254780975

254780975

D-ribulose-5 phosphate 3-epimerase protein

GeneID in NCBI database:8209997Locus tag:CLIBASIA_04380
Protein GI in NCBI database:254780975Protein Accession:YP_003065388.1
Gene range:-(971892, 972566)Protein Length:224aa
Gene description:D-ribulose-5 phosphate 3-epimerase protein
COG prediction:[G] Pentose-5-phosphate-3-epimerase
KEGG prediction:D-ribulose-5 phosphate 3-epimerase protein; K01783 ribulose-phosphate 3-epimerase [EC:5.1.3.1]
SEED prediction:Ribulose-phosphate 3-epimerase (EC 5.1.3.1)
Pathway involved in KEGG:Pentose phosphate pathway [PATH:las00030]
Pentose and glucuronate interconversions [PATH:las00040]
Subsystem involved in SEED:Pentose phosphate pathway;
Formaldehyde assimilation: Ribulose monophosphate pathway;
Conserved gene cluster associated with Met-tRNA formyltransferase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MTPSIQIVPSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSYSDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGKKTGVAINPETPVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTSRNIKSLVQAGADLLVVGSSFFNQKGEISYAKRLNDLKKSALAID
cccccEEEHHHHHccHHHHHHHHHHHHHccccEEEEEEEcccccccccccHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHccEEEEEEcccccccccccHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHccccEEEEcHHHHccccHHHHHHHHHHHHHHHHccc
cccccEEccEHHHccHHHHHHHHHHHHHcccccEEEEEEEccccccEcccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHcccEEEEEEcccccHHHHccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHHHHccc
mtpsiqivPSILAADFSRLGEEISNITKAGAKQIHfdvmdgcfvpnisfgADVIRSLRSysdsvfdchLMISSIDSHINIIADAgcdiitfhpessphiRRSLRTIHAMGKktgvainpetpvAILEDVIDEIDMILIMtvnpgfggqqlieSTIPKIRQAKALigkrsislevdggvtsRNIKSLVQAGADLLVVGssffnqkgeISYAKRLNDLKKSALAID
mtpsiqivpSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSYSDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGkktgvainpetpVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTSRNIKSLVQAGADLLVVGSSFfnqkgeisyakrlndlkksalaid
MTPSIQIVPSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSYSDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGKKTGVAINPETPVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTSRNIKSLVQAGADLLVVGSSFFNQKGEISYAKRLNDLKKSALAID
***SIQIVPSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSYSDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGKKTGVAINPETPVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTSRNIKSLVQAGADLLVVGSSFFNQKGEISYAKRLNDLKKSA****
MTPSIQIVPSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSYSDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGKKTGVAINPETPVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTSRNIKSLVQAGADLLVVGSSFFNQKGEISYAKRLNDLKKSALAID
**PSIQIVPSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSYSDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGKKTGVAINPETPVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTSRNIKSLVQAGADLLVVGSSFFNQKGEISYAKRLNDLKKSALA**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPSIQIVPSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSYSDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGKKTGVAINPETPVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTSRNIKSLVQAGADLLVVGSSFFNQKGEISYAKRLNDLKKSALAID
MTPSIQIVPSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSYSDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGKKTGVAINPETPVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTSRNIKSLVQAGADLLVVGSSFFNQKGEISYAKRLNDLKKSALAID
MTPSIQIVPSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSYSDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGKKTGVAINPETPVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTSRNIKSLVQAGADLLVVGSSFFNQKGEISYAKRLNDLKKSALAID

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target224 D-ribulose-5 phosphate 3-epimerase protein [Candidatus
315122607225 D-ribulose-5 phosphate 3-epimerase protein [Candidatus 1 3e-99
190891970225 D-ribulose-5 phosphate 3-epimerase [Rhizobium etli CIAT 1 1e-69
86357885225 D-ribulose-5 phosphate 3-epimerase protein [Rhizobium e 1 8e-69
222086125228 ribulose-phosphate 3-epimerase [Agrobacterium radiobact 1 2e-68
222148777225 ribulose-phosphate 3-epimerase [Agrobacterium vitis S4] 1 2e-68
327190557225 D-ribulose-5 phosphate 3-epimerase protein [Rhizobium e 1 3e-67
325293239225 ribulose-phosphate 3-epimerase [Agrobacterium sp. H13-3 1 3e-67
218671602225 D-ribulose-5 phosphate 3-epimerase protein [Rhizobium e 1 6e-67
209549512225 ribulose-phosphate 3-epimerase [Rhizobium leguminosarum 1 9e-67
116252344225 ribulose-phosphate 3-epimerase [Rhizobium leguminosarum 1 1e-65
>gi|315122607|ref|YP_004063096.1| D-ribulose-5 phosphate 3-epimerase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 225 Back     alignment and organism information
 Score =  365 bits (936), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 200/224 (89%)

Query: 1   MTPSIQIVPSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSY 60
           M  SIQIVPSILAADFSRLGEE+S+ITKAGAKQIHFDVMDG FVPNISFGADVI+SLRSY
Sbjct: 1   MPLSIQIVPSILAADFSRLGEEVSDITKAGAKQIHFDVMDGHFVPNISFGADVIKSLRSY 60

Query: 61  SDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGKKTGVAINPE 120
           SD++FDCHLMISS+DSHI + ADAGCDIIT H E SPHIR+SLRTI AMGKK+G+A+NPE
Sbjct: 61  SDAIFDCHLMISSVDSHIKVFADAGCDIITLHAEFSPHIRQSLRTIRAMGKKSGIALNPE 120

Query: 121 TPVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTS 180
           TPV++LE+VIDEIDMILIMTVNPGFGGQQLI  T+PKIRQA+ LIGKR I+LEVDGG+ S
Sbjct: 121 TPVSVLENVIDEIDMILIMTVNPGFGGQQLINFTVPKIRQARELIGKRPIALEVDGGIKS 180

Query: 181 RNIKSLVQAGADLLVVGSSFFNQKGEISYAKRLNDLKKSALAID 224
            NI+SL Q GA+L V GS+ FN+K + SY +RLN+LKKSAL ID
Sbjct: 181 GNIRSLAQEGANLFVAGSAIFNKKEKESYKQRLNELKKSALKID 224


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190891970|ref|YP_001978512.1| D-ribulose-5 phosphate 3-epimerase [Rhizobium etli CIAT 652] Length = 225 Back     alignment and organism information
>gi|86357885|ref|YP_469777.1| D-ribulose-5 phosphate 3-epimerase protein [Rhizobium etli CFN 42] Length = 225 Back     alignment and organism information
>gi|222086125|ref|YP_002544657.1| ribulose-phosphate 3-epimerase [Agrobacterium radiobacter K84] Length = 228 Back     alignment and organism information
>gi|222148777|ref|YP_002549734.1| ribulose-phosphate 3-epimerase [Agrobacterium vitis S4] Length = 225 Back     alignment and organism information
>gi|327190557|gb|EGE57651.1| D-ribulose-5 phosphate 3-epimerase protein [Rhizobium etli CNPAF512] Length = 225 Back     alignment and organism information
>gi|325293239|ref|YP_004279103.1| ribulose-phosphate 3-epimerase [Agrobacterium sp. H13-3] Length = 225 Back     alignment and organism information
>gi|218671602|ref|ZP_03521272.1| D-ribulose-5 phosphate 3-epimerase protein [Rhizobium etli GR56] Length = 225 Back     alignment and organism information
>gi|209549512|ref|YP_002281429.1| ribulose-phosphate 3-epimerase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 225 Back     alignment and organism information
>gi|116252344|ref|YP_768182.1| ribulose-phosphate 3-epimerase [Rhizobium leguminosarum bv. viciae 3841] Length = 225 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target224 D-ribulose-5 phosphate 3-epimerase protein [Candidatus
PRK05581220 PRK05581, PRK05581, ribulose-phosphate 3-epimerase; Val 3e-76
COG0036220 COG0036, Rpe, Pentose-5-phosphate-3-epimerase [Carbohyd 9e-71
TIGR01163210 TIGR01163, rpe, ribulose-phosphate 3-epimerase 8e-67
pfam00834201 pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 epimera 1e-63
PLN02334229 PLN02334, PLN02334, ribulose-phosphate 3-epimerase 3e-63
PRK08883220 PRK08883, PRK08883, ribulose-phosphate 3-epimerase; Pro 4e-53
KOG3111224 KOG3111, KOG3111, KOG3111, D-ribulose-5-phosphate 3-epi 5e-52
PRK08745223 PRK08745, PRK08745, ribulose-phosphate 3-epimerase; Pro 5e-52
PTZ00170228 PTZ00170, PTZ00170, D-ribulose-5-phosphate 3-epimerase; 1e-51
PRK09722229 PRK09722, PRK09722, allulose-6-phosphate 3-epimerase; P 7e-45
PRK08005210 PRK08005, PRK08005, epimerase; Validated 4e-22
PRK08091228 PRK08091, PRK08091, ribulose-phosphate 3-epimerase; Val 8e-18
PRK14057254 PRK14057, PRK14057, epimerase; Provisional 2e-14
cd04722200 cd04722, TIM_phosphate_binding, TIM barrel proteins sha 4e-06
cd00429211 cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RPE) 2e-72
>gnl|CDD|180145 PRK05581, PRK05581, ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>gnl|CDD|30385 COG0036, Rpe, Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130231 TIGR01163, rpe, ribulose-phosphate 3-epimerase Back     alignment and domain information
>gnl|CDD|144433 pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 epimerase family Back     alignment and domain information
>gnl|CDD|177968 PLN02334, PLN02334, ribulose-phosphate 3-epimerase Back     alignment and domain information
>gnl|CDD|181575 PRK08883, PRK08883, ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|38321 KOG3111, KOG3111, KOG3111, D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|136958 PRK08745, PRK08745, ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|185495 PTZ00170, PTZ00170, D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|182048 PRK09722, PRK09722, allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|169179 PRK08005, PRK08005, epimerase; Validated Back     alignment and domain information
>gnl|CDD|169215 PRK08091, PRK08091, ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>gnl|CDD|172549 PRK14057, PRK14057, epimerase; Provisional Back     alignment and domain information
>gnl|CDD|73384 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>gnl|CDD|73366 cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 224 D-ribulose-5 phosphate 3-epimerase protein [Candidatus
TIGR01163216 rpe ribulose-phosphate 3-epimerase; InterPro: IPR000056 100.0
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 100.0
PRK05581220 ribulose-phosphate 3-epimerase; Validated 100.0
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate trans 100.0
PRK08005210 ribulose-phosphate 3-epimerase; Validated 100.0
PRK08091235 ribulose-phosphate 3-epimerase; Validated 100.0
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 100.0
PRK09722227 allulose-6-phosphate 3-epimerase; Provisional 100.0
PTZ00170224 D-ribulose-5-phosphate 3-epimerase; Provisional 100.0
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This enzyme 100.0
pfam00834201 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family. T 100.0
KOG3111224 consensus 100.0
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the cost 99.68
PRK07028 429 bifunctional hexulose-6-phosphate synthase/ribonuclease 99.66
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provi 99.62
PRK13305220 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provi 99.59
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related protei 99.52
PRK13307392 bifunctional formaldehyde-activating enzyme/3-hexulose- 99.48
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 99.38
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase ( 99.36
PRK13127262 consensus 99.04
CHL00200263 trpA tryptophan synthase alpha subunit; Provisional 99.02
PRK13122242 consensus 99.01
PRK13111256 trpA tryptophan synthase subunit alpha; Provisional 99.0
cd04722200 TIM_phosphate_binding TIM barrel proteins share a struc 98.99
PRK00043210 thiE thiamine-phosphate pyrophosphorylase; Reviewed 98.96
PRK03220257 consensus 98.96
PRK13129267 consensus 98.95
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) a 98.92
PRK13117268 consensus 98.9
PRK02621254 consensus 98.89
PRK00748241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 98.86
pfam00977229 His_biosynth Histidine biosynthesis protein. Proteins i 98.86
PRK13131257 consensus 98.85
pfam00290258 Trp_syntA Tryptophan synthase alpha chain. 98.85
cd04731243 HisF The cyclase subunit of imidazoleglycerol phosphate 98.85
PRK13118269 consensus 98.83
PRK13125247 trpA tryptophan synthase subunit alpha; Provisional 98.82
PRK13585240 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 98.82
PRK13136253 consensus 98.81
PRK02145257 consensus 98.81
PRK01659252 consensus 98.8
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carb 98.8
PRK13139254 consensus 98.79
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synthase) 98.78
PRK13135267 consensus 98.78
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazole car 98.77
PRK07695202 transcriptional regulator TenI; Provisional 98.77
PRK13119261 consensus 98.76
PRK13113263 consensus 98.75
PRK13597252 imidazole glycerol phosphate synthase subunit HisF; Pro 98.74
PRK04281254 consensus 98.74
PRK13140257 consensus 98.73
PRK02747257 consensus 98.73
PRK13134257 consensus 98.73
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme metaboli 98.72
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 98.71
PRK13124257 consensus 98.69
PRK13116278 consensus 98.66
PRK02615345 thiamine-phosphate pyrophosphorylase; Provisional 98.64
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 98.64
PRK13121265 consensus 98.62
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. This c 98.6
PRK02083253 imidazole glycerol phosphate synthase subunit HisF; Pro 98.6
PRK13114266 consensus 98.59
PRK13112279 consensus 98.59
PRK13586231 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 98.57
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid transp 98.57
PRK05211248 consensus 98.55
PRK00830273 consensus 98.54
PRK01033253 imidazole glycerol phosphate synthase subunit HisF; Pro 98.53
PRK13138264 consensus 98.52
PRK13115269 consensus 98.49
PRK13133267 consensus 98.49
PRK13123256 consensus 98.49
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carboxami 98.47
PRK13120285 consensus 98.44
PRK13126237 consensus 98.41
PRK01222212 N-(5'-phosphoribosyl)anthranilate isomerase; Provisiona 98.41
PRK12290439 thiE thiamine-phosphate pyrophosphorylase; Reviewed 98.4
pfam00215218 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS 98.4
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 98.4
PRK00230231 orotidine 5'-phosphate decarboxylase; Reviewed 98.39
PRK13132246 consensus 98.36
PRK13137266 consensus 98.3
PRK01130222 N-acetylmannosamine-6-phosphate 2-epimerase; Provisiona 98.28
pfam00697195 PRAI N-(5'phosphoribosyl)anthranilate (PRA) isomerase. 98.27
cd04725216 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxy 98.27
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) cataly 98.2
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provisiona 98.15
PRK07455210 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 98.15
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) c 98.13
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 98.11
PRK09427459 bifunctional indole-3-glycerol phosphate synthase/phosp 98.08
PRK00278261 trpC indole-3-glycerol-phosphate synthase; Reviewed 98.08
COG0135208 TrpF Phosphoribosylanthranilate isomerase [Amino acid t 98.06
pfam01081196 Aldolase KDPG and KHG aldolase. This family includes th 98.03
pfam02581180 TMP-TENI Thiamine monophosphate synthase/TENI. Thiamine 98.03
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Review 98.02
PRK09517 738 multifunctional thiamine-phosphate pyrophosphorylase/sy 98.01
TIGR00007241 TIGR00007 phosphoribosylformimino-5-aminoimidazole carb 97.99
PRK06857209 consensus 97.96
pfam00218254 IGPS Indole-3-glycerol phosphate synthase. 97.96
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); an en 97.95
PRK08904207 consensus 97.95
PRK06015212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 97.93
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino acid t 97.92
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epimerase 97.89
PRK06552209 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 97.86
TIGR00693210 thiE thiamine-phosphate pyrophosphorylase; InterPro: IP 97.83
COG0284240 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide t 97.83
PRK08104212 consensus 97.81
PRK08782219 consensus 97.77
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 97.76
pfam03932202 CutC CutC family. Copper transport in Escherichia coli 97.73
pfam04481243 DUF561 Protein of unknown function (DUF561). Protein of 97.72
PRK13803 611 bifunctional phosphoribosylanthranilate isomerase/trypt 97.66
PRK05265240 pyridoxine 5'-phosphate synthase; Provisional 97.64
pfam03740239 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ. Mem 97.56
PRK07114223 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 97.54
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family belong 97.5
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 97.39
pfam01884231 PcrB PcrB family. This family contains proteins that ar 97.34
PRK11572248 copper homeostasis protein CutC; Provisional 97.28
PRK07807479 inositol-5-monophosphate dehydrogenase; Validated 97.28
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/trypt 97.27
PRK10128250 putative aldolase; Provisional 97.24
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase doma 97.24
PRK06256325 biotin synthase; Validated 97.23
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. coli th 97.2
TIGR01740233 pyrF orotidine 5'-phosphate decarboxylase; InterPro: IP 97.0
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisio 97.0
TIGR01302476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 96.86
KOG4175268 consensus 96.76
PRK09282 580 pyruvate carboxylase subunit B; Validated 96.76
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 96.76
PRK07107497 inositol-5-monophosphate dehydrogenase; Validated 96.7
PRK12330 499 oxaloacetate decarboxylase; Provisional 96.69
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohy 96.55
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fold [G 96.52
PRK02506308 dihydroorotate dehydrogenase 1A; Reviewed 96.5
PRK09427 459 bifunctional indole-3-glycerol phosphate synthase/phosp 96.27
PRK04169229 geranylgeranylglyceryl phosphate synthase-like protein; 96.23
cd02812219 PcrB_like PcrB_like proteins. One member of this family 96.15
pfam03437254 BtpA BtpA family. The BtpA protein is tightly associate 96.11
TIGR01182205 eda 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydrox 95.88
TIGR01768242 GGGP-family geranylgeranylglyceryl phosphate synthase f 95.71
PRK12581 468 oxaloacetate decarboxylase; Provisional 95.7
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FM 95.68
TIGR00262262 trpA tryptophan synthase, alpha subunit; InterPro: IPR0 95.55
COG3142241 CutC Uncharacterized protein involved in copper resista 95.42
PRK00042251 tpiA triosephosphate isomerase; Provisional 94.91
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 94.8
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino acid t 94.7
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy produ 94.45
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 94.32
PRK07094323 biotin synthase; Provisional 94.29
PRK12331 463 oxaloacetate decarboxylase; Provisional 94.18
PRK08195337 4-hydroxy-2-ketovalerate aldolase; Validated 93.8
pfam00682237 HMGL-like HMGL-like. This family contains a diverse set 93.77
TIGR00734230 hisAF_rel hisA/hisF family protein; InterPro: IPR004650 93.75
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme meta 93.67
PRK12857284 putative aldolase; Reviewed 93.52
pfam05690246 ThiG Thiazole biosynthesis protein ThiG. This family co 93.51
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. Membe 93.46
TIGR00381 401 cdhD CO dehydrogenase/acetyl-CoA synthase, delta subuni 93.13
PRK08999312 hypothetical protein; Provisional 92.92
pfam00121243 TIM Triosephosphate isomerase. 92.71
PRK00208256 thiG thiazole synthase; Reviewed 92.6
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme 92.33
TIGR01769212 GGGP geranylgeranylglyceryl phosphate synthase; InterPr 92.1
PRK06267324 hypothetical protein; Provisional 91.76
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 91.56
PRK06806281 fructose-bisphosphate aldolase; Provisional 91.33
COG1856275 Uncharacterized homolog of biotin synthetase [Function 91.28
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 90.02
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of the n 98.51
pfam04131192 NanE Putative N-acetylmannosamine-6-phosphate epimerase 98.22
PRK07565333 dihydroorotate dehydrogenase 2; Reviewed 98.2
pfam03060330 NPD 2-nitropropane dioxygenase. Members of this family 98.08
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 98.01
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 97.89
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like prot 97.86
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) reduc 97.84
PRK05567486 inositol-5'-monophosphate dehydrogenase; Reviewed 97.82
PRK07896288 nicotinate-nucleotide pyrophosphorylase; Provisional 97.75
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and D 97.66
PTZ00314 499 inosine-5'-monophosphate dehydrogenase; Provisional 97.65
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine monoph 97.56
PRK08318 413 dihydropyrimidine dehydrogenase; Validated 97.54
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provisional 97.5
PRK06843404 inositol-5-monophosphate dehydrogenase; Validated 97.49
pfam00478467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 97.46
PRK04302223 triosephosphate isomerase; Provisional 97.36
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provisional 97.35
PRK09016296 quinolinate phosphoribosyltransferase; Validated 97.31
pfam01180290 DHO_dh Dihydroorotate dehydrogenase. 96.92
PRK08649368 inositol-5-monophosphate dehydrogenase; Validated 96.87
PRK09853 1032 putative selenate reductase subunit YgfK; Provisional 96.87
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 96.81
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme 96.73
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-bin 96.63
TIGR01303476 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro 96.1
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 96.03
TIGR01108 616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 95.98
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide transport 95.55
PRK05286336 dihydroorotate dehydrogenase 2; Reviewed 95.36
TIGR00078276 nadC nicotinate-nucleotide pyrophosphorylase; InterPro: 95.34
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisional 94.88
COG0325228 Predicted enzyme with a TIM-barrel fold [General functi 94.67
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase doma 94.57
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase [Gen 94.57
COG0149251 TpiA Triosephosphate isomerase [Carbohydrate transport 94.37
cd06824224 PLPDE_III_Yggs_like Pyridoxal 5-phosphate (PLP)-binding 93.95
COG2108353 Uncharacterized conserved protein related to pyruvate f 93.73
smart00812 384 Alpha_L_fucos Alpha-L-fucosidase. O-Glycosyl hydrolases 93.72
PRK05265240 pyridoxine 5'-phosphate synthase; Provisional 93.48
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dep 93.11
cd06822227 PLPDE_III_YBL036c_euk Pyridoxal 5-phosphate (PLP)-bindi 93.07
PRK08227291 aldolase; Validated 93.05
KOG2550503 consensus 91.29
TIGR01304376 IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro 91.13
PRK01362214 putative translaldolase; Provisional 90.83
pfam01120344 Alpha_L_fucos Alpha-L-fucosidase. 90.74
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-phospha 90.63
PRK00748 241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 98.04
PRK02621 254 consensus 97.97
TIGR03572 232 WbuZ glycosyl amidation-associated protein WbuZ. This c 97.93
PRK02747 257 consensus 97.92
PRK01033 253 imidazole glycerol phosphate synthase subunit HisF; Pro 97.89
PRK13585 240 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.89
PRK05211 248 consensus 97.86
PRK04281 254 consensus 97.86
pfam00977229 His_biosynth Histidine biosynthesis protein. Proteins i 97.84
PRK01659 252 consensus 97.8
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazole car 97.49
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.48
pfam01207309 Dus Dihydrouridine synthase (Dus). Members of this fami 96.35
cd01571302 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTa 95.63
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (P 94.63
PRK04180293 pyridoxine biosynthesis protein; Provisional 94.56
PRK08662343 nicotinate phosphoribosyltransferase; Reviewed 93.53
KOG3055 263 consensus 92.47
PRK13597 252 imidazole glycerol phosphate synthase subunit HisF; Pro 97.91
PRK03220 257 consensus 97.86
PRK02145 257 consensus 97.85
PRK00830 273 consensus 97.82
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.77
PRK13586 231 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.52
TIGR00007 241 TIGR00007 phosphoribosylformimino-5-aminoimidazole carb 97.49
COG0106 241 HisA Phosphoribosylformimino-5-aminoimidazole carboxami 97.08
TIGR02129 274 hisA_euk phosphoribosylformimino-5-aminoimidazole carbo 96.21
cd00516281 PRTase_typeII Phosphoribosyltransferase (PRTase) type I 95.57
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolis 94.45
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QAPRTas 97.88
PRK07428285 nicotinate-nucleotide pyrophosphorylase; Provisional 97.8
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferase (QA 97.79
PRK05848272 nicotinate-nucleotide pyrophosphorylase; Provisional 97.74
pfam01729169 QRPTase_C Quinolinate phosphoribosyl transferase, C-ter 97.69
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provisional 97.66
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provisional 97.62
PRK06096284 molybdenum transport protein ModD; Provisional 97.62
PRK08385279 nicotinate-nucleotide pyrophosphorylase; Provisional 97.57
TIGR01334277 modD modD protein; InterPro: IPR006242 The gene modD fo 97.56
PRK06978288 nicotinate-nucleotide pyrophosphorylase; Provisional 97.53
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transferase 97.53
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provisional 97.11
PRK05096347 guanosine 5'-monophosphate oxidoreductase; Provisional 96.93
cd00311242 TIM Triosephosphate isomerase (TIM) is a glycolytic enz 96.43
PRK07188355 nicotinate phosphoribosyltransferase; Provisional 95.18
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding doma 94.5
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding d 93.54
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN bind 93.5
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN bi 93.12
CHL00162267 thiG thiamin biosynthesis protein G; Validated 93.05
pfam01645367 Glu_synthase Conserved region in glutamate synthase. Th 92.76
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding domain. 90.91
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding 90.69
PRK02083253 imidazole glycerol phosphate synthase subunit HisF; Pro 97.85
cd04731243 HisF The cyclase subunit of imidazoleglycerol phosphate 97.73
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carb 97.63
PRK00957307 methionine synthase; Provisional 96.81
PRK09121339 5-methyltetrahydropteroyltriglutamate--homocysteine met 93.23
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM. Thi 92.36
pfam04055165 Radical_SAM Radical SAM superfamily. Radical SAM protei 92.3
PRK04326330 methionine synthase; Provisional 92.0
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM prote 96.28
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 96.18
cd03311332 CIMS_C_terminal_like CIMS - Cobalamine-independent meth 95.51
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM prote 93.79
pfam01717324 Meth_synt_2 Cobalamin-independent synthase, Catalytic d 91.71
PRK12331463 oxaloacetate decarboxylase; Provisional 91.49
TIGR02176 1194 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoredu 91.39
PRK04452322 acetyl-CoA decarbonylase/synthase complex subunit delta 93.57
PRK08367395 porA pyruvate ferredoxin oxidoreductase subunit alpha; 91.48
PRK09627375 oorA 2-oxoglutarate-acceptor oxidoreductase subunit Oor 91.22
PRK08366394 vorA 2-ketoisovalerate ferredoxin oxidoreductase subuni 90.9
PRK09622407 porA pyruvate flavodoxin oxidoreductase subunit alpha; 90.9
>TIGR01163 rpe ribulose-phosphate 3-epimerase; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08005 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>pfam00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family Back     alignment and domain information
>KOG3111 consensus Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK13127 consensus Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK13122 consensus Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK03220 consensus Back     alignment and domain information
>PRK13129 consensus Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PRK13117 consensus Back     alignment and domain information
>PRK02621 consensus Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>pfam00977 His_biosynth Histidine biosynthesis protein Back     alignment and domain information
>PRK13131 consensus Back     alignment and domain information
>pfam00290 Trp_syntA Tryptophan synthase alpha chain Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK13118 consensus Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK13136 consensus Back     alignment and domain information
>PRK02145 consensus Back     alignment and domain information
>PRK01659 consensus Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK13139 consensus Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PRK13135 consensus Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>PRK13119 consensus Back     alignment and domain information
>PRK13113 consensus Back     alignment and domain information
>PRK13597 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK04281 consensus Back     alignment and domain information
>PRK13140 consensus Back     alignment and domain information
>PRK02747 consensus Back     alignment and domain information
>PRK13134 consensus Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13124 consensus Back     alignment and domain information
>PRK13116 consensus Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK13121 consensus Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK13114 consensus Back     alignment and domain information
>PRK13112 consensus Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05211 consensus Back     alignment and domain information
>PRK00830 consensus Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK13138 consensus Back     alignment and domain information
>PRK13115 consensus Back     alignment and domain information
>PRK13133 consensus Back     alignment and domain information
>PRK13123 consensus Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13120 consensus Back     alignment and domain information
>PRK13126 consensus Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>pfam00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK13132 consensus Back     alignment and domain information
>PRK13137 consensus Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>pfam00697 PRAI N-(5'phosphoribosyl)anthranilate (PRA) isomerase Back     alignment and domain information
>cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam01081 Aldolase KDPG and KHG aldolase Back     alignment and domain information
>pfam02581 TMP-TENI Thiamine monophosphate synthase/TENI Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>TIGR00007 TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; InterPro: IPR006063 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (5 Back     alignment and domain information
>PRK06857 consensus Back     alignment and domain information
>pfam00218 IGPS Indole-3-glycerol phosphate synthase Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK08904 consensus Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08104 consensus Back     alignment and domain information
>PRK08782 consensus Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>pfam03932 CutC CutC family Back     alignment and domain information
>pfam04481 DUF561 Protein of unknown function (DUF561) Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>pfam03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>pfam01884 PcrB PcrB family Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PRK07807 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK10128 putative aldolase; Provisional Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase; InterPro: IPR014732 Orotidine 5'-phosphate decarboxylase (OMPdecase) (4 Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990 Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase IMP dehydrogenase (1 Back     alignment and domain information
>KOG4175 consensus Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PRK07107 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information