 1   MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALR 60
           M   V +IIQ+ IK+NDVVLFMKGTP  P+CGFSGKV Q+LDSL VSYKGI++L DD LR
Sbjct: 1   MTDLVKNIIQDVIKQNDVVLFMKGTPEYPQCGFSGKVAQILDSLNVSYKGINILEDDTLR 60

Query: 61  QSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSI 103
           Q IKEYS WPTIPQLYVKGDFIGGCDIVCEMF+S ELH+ILS+
Sbjct: 61  QGIKEYSQWPTIPQLYVKGDFIGGCDIVCEMFQSKELHKILSV 103


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163759579|ref|ZP_02166664.1| putative glutaredoxin [Hoeflea phototrophica DFL-43] Length = 110 Back     alignment and organism information
>gi|163868503|ref|YP_001609712.1| hypothetical protein Btr_1355 [Bartonella tribocorum CIP 105476] Length = 110 Back     alignment and organism information
>gi|49474339|ref|YP_032381.1| hypothetical protein BQ07520 [Bartonella quintana str. Toulouse] Length = 110 Back     alignment and organism information
>gi|15965534|ref|NP_385887.1| hypothetical protein SMc00538 [Sinorhizobium meliloti 1021] Length = 111 Back     alignment and organism information
>gi|116252361|ref|YP_768199.1| glutaredoxin [Rhizobium leguminosarum bv. viciae 3841] Length = 111 Back     alignment and organism information
>gi|161618799|ref|YP_001592686.1| glutaredoxin-like protein [Brucella canis ATCC 23365] Length = 110 Back     alignment and organism information
>gi|190891990|ref|YP_001978532.1| glutaredoxin protein [Rhizobium etli CIAT 652] Length = 111 Back     alignment and organism information
>gi|218462345|ref|ZP_03502436.1| glutaredoxin protein [Rhizobium etli Kim 5] Length = 111 Back     alignment and organism information
>gi|209549533|ref|YP_002281450.1| glutaredoxin-like protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 111 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target106 hypothetical protein CLIBASIA_04345 [Candidatus Liberib
TIGR0036597 TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 fami 2e-47
cd0302890 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family, PKC 8e-39
KOG0911227 KOG0911, KOG0911, KOG0911, Glutaredoxin-related protein 3e-33
PRK10824115 PRK10824, PRK10824, glutaredoxin-4; Provisional 2e-26
PTZ00062204 PTZ00062, PTZ00062, glutaredoxin; Provisional 3e-26
cd0206672 cd02066, GRX_family, Glutaredoxin (GRX) family; compose 4e-19
pfam0046260 pfam00462, Glutaredoxin, Glutaredoxin 3e-17
cd0341982 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) family, 2e-08
KOG1752104 KOG1752, KOG1752, KOG1752, Glutaredoxin and related pro 4e-08
cd0341875 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) family, 9e-08
TIGR0218179 TIGR02181, GRX_bact, Glutaredoxin, GrxC family 1e-07
TIGR0218084 TIGR02180, GRX_euk, Glutaredoxin 7e-07
PRK1063883 PRK10638, PRK10638, glutaredoxin 3; Provisional 2e-06
COG069580 COG0695, GrxC, Glutaredoxin and related proteins [Postt 1e-05
cd0302972 cd03029, GRX_hybridPRX5, Glutaredoxin (GRX) family, PRX 4e-05
TIGR0219079 TIGR02190, GlrX-dom, Glutaredoxin-family domain 2e-04
cd0297673 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is a sm 0.001
COG0278105 COG0278, COG0278, Glutaredoxin-related protein [Posttra 3e-39
cd03031147 cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, GRX-l 1e-07
KOG2824281 KOG2824, KOG2824, KOG2824, Glutaredoxin-related protein 3e-06
>gnl|CDD|161841 TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>gnl|CDD|48577 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>gnl|CDD|36129 KOG0911, KOG0911, KOG0911, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182759 PRK10824, PRK10824, glutaredoxin-4; Provisional Back     alignment and domain information
>gnl|CDD|173357 PTZ00062, PTZ00062, glutaredoxin; Provisional Back     alignment and domain information
>gnl|CDD|48495 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|144161 pfam00462, Glutaredoxin, Glutaredoxin Back     alignment and domain information
>gnl|CDD|48634 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|36963 KOG1752, KOG1752, KOG1752, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48633 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|162749 TIGR02181, GRX_bact, Glutaredoxin, GrxC family Back     alignment and domain information
>gnl|CDD|162748 TIGR02180, GRX_euk, Glutaredoxin Back     alignment and domain information
>gnl|CDD|182607 PRK10638, PRK10638, glutaredoxin 3; Provisional Back     alignment and domain information
>gnl|CDD|31039 COG0695, GrxC, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48578 cd03029, GRX_hybridPRX5, Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>gnl|CDD|131245 TIGR02190, GlrX-dom, Glutaredoxin-family domain Back     alignment and domain information
>gnl|CDD|48525 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>gnl|CDD|30626 COG0278, COG0278, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48580 cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>gnl|CDD|38035 KOG2824, KOG2824, KOG2824, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 106 hypothetical protein CLIBASIA_04345 [Candidatus Liberib
PRK10824115 hypothetical protein; Provisional 100.0
TIGR00365103 TIGR00365 glutaredoxin homolog; InterPro: IPR004480 Glu 100.0
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacti 100.0
COG0278105 Glutaredoxin-related protein [Posttranslational modific 100.0
PTZ00062219 glutaredoxin; Provisional 100.0
KOG0911227 consensus 99.97
TIGR0218182 GRX_bact glutaredoxin 3; InterPro: IPR011900 Glutaredox 99.96
PRK1063883 glutaredoxin 3; Provisional 99.94
TIGR0218085 GRX_euk Glutaredoxin; InterPro: IPR011899 Glutaredoxins 99.94
KOG1752104 consensus 99.94
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human 99.92
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, 99.9
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacter 99.88
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid s 99.87
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of GRX, 99.86
PRK1120087 grxA glutaredoxin 1; Provisional 99.84
TIGR0219079 GlrX-dom Glutaredoxin-family domain; InterPro: IPR01190 99.8
COG069580 GrxC Glutaredoxin and related proteins [Posttranslation 99.78
TIGR02189101 GlrX-like_plant Glutaredoxin-like family; InterPro: IPR 99.75
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monome 99.73
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain 99.71
pfam0046260 Glutaredoxin Glutaredoxin. 99.7
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphate red 99.58
TIGR0219679 GlrX_YruB Glutaredoxin-like protein, YruB-family; Inter 99.51
TIGR0218386 GRXA Glutaredoxin, GrxA family; InterPro: IPR011902 Glu 99.41
KOG2824281 consensus 99.38
PRK1032981 glutaredoxin-like protein; Provisional 99.2
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domai 99.14
pfam0490892 SH3BGR SH3-binding, glutamic acid-rich protein. 99.09
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH; InterPro: IPR 98.79
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal 98.61
TIGR0220078 GlrX_actino Glutaredoxin-like protein; InterPro: IPR011 98.57
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E s 98.39
KOG3029 370 consensus 98.13
TIGR0041182 redox_disulf_1 redox-active disulfide protein 1; InterP 97.88
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; GSTs a 97.77
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamily; co 97.67
cd0057071 GST_N_family Glutathione S-transferase (GST) family, N- 97.57
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like 97.52
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 97.46
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin 97.45
cd0305973 GST_N_SspA GST_N family, Stringent starvation protein A 97.42
PTZ0005198 thioredoxin; Provisional 97.4
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are c 97.22
KOG4023108 consensus 97.22
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Channel 97.19
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide red 97.14
PRK09481 211 sspA stringent starvation protein A; Provisional 97.12
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of prote 97.09
pfam0576876 DUF836 Glutaredoxin-like domain (DUF836). These protein 97.07
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reductase ( 96.93
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase LigE su 96.88
PTZ00102 479 disulphide isomerase; Provisional 96.87
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxi 96.84
cd0294793 TRX_family TRX family; composed of two groups: Group I, 96.82
PRK10996139 thioredoxin 2; Provisional 96.5
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are 96.5
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 96.49
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was origina 96.4
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protein fam 96.28
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; composed o 96.25
PRK09381109 trxA thioredoxin; Provisional 96.22
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed of pro 96.17
pfam00085104 Thioredoxin Thioredoxin. Thioredoxins are small enzymes 96.17
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; composed of 96.17
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 96.12
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical protei 96.06
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 96.05
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; compos 95.92
KOG0406 231 consensus 95.76
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryo 95.65
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced different 95.61
PHA0212575 thioredoxin-like protein 95.46
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induced st 95.33
COG3118 304 Thioredoxin domain-containing protein [Posttranslationa 95.33
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae 95.3
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsil 94.96
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; 94.95
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, 94.83
KOG0910150 consensus 94.53
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; composed of 94.46
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; compos 94.37
cd02957113 Phd_like Phosducin (Phd)-like family; composed of Phd a 94.2
COG454585 Glutaredoxin-related protein [Posttranslational modific 94.17
PRK10357 202 predicted glutathione S-transferase; Provisional 93.99
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V- 93.9
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; composed of 93.77
KOG4244 281 consensus 92.95
KOG1422 221 consensus 92.73
pfam11009104 DUF2847 Protein of unknown function (DUF2847). Some mem 92.55
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; composed of 92.23
pfam0279872 GST_N Glutathione S-transferase, N-terminal domain. Fun 92.17
TIGR02495 220 NrdG2 anaerobic ribonucleoside-triphosphate reductase a 92.09
COG3019149 Predicted metal-binding protein [General function predi 91.91
COG0625 211 Gst Glutathione S-transferase [Posttranslational modifi 91.38
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA-like 90.17
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamil 97.67
PRK10387 210 glutaredoxin 2; Provisional 97.16
TIGR02182 212 GRXB Glutaredoxin, GrxB family; InterPro: IPR011901 Glu 96.58
TIGR01130 522 ER_PDI_fam protein disulfide isomerases; InterPro: IPR0 95.86
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (AP 95.84
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Met 95.39
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) family, 95.36
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-termin 95.35
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulum pro 95.2
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of euk 95.01
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a large, 94.9
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 94.73
TIGR02738176 TrbB type-F conjugative transfer system pilin assembly 94.44
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; 93.83
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; composed 93.56
TIGR01162159 purE phosphoribosylaminoimidazole carboxylase, catalyti 93.45
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') 93.34
COG2999 215 GrxB Glutaredoxin 2 [Posttranslational modification, pr 92.68
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; 92.63
TIGR02740306 TraF-like TraF-like protein; InterPro: IPR014111 This e 92.48
PTZ00102479 disulphide isomerase; Provisional 91.91
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EF 91.58
PRK13728181 conjugal transfer protein TrbB; Provisional 91.38
TIGR00014114 arsC arsenate reductase; InterPro: IPR006659 This entry 91.12
cd05295 452 MDH_like Malate dehydrogenase-like. These MDH-like prot 90.99
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protei 97.02
COG1393117 ArsC Arsenate reductase and related proteins, glutaredo 96.83
PRK13344132 spxA transcriptional regulator Spx; Reviewed 96.61
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfam 96.59
PRK12559131 transcriptional regulator Spx; Provisional 96.5
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfam 96.27
TIGR01617122 arsC_related conserved hypothetical protein; InterPro: 96.16
PRK10853118 hypothetical protein; Provisional 96.06
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; composed 96.03
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamil 96.02
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknown sub 95.91
PRK01655131 spxA transcriptional regulator Spx; Reviewed 95.72
pfam03960111 ArsC ArsC family. This family is related to glutaredoxi 95.53
PRK10026141 arsenate reductase; Provisional 94.29
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide oxid 92.49
PRK13703247 conjugal pilus assembly protein TraF; Provisional 92.36
PRK10877232 thiol:disulfide interchange protein DsbC; Provisional 92.21
PRK11657253 dsbG disulfide isomerase/thiol-disulfide oxidase; Provi 91.77
TIGR02187237 GlrX_arch Glutaredoxin-like domain protein; InterPro: I 96.07
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; compos 94.44
>PRK10824 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00365 TIGR00365 glutaredoxin homolog; InterPro: IPR004480 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>KOG0911 consensus Back     alignment and domain information
>TIGR02181 GRX_bact glutaredoxin 3; InterPro: IPR011900 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin; InterPro: IPR011899 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG1752 consensus Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain; InterPro: IPR011906 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family; InterPro: IPR011905 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>pfam00462 Glutaredoxin Glutaredoxin Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family; InterPro: IPR011911 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family; InterPro: IPR011902 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG2824 consensus Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>pfam04908 SH3BGR SH3-binding, glutamic acid-rich protein Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH; InterPro: IPR011909 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein; InterPro: IPR011915 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>KOG3029 consensus Back     alignment and domain information
>TIGR00411 redox_disulf_1 redox-active disulfide protein 1; InterPro: IPR004502 This group of proteins includes thioredoxins, glutaredoxins, protein-disulphide isomerases, and others, some of which have several such domains Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG4023 consensus Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>pfam05768 DUF836 Glutaredoxin-like domain (DUF836) Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>pfam00085 Thioredoxin Thioredoxin Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>KOG0406 consensus Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>KOG0910 consensus Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10357 predicted glutathione S-transferase; Provisional Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>KOG4244 consensus Back     alignment and domain information
>KOG1422 consensus Back     alignment and domain information
>pfam11009 DUF2847 Protein of unknown function (DUF2847) Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>pfam02798 GST_N Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012840 This enzyme is a member of the radical-SAM family Back     alignment and domain information
>COG3019 Predicted metal-binding protein [General function prediction only] Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family; InterPro: IPR011901 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases; InterPro: IPR005792 This family represents eukaryotic protein disulphide isomerases retained in the endoplasmic reticulum (ER) and other closely related forms Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB; InterPro: IPR014109 This entry includes thiol-disulphide isomerase (TrbB), a protein that is involved in conjugative transfer of plasmid DNA, specifically in the F-type system Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, catalytic subunit; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein; InterPro: IPR014111 This entry contains TraF-like proteins that are related to the F-type conjugation system pilus assembly proteins TraF (IPR014110 from INTERPRO)and TrbB (IPR014109 from INTERPRO) both of which exhibit a thioredoxin fold Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR00014 arsC arsenate reductase; InterPro: IPR006659 This entry describes a distinct clade, including ArsC itself, of the broader family of ArsC and related proteins Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>TIGR01617 arsC_related conserved hypothetical protein; InterPro: IPR006504 These sequences are a part of the Arsenate reductase family of sequences Back     alignment and domain information
>PRK10853 hypothetical protein; Provisional Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>pfam03960 ArsC ArsC family Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PRK10877 thiol:disulfide interchange protein DsbC; Provisional Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein; InterPro: IPR011903 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target106 hypothetical protein CLIBASIA_04345 [Candidatus Liberib
2wci_A135 Structure Of E. Coli Monothiol Glutaredoxin Grx4 Ho 5e-27
1yka_A115 Solution Structure Of Grx4, A Monothiol Glutaredoxi 8e-27
3gx8_A121 Structural And Biochemical Characterization Of Yeas 9e-25
3ipz_A109 Crystal Structure Of Arabidopsis Monothiol Glutared 2e-23
2wem_B118 Crystal Structure Of The Human Glutaredoxin 5 With 3e-23
1wik_A109 Solution Structure Of The Picot Homology 2 Domain O 7e-18
3fz9_A112 Crystal Structure Of Poplar Glutaredoxin S12 In Com 3e-16
2e7p_A116 Crystal Structure Of The Holo Form Of Glutaredoxin 4e-16
1z7p_A117 Solution Structure Of Reduced Glutaredoxin C1 From 4e-16
2khp_A92 Solution Structure Of Glutaredoxin From Brucella Me 6e-15
1fov_A82 Glutaredoxin 3 From Escherichia Coli In The Fully O 1e-13
2cq9_A130 Solution Structure Of Rsgi Ruh-044, An N-Terminal D 1e-13
2ht9_A146 The Structure Of Dimeric Human Glutaredoxin 2 Lengt 2e-13
3grx_A82 Nmr Structure Of Escherichia Coli Glutaredoxin 3- G 3e-13
2fls_A132 Crystal Structure Of Human Glutaredoxin 2 Complexed 6e-13
3h8q_A114 Crystal Structure Of Glutaredoxin Domain Of Human T 1e-12
1kte_A105 Crystal Structure Of Thioltransferase At 2.2 Angstr 7e-12
2klx_A89 Solution Structure Of Glutaredoxin From Bartonella 1e-11
1jhb_A106 Human Glutaredoxin In Fully Reduced Form, Nmr, 20 S 4e-11
1b4q_A105 Solution Structure Of Human Thioltransferase Comple 6e-11
1nm3_A241 Crystal Structure Of Heamophilus Influenza Hybrid-P 1e-09
3h4k_A 598 Crystal Structure Of The Wild Type Thioredoxin Glut 5e-09
2v6o_A 596 Structure Of Schistosoma Mansoni Thioredoxin-Glutat 5e-09
2x8c_A 598 Thioredoxin Glutathione Reductase From Schistosoma 5e-09
3ctf_A129 Crystal Structure Of Oxidized Grx2 Length = 129 2e-08
3d4m_A109 Glutaredoxin 2 Oxidized Structure Length = 109 4e-08
3d5j_A112 Structure Of Yeast Grx2-C30s Mutant With Glutathion 1e-07
2jad_A362 Yellow Fluorescent Protein- Glutaredoxin Fusion Pro 2e-07
3c1r_A118 Crystal Structure Of Oxidized Grx1 Length = 118 3e-07
2jac_A110 Glutaredoxin Grx1p C30s Mutant From Yeast Length = 3e-07
2hze_A114 Crystal Structures Of A Poxviral Glutaredoxin In Th 4e-07
2hze_B114 Crystal Structures Of A Poxviral Glutaredoxin In Th 7e-06
3l4n_A127 Crystal Structure Of Yeast Monothiol Glutaredoxin G 4e-05
3lgc_A89 Crystal Structure Of Glutaredoxin 1 From Francisell 0.001
1ego_A85 Nmr Structure Of Oxidized Escherichia Coli Glutared 0.002
>gi|241913123|pdb|2WCI|A Chain A, Structure Of E. Coli Monothiol Glutaredoxin Grx4 Homodimer Length = 135 Back     alignment and structure
 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 43/103 (41%), Positives = 71/103 (68%), Gaps = 1/103 (0%)

Query: 1   MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALR 60
           M++++   IQ +I +N ++L+MKG+P  P CGFS + VQ L + G  +  +D+L +  +R
Sbjct: 21  MSTTI-EKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIR 79

Query: 61  QSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSI 103
             + +Y+NWPT PQL+V G+ +GGCDIV EM++ GEL +++  
Sbjct: 80  AELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKE 122


gi|66361013|pdb|1YKA|A Chain A, Solution Structure Of Grx4, A Monothiol Glutaredoxin From E. Coli. Length = 115 Back     alignment and structure
>gi|294662363|pdb|3GX8|A Chain A, Structural And Biochemical Characterization Of Yeast Monothiol Glutaredoxin Grx5 Length = 121 Back     alignment and structure
>gi|298508363|pdb|3IPZ|A Chain A, Crystal Structure Of Arabidopsis Monothiol Glutaredoxin Atgr Length = 109 Back     alignment and structure
>gi|159163386|pdb|1WIK|A Chain A, Solution Structure Of The Picot Homology 2 Domain Of The Mouse Pkc-Interacting Cousin Of Thioredoxin Protein Length = 109 Back     alignment and structure
>gi|224036432|pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione Length = 112 Back     alignment and structure
>gi|158428280|pdb|2E7P|A Chain A, Crystal Structure Of The Holo Form Of Glutaredoxin C1 From Populus Tremula X Tremuloides Length = 116 Back     alignment and structure
>gi|93278531|pdb|1Z7P|A Chain A, Solution Structure Of Reduced Glutaredoxin C1 From Populus Tremula X Tremuloides Length = 117 Back     alignment and structure
>gi|229597571|pdb|2KHP|A Chain A, Solution Structure Of Glutaredoxin From Brucella Melitensis Length = 92 Back     alignment and structure
>gi|11514277|pdb|1FOV|A Chain A, Glutaredoxin 3 From Escherichia Coli In The Fully Oxidized Form Length = 82 Back     alignment and structure
>gi|159163859|pdb|2CQ9|A Chain A, Solution Structure Of Rsgi Ruh-044, An N-Terminal Domain Of Glutaredoxin 2 From Human Cdna Length = 130 Back     alignment and structure
>gi|114794509|pdb|2HT9|A Chain A, The Structure Of Dimeric Human Glutaredoxin 2 Length = 146 Back     alignment and structure
>gi|157836820|pdb|3GRX|A Chain A, Nmr Structure Of Escherichia Coli Glutaredoxin 3- Glutathione Mixed Disulfide Complex, 20 Structures Length = 82 Back     alignment and structure
>gi|88193079|pdb|2FLS|A Chain A, Crystal Structure Of Human Glutaredoxin 2 Complexed With Glutathione Length = 132 Back     alignment and structure
>gi|237640665|pdb|3H8Q|A Chain A, Crystal Structure Of Glutaredoxin Domain Of Human Thioredoxin Reductase 3 Length = 114 Back     alignment and structure
>gi|157831627|pdb|1KTE|A Chain A, Crystal Structure Of Thioltransferase At 2.2 Angstrom Resolution Length = 105 Back     alignment and structure
>gi|254839155|pdb|2KLX|A Chain A, Solution Structure Of Glutaredoxin From Bartonella Henselae Str. Houston Length = 89 Back     alignment and structure
gi|157831548|pdb|1JHB|A Chain A, Human Glutaredoxin In Fully Reduced Form, Nmr, 20 Structures Length = 106 Back     alignment and structure
>gi|6730102|pdb|1B4Q|A Chain A, Solution Structure Of Human Thioltransferase Complex With Glutathione Length = 105 Back     alignment and structure
>gi|29726703|pdb|1NM3|A Chain A, Crystal Structure Of Heamophilus Influenza Hybrid-Prx5 Length = 241 Back     alignment and structure
>gi|256599739|pdb|3H4K|A Chain A, Crystal Structure Of The Wild Type Thioredoxin Glutatione Reductase From Schistosoma Mansoni In Complex With Auranofin Length = 598 Back     alignment and structure
>gi|169404640|pdb|2V6O|A Chain A, Structure Of Schistosoma Mansoni Thioredoxin-Glutathione Reductase (Smtgr) Length = 596 Back     alignment and structure
>gi|301015710|pdb|2X8C|A Chain A, Thioredoxin Glutathione Reductase From Schistosoma Mansoni With The Reduced C-Terminal End Length = 598 Back     alignment and structure
>gi|212374954|pdb|3CTF|A Chain A, Crystal Structure Of Oxidized Grx2 Length = 129 Back     alignment and structure
>gi|210060958|pdb|3D4M|A Chain A, Glutaredoxin 2 Oxidized Structure Length = 109 Back     alignment and structure
>gi|210060959|pdb|3D5J|A Chain A, Structure Of Yeast Grx2-C30s Mutant With Glutathionyl Mixed Disulfide Length = 112 Back     alignment and structure
>gi|122920877|pdb|2JAD|A Chain A, Yellow Fluorescent Protein- Glutaredoxin Fusion Protein Length = 362 Back     alignment and structure
>gi|217035364|pdb|3C1R|A Chain A, Crystal Structure Of Oxidized Grx1 Length = 118 Back     alignment and structure
>gi|122920875|pdb|2JAC|A Chain A, Glutaredoxin Grx1p C30s Mutant From Yeast Length = 110 Back     alignment and structure
>gi|119389998|pdb|2HZE|A Chain A, Crystal Structures Of A Poxviral Glutaredoxin In The Oxidized And Reduced States Show Redox-Correlated Structural Changes Length = 114 Back     alignment and structure
>gi|119389999|pdb|2HZE|B Chain B, Crystal Structures Of A Poxviral Glutaredoxin In The Oxidized And Reduced States Show Redox-Correlated Structural Changes Length = 114 Back     alignment and structure
>gi|293651923|pdb|3L4N|A Chain A, Crystal Structure Of Yeast Monothiol Glutaredoxin Grx6 Length = 127 Back     alignment and structure
>gi|288965852|pdb|3LGC|A Chain A, Crystal Structure Of Glutaredoxin 1 From Francisella Tularensis Length = 89 Back     alignment and structure
>gi|157830944|pdb|1EGO|A Chain A, Nmr Structure Of Oxidized Escherichia Coli Glutaredoxin: Comparison With Reduced E. Coli Glutaredoxin And Functionally Related Proteins Length = 85 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target106 hypothetical protein CLIBASIA_04345 [Candidatus Liberib
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur cluste 9e-33
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electron tra 3e-30
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open read 6e-28
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, elec 9e-28
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domain, pi 2e-26
2jad_A362 Yellow fluorescent protein glutaredoxin fusion protein; 8e-23
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cytoplas 3e-20
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53 6e-20
3fz9_A112 Glutaredoxin; oxidoreductase; HET: GSH; 1.70A {Populus 3e-18
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX6, ox 6e-18
1kte_A105 Thioltransferase; redox-active center, electron transpo 1e-17
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2e-17
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarse 2e-17
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-transferas 4e-17
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, electron 8e-17
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron transp 3e-16
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, el 6e-16
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, electron 1e-15
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structural gen 1e-15
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 2; S 6e-14
3ctg_A129 Glutaredoxin-2; reduced form, cytoplasm, electron trans 8e-14
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein; SH3 1e-13
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich protein 2e-13
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia coli 6e-12
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A {Bact 2e-11
3lgc_A89 Glutaredoxin 1; alpha-beta sandwich, structural genomic 3e-11
2v6o_A 596 Thioredoxin glutathione reductase; FAD, flavoprotein, o 8e-11
1h75_A81 Glutaredoxin-like protein NRDH; electron transport, thi 1e-10
2x8g_A 598 Thioredoxin glutathione reductase; redox-active center, 1e-09
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for structu 1e-08
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, p 8e-08
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, protein 6e-07
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, 8e-07
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, cytoplasm, transport, glutathione, thioredoxin fold; HET: GSW; 1.90A {Escherichia coli} PDB: 1yka_A Length = 135 Back     alignment and structure
 Score =  133 bits (336), Expect = 9e-33
 Identities = 43/100 (43%), Positives = 68/100 (68%)

Query: 3   SSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQS 62
           S+    IQ +I +N ++L+MKG+P  P CGFS + VQ L + G  +  +D+L +  +R  
Sbjct: 22  STTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAE 81

Query: 63  IKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILS 102
           + +Y+NWPT PQL+V G+ +GGCDIV EM++ GEL +++ 
Sbjct: 82  LPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIK 121


>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} Length = 109 Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Length = 121 Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Length = 109 Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Length = 362 Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A Length = 118 Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 Back     alignment and structure
>3fz9_A Glutaredoxin; oxidoreductase; HET: GSH; 1.70A {Populus tremula x populus tremuloides} PDB: 3fza_A* Length = 112 Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GTT; 1.50A {Saccharomyces cerevisiae} Length = 127 Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Length = 105 Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Length = 146 Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron transport, oxidoreductase; 1.80A {Ectromelia virus moscow} PDB: 2hzf_A 2hze_B Length = 114 Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 130 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron transport, structural genomics; NMR {Bartonella henselae str} Length = 89 Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GTT; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Length = 241 Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron transport, structural genomics; NMR {Brucella melitensis} Length = 92 Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics consortium, SGC, cytoplasm, developmental protein; 2.21A {Homo sapiens} Length = 114 Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, cytoplasm, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Length = 129 Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Length = 121 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein- like 3; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Length = 93 Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Length = 85 Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Bacteriophage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Length = 87 Back     alignment and structure
>3lgc_A Glutaredoxin 1; alpha-beta sandwich, structural genomics, structural genomics of infectious diseases; 2.77A {Francisella tularensis subsp} Length = 89 Back     alignment and structure
>2v6o_A Thioredoxin glutathione reductase; FAD, flavoprotein, oxidoreductase, chimeric enzyme, thiol-mediated detoxification pathway; HET: FAD PG4; 2.20A {Schistosoma mansoni} PDB: 3h4k_A* Length = 596 Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Length = 81 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GTT; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Length = 89 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomics; 1.70A {Archaeoglobus fulgidus} Length = 92 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Length = 103 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Length = 75 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target106 hypothetical protein CLIBASIA_04345 [Candidatus Liberib
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electron tra 100.0
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur cluste 100.0
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, elec 100.0
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open read 100.0
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domain, pi 100.0
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 99.96
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron transp 99.95
3fz9_A112 Glutaredoxin; oxidoreductase; HET: GSH; 1.70A {Populus 99.95
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarse 99.95
2jad_A362 Yellow fluorescent protein glutaredoxin fusion protein; 99.95
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structural gen 99.95
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-transferas 99.95
3ctg_A129 Glutaredoxin-2; reduced form, cytoplasm, electron trans 99.95
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX6, ox 99.94
1kte_A105 Thioltransferase; redox-active center, electron transpo 99.94
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cytoplas 99.94
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, electron 99.92
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53 99.91
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, electron 99.87
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, el 99.84
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for structu 99.81
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein; SH3 99.8
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich protein 99.8
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 2; S 99.79
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia coli 99.77
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A {Ente 99.76
1h75_A81 Glutaredoxin-like protein NRDH; electron transport, thi 99.71
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, 99.7
2x8g_A 598 Thioredoxin glutathione reductase; redox-active center, 99.69
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, p 99.64
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, protein 99.59
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin fold, 98.69
1ttz_A87 Conserved hypothetical protein; structural genomics, un 98.54
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulation, d 98.21
3ir4_A 218 Glutaredoxin 2; glutathione, IDP00895, structural genom 98.2
3lyp_A 215 Stringent starvation protein A; structural genomics, GS 97.97
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thiol-th 97.95
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disulfide 97.93
1r26_A125 Thioredoxin; redox-active disulfide, electron transport 97.93
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold; 1.9 97.9
3lyk_A 216 Stringent starvation protein A homolog; structural geno 97.87
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tr 97.82
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like 97.81
1k0m_A 241 CLIC1, NCC27, chloride intracellular channel protein 1; 97.79
1e6b_A 221 Glutathione S-transferase; 1.65A {Arabidopsis thaliana} 97.77
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathione, t 97.76
3fy7_A 250 Chloride intracellular channel protein 3; GST, glutathi 97.75
2ahe_A 267 Chloride intracellular channel protein 4; glutathione-S 97.69
1oyj_A 231 Glutathione S-transferase; herbicide detoxification; HE 97.62
2cz2_A 223 Maleylacetoacetate isomerase; structural genomics, GST, 97.6
2r4v_A 247 XAP121, chloride intracellular channel protein 2; chlor 97.59
1r5a_A 218 Glutathione transferase; glutathione S-transferase, GST 97.56
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, protein st 97.55
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} P 97.55
2vo4_A 219 2,4-D inducible glutathione S-transferase; herbicide, T 97.53
3lxz_A 229 Glutathione S-transferase family protein; structural ge 97.51
1aw9_A 216 Glutathione S-transferase III; herbicide detoxification 97.45
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxidored 97.45
1eem_A 241 Glutathione-S-transferase; GST, glutathione conjugating 97.44
2c3n_A 247 Glutathione S-transferase theta 1; glutathione transfer 97.43
3bby_A 215 Uncharacterized GST-like protein YFCF; NP_416804.1, glu 97.42
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.3 97.41
2imi_A 221 Epsilon-class glutathione S-transferase; HET: GSH; 1.40 97.4
1yy7_A 213 SSPA, stringent starvation protein A; GST fold, transcr 97.37
1axd_A 209 Glutathione S-transferase I; complex (transferase/ligan 97.33
2yv7_A 260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channe 97.31
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sandwich, 97.31