254780976

254780976

Holliday junction resolvase YqgF

GeneID in NCBI database:8209998Locus tag:CLIBASIA_04385
Protein GI in NCBI database:254780976Protein Accession:YP_003065389.1
Gene range:-(973456, 973938)Protein Length:160aa
Gene description:Holliday junction resolvase YqgF
COG prediction:[L] Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B. subtilis)
KEGG prediction:Holliday junction resolvase YqgF; K07447 putative holliday junction resolvase [EC:3.1.-.-]
SEED prediction:Putative Holliday junction resolvase (EC 3.1.-.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG
cccccHHHHHHHccccccEEEEEccccEEEEEcccccccEEccEEEEEcccccHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
cccccHHHHHHHcccccEEEEEEccccEEEEEEccccccccccHHHHHHccccccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHccccccEEEccccccHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccc
MSILLIEDLVKslkpnqpiasidlgtkriglaisdpgrrfahprpflvRKKVTQTALELLSFITTENIAAFIIGlplnmngsegprvhsTRAFVHNmidrkvyvpfvfwderlttVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG
MSILLIEDLVKslkpnqpiasidlgtkRIGLAISdpgrrfahprpflvrKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG
MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG
*SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSE*PRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ****************VDSIAAALILQEVL****F******
MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG
*SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG
MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG
MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target160 Holliday junction resolvase YqgF [Candidatus Liberibact
315122522167 Holliday junction resolvase YqgF [Candidatus Liberibact 1 2e-76
209549118163 Holliday junction resolvase-like protein [Rhizobium leg 1 2e-47
218661529166 holliday junction resolvase protein [Rhizobium etli IE4 1 2e-47
327192100164 holliday junction resolvase protein [Rhizobium etli CNP 1 2e-47
86357479164 holliday junction resolvase protein [Rhizobium etli CFN 1 3e-47
190891542164 holliday junction resolvase [Rhizobium etli CIAT 652] L 1 4e-47
222085624164 holliday junction resolvase protein [Agrobacterium radi 1 1e-46
222148317158 Holliday junction resolvase-like protein [Agrobacterium 1 5e-46
241204443164 Holliday junction resolvase-like protein [Rhizobium leg 1 6e-46
325292676159 Holliday junction resolvase [Agrobacterium sp. H13-3] L 1 6e-46
>gi|315122522|ref|YP_004063011.1| Holliday junction resolvase YqgF [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 167 Back     alignment and organism information
 Score =  288 bits (737), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 152/159 (95%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           MSILLIEDLVKSLKPNQPIASIDLGTK+IG+AISD GRRFAHPRPFL+RKK+TQTALELL
Sbjct: 1   MSILLIEDLVKSLKPNQPIASIDLGTKKIGIAISDLGRRFAHPRPFLIRKKITQTALELL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           SF TTENIAAF+IGLPLNMNGSEGPRV STRAFV NMIDR++ VPF+FWDERLTTVSAQQ
Sbjct: 61  SFATTENIAAFVIGLPLNMNGSEGPRVQSTRAFVQNMIDREINVPFIFWDERLTTVSAQQ 120

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           ILIDM+VSRKKR QKVDSIAA+LILQEVLDRIS L+SS+
Sbjct: 121 ILIDMDVSRKKRAQKVDSIAASLILQEVLDRISSLKSSE 159


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209549118|ref|YP_002281035.1| Holliday junction resolvase-like protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 163 Back     alignment and organism information
>gi|218661529|ref|ZP_03517459.1| holliday junction resolvase protein [Rhizobium etli IE4771] Length = 166 Back     alignment and organism information
>gi|327192100|gb|EGE59078.1| holliday junction resolvase protein [Rhizobium etli CNPAF512] Length = 164 Back     alignment and organism information
>gi|86357479|ref|YP_469371.1| holliday junction resolvase protein [Rhizobium etli CFN 42] Length = 164 Back     alignment and organism information
>gi|190891542|ref|YP_001978084.1| holliday junction resolvase [Rhizobium etli CIAT 652] Length = 164 Back     alignment and organism information
>gi|222085624|ref|YP_002544154.1| holliday junction resolvase protein [Agrobacterium radiobacter K84] Length = 164 Back     alignment and organism information
>gi|222148317|ref|YP_002549274.1| Holliday junction resolvase-like protein [Agrobacterium vitis S4] Length = 158 Back     alignment and organism information
>gi|241204443|ref|YP_002975539.1| Holliday junction resolvase-like protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 164 Back     alignment and organism information
>gi|325292676|ref|YP_004278540.1| Holliday junction resolvase [Agrobacterium sp. H13-3] Length = 159 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target160 Holliday junction resolvase YqgF [Candidatus Liberibact
PRK00109138 PRK00109, PRK00109, Holliday junction resolvase-like pr 1e-37
COG0816141 COG0816, COG0816, Predicted endonuclease involved in re 1e-32
TIGR00250130 TIGR00250, RNAse_H_YqgF, RNAse H-fold protein YqgF 4e-21
pfam03652134 pfam03652, UPF0081, Uncharacterized protein family (UPF 9e-38
smart0073299 smart00732, YqgFc, Likely ribonuclease with RNase H fol 2e-18
>gnl|CDD|178870 PRK00109, PRK00109, Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|31158 COG0816, COG0816, Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B Back     alignment and domain information
>gnl|CDD|129352 TIGR00250, RNAse_H_YqgF, RNAse H-fold protein YqgF Back     alignment and domain information
>gnl|CDD|146342 pfam03652, UPF0081, Uncharacterized protein family (UPF0081) Back     alignment and domain information
>gnl|CDD|128971 smart00732, YqgFc, Likely ribonuclease with RNase H fold Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 160 Holliday junction resolvase YqgF [Candidatus Liberibact
PRK00109141 Holliday junction resolvase-like protein; Reviewed 100.0
pfam03652134 UPF0081 Uncharacterized protein family (UPF0081). 100.0
COG0816141 Predicted endonuclease involved in recombination (possi 100.0
TIGR00250133 TIGR00250 conserved hypothetical protein TIGR00250; Int 100.0
COG2433 652 Uncharacterized conserved protein [Function unknown] 97.7
pfam04312138 DUF460 Protein of unknown function (DUF460). Archaeal p 97.33
TIGR00228158 ruvC crossover junction endodeoxyribonuclease RuvC; Int 90.74
smart0073299 YqgFc Likely ribonuclease with RNase H fold. YqgF prote 99.95
PRK00039169 ruvC Holliday junction resolvase; Reviewed 97.53
cd00529154 RuvC_resolvase Holliday junction resolvases (HJRs) are 97.51
COG2183 780 Tex Transcriptional accessory protein [Transcription] 97.41
pfam02075148 RuvC Crossover junction endodeoxyribonuclease RuvC. 97.16
COG1548 330 Predicted transcriptional regulator/sugar kinase [Trans 95.78
COG0817160 RuvC Holliday junction resolvasome, endonuclease subuni 95.16
COG1940 314 NagC Transcriptional regulator/sugar kinase [Transcript 95.1
PRK09698 302 D-allose kinase; Provisional 94.05
>PRK00109 Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information
>pfam03652 UPF0081 Uncharacterized protein family (UPF0081) Back     alignment and domain information
>COG0816 Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B Back     alignment and domain information
>TIGR00250 TIGR00250 conserved hypothetical protein TIGR00250; InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam04312 DUF460 Protein of unknown function (DUF460) Back     alignment and domain information
>TIGR00228 ruvC crossover junction endodeoxyribonuclease RuvC; InterPro: IPR002176 The Escherichia coli ruvC gene is involved in DNA repair and in the late step of RecE and RecF pathway recombination Back     alignment and domain information
>smart00732 YqgFc Likely ribonuclease with RNase H fold Back     alignment and domain information
>PRK00039 ruvC Holliday junction resolvase; Reviewed Back     alignment and domain information
>cd00529 RuvC_resolvase Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination Back     alignment and domain information
>COG2183 Tex Transcriptional accessory protein [Transcription] Back     alignment and domain information
>pfam02075 RuvC Crossover junction endodeoxyribonuclease RuvC Back     alignment and domain information
>COG1548 Predicted transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0817 RuvC Holliday junction resolvasome, endonuclease subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09698 D-allose kinase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target160 Holliday junction resolvase YqgF [Candidatus Liberibact
1vhx_A150 Crystal Structure Of Putative Holliday Junction Res 4e-32
1nmn_A138 Structure Of Yqgf From Escherichia Coli, A Hypothet 1e-30
1ovq_A138 Solution Structure Of The Hypothetical Protein Yqgf 2e-30
1nu0_A138 Structure Of The Double Mutant (L6m; F134m, Semet F 1e-28
1iv0_A98 Solution Structure Of The Yqgf-Family Protein (N-Te 5e-11
>gi|40889964|pdb|1VHX|A Chain A, Crystal Structure Of Putative Holliday Junction Resolvase Length = 150 Back     alignment and structure
 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 50/142 (35%), Positives = 74/142 (52%), Gaps = 3/142 (2%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGL 75
            I  +DLGTK +G+A+SD     A     +   +         L   I    I   ++G 
Sbjct: 4   RILGLDLGTKTLGVALSDEXGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGF 63

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P N NG+ GPR  +++ F   +++    VP V WDERLTT +A++ LI  +VSR+KR + 
Sbjct: 64  PKNXNGTVGPRGEASQTFAK-VLETTYNVPVVLWDERLTTXAAEKXLIAADVSRQKRKKV 122

Query: 136 VDSIAAALILQEVLDRISFLES 157
           +D  AA  ILQ  LD ++   S
Sbjct: 123 IDKXAAVXILQGYLDSLNEGGS 144


gi|46014935|pdb|1NMN|A Chain A, Structure Of Yqgf From Escherichia Coli, A Hypothetical Protein Length = 138 Back     alignment and structure
>gi|157879567|pdb|1OVQ|A Chain A, Solution Structure Of The Hypothetical Protein Yqgf From Escherichia Coli Length = 138 Back     alignment and structure
>gi|46014949|pdb|1NU0|A Chain A, Structure Of The Double Mutant (L6m; F134m, Semet Form) Of Yqgf From Escherichia Coli, A Hypothetical Protein Length = 138 Back     alignment and structure
>gi|37926502|pdb|1IV0|A Chain A, Solution Structure Of The Yqgf-Family Protein (N-Terminal Fragment) Length = 98 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target160 Holliday junction resolvase YqgF [Candidatus Liberibact
1nu0_A138 Hypothetical protein YQGF; structural genomics, structu 1e-31
1vhx_A150 Putative holliday junction resolvase; structural genomi 4e-27
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structural gen 4e-21
>1nu0_A Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} SCOP: c.55.3.8 PDB: 1nmn_A 1ovq_A Length = 138 Back     alignment and structure
 Score =  130 bits (329), Expect = 1e-31
 Identities = 41/134 (30%), Positives = 63/134 (47%), Gaps = 1/134 (0%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
            + + D GTK IG+A+       A P P +  +  T     +   +        I+GLPL
Sbjct: 4   TLMAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGLPL 63

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     KVD
Sbjct: 64  NMDGTEQPLTARARKFANR-IHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGKVD 122

Query: 138 SIAAALILQEVLDR 151
           S +A +IL+  +++
Sbjct: 123 SASAVIILESYMEQ 136


>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 Length = 150 Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Length = 98 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target160 Holliday junction resolvase YqgF [Candidatus Liberibact
1vhx_A150 Putative holliday junction resolvase; structural genomi 100.0
1nu0_A138 Hypothetical protein YQGF; structural genomics, structu 100.0
3bzc_A 785 TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, 97.61
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structural gen 99.97
1hjr_A158 Holliday junction resolvase (RUVC); site-specific recom 97.75
2gup_A 292 ROK family protein; sugar kinase, APC80695, sucrose, st 96.07
3htv_A 310 D-allose kinase, allokinase; NP_418508.1, structural ge 95.26
2ap1_A 327 Putative regulator protein; zinc binding protein, struc 95.04
3epq_A 302 Putative fructokinase; SCRK, ADP binding, PSI2, MCSG, s 94.81
3eo3_A 333 Bifunctional UDP-N-acetylglucosamine 2- epimerase/N-ace 93.28
1woq_A267 Inorganic polyphosphate/ATP-glucomannokinase; transfera 92.88
2qm1_A 326 Glucokinase; alpha-beta structure, putative helix-turn- 92.33
3mcp_A 366 Glucokinase; structural genomics, joint center for stru 92.21
1z05_A 429 Transcriptional regulator, ROK family; structural genom 90.43
3lm2_A226 Putative kinase; structural genomics, joint center for 96.02
1sz2_A 332 Glucokinase, glucose kinase; ATP-dependent, glucose bin 92.63
2q2r_A 373 Glucokinase 1, putative; ATPase hexose kinase family, t 90.31
1dkg_D 383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide excha 93.29
3i33_A 404 Heat shock-related 70 kDa protein 2; protein-ADP comple 90.35
>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 Back     alignment and structure
Probab=100.00  E-value=1.3e-43  Score=283.19  Aligned_cols=142  Identities=36%  Similarity=0.532  Sum_probs=132.6

Q ss_pred             CCCEEEEECCCCEEEEEEEECCCCEECCCEEEECCCCCH--HHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHH
Q ss_conf             983999986887689996307651101210110477415--689899998651677589972135788888447999999
Q gi|254780976|r   16 NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQ--TALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAF   93 (160)
Q Consensus        16 ~~riLgiD~G~kriGiAisd~~~~~a~Pl~~i~~~~~~~--~~~~l~~ii~e~~i~~iVvGlP~~~~g~~~~~~~~v~~f   93 (160)
                      +.|+||||||+||||+|+||+.+.+|+|++++.+++...  .+.+|.+++++|+|+.||||+|+++||+++++++.++.|
T Consensus         2 ~MriLgiD~G~kriGvAisD~~~~~a~pl~~i~~~~~~~~~~~~~i~~ii~e~~i~~iViGlP~~~dg~~~~~~~~v~~f   81 (150)
T 1vhx_A            2 SLRILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGFPKNMNGTVGPRGEASQTF   81 (150)
T ss_dssp             CEEEEEEEECSSEEEEEEECTTSSSEEEEEEEECBGGGTBCCHHHHHHHHTTSEEEEEEEECCCCBTTBCCHHHHHHHHH
T ss_pred             CCEEEEEECCCCEEEEEEECCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             86099995289979999956998833560113322345247999999999983999699857846688754889999999


Q ss_pred             HHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             99998404899779983671679999999986986445464378998999999999686456622
Q gi|254780976|r   94 VHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS  158 (160)
Q Consensus        94 ~~~L~~~~~~l~v~~~DEr~TS~~A~~~l~~~g~~~k~~k~~iD~~AA~iILq~~Ld~~~~~~~~  158 (160)
                      ++.|. +.+++||++|||||||++|++.+++.|++++++|+.+|++||++|||+|||+.+...|-
T Consensus        82 ~~~l~-~~~~l~V~~~DEr~TS~~A~~~l~~~~~~~~k~k~~iD~~AA~iILq~~Ld~~n~g~~~  145 (150)
T 1vhx_A           82 AKVLE-TTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVIDKMAAVMILQGYLDSLNEGGSH  145 (150)
T ss_dssp             HHHHH-HHHCSCEEEECCSSCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHTC----
T ss_pred             HHHHC-CCCCCCEEEECCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99626-58897568867886599999999976997000441476999999999999876376875



>1nu0_A Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} SCOP: c.55.3.8 PDB: 1nmn_A 1ovq_A Back     alignment and structure
>3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Back     alignment and structure
>1hjr_A Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} SCOP: c.55.3.6 Back     alignment and structure
>2gup_A ROK family protein; sugar kinase, APC80695, sucrose, structural genomics, PSI, protein structure initiative; HET: SUC; 2.01A {Streptococcus pneumoniae TIGR4} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>3htv_A D-allose kinase, allokinase; NP_418508.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Escherichia coli k-12} Back     alignment and structure
>2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>3eo3_A Bifunctional UDP-N-acetylglucosamine 2- epimerase/N-acetylmannosamine kinase; non-protein kinase, sialic acid biosynthesis; 2.84A {Homo sapiens} Back     alignment and structure
>1woq_A Inorganic polyphosphate/ATP-glucomannokinase; transferase; HET: BGC; 1.80A {Arthrobacter SP} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis V583} Back     alignment and structure
>3mcp_A Glucokinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, transferase; 3.00A {Parabacteroides distasonis} Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, PSI, protein structure initiative; 2.00A {Vibrio cholerae o1 biovar eltor str} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>3lm2_A Putative kinase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2, transferase; HET: MSE; 1.70A {Agrobacterium tumefaciens} Back     alignment and structure
>1sz2_A Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} SCOP: c.55.1.7 PDB: 1q18_A* Back     alignment and structure
>2q2r_A Glucokinase 1, putative; ATPase hexose kinase family, transferase; HET: BGC ADP; 2.10A {Trypanosoma cruzi} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide- binding, phosphoprotein, polymorphism; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3fzh_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 1ngh_A* 1ngd_A* 1ngf_A* 1bup_A* 1nga_A* ... Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 160 Holliday junction resolvase YqgF [Candidatus Liberibact
d1nu0a_138 c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escheri 1e-28
d1vhxa_140 c.55.3.8 (A:) Hypothetical protein YrrK (RuvX) {Bacillu 7e-26
d1iv0a_98 c.55.3.8 (A:) Hypothetical protein, YqgF homologue {The 3e-19
>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: Putative Holliday junction resolvase RuvX
domain: Hypothetical protein YqgF (RuvX)
species: Escherichia coli [TaxId: 562]
 Score =  119 bits (300), Expect = 1e-28
 Identities = 41/134 (30%), Positives = 63/134 (47%), Gaps = 1/134 (0%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
            + + D GTK IG+A+       A P P +  +  T     +   +        I+GLPL
Sbjct: 4   TLMAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGLPL 63

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+G+E P     R F + +  R   V     DERL+TV A+  L +    R     KVD
Sbjct: 64  NMDGTEQPLTARARKFANRIHGRF-GVEVKLHDERLSTVEARSGLFEQGGYRALNKGKVD 122

Query: 138 SIAAALILQEVLDR 151
           S +A +IL+  +++
Sbjct: 123 SASAVIILESYMEQ 136


>d1vhxa_ c.55.3.8 (A:) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]} Length = 140 Back     information, alignment and structure
>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} Length = 98 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target160 Holliday junction resolvase YqgF [Candidatus Liberibact
d1vhxa_140 Hypothetical protein YrrK (RuvX) {Bacillus subtilis [Ta 100.0
d1nu0a_138 Hypothetical protein YqgF (RuvX) {Escherichia coli [Tax 100.0
d1iv0a_98 Hypothetical protein, YqgF homologue {Thermus thermophi 99.97
d3bzka5149 Transcriptional accessory factor Tex {Pseudomonas aerug 98.49
d1hjra_158 RuvC resolvase {Escherichia coli [TaxId: 562]} 97.7
d1xc3a1118 Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1 96.01
d2gupa1114 Hypothetical protein SP2142 {Streptococcus pneumoniae [ 96.0
d2aa4a1119 N-acetylmannosamine kinase NanK {Escherichia coli [TaxI 95.7
d2ap1a2117 Putative regulator protein YcfX {Salmonella typhimurium 94.73
d1z6ra2129 Mlc protein {Escherichia coli [TaxId: 562]} 93.77
d1z05a3128 Transcriptional regulator VC2007 {Vibrio cholerae [TaxI 93.75
d1okja1106 Hypothetical protein YeaZ {Escherichia coli [TaxId: 562 93.38
d2hoea3128 N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 90.4
d1woqa1129 Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Art 90.14
d1q18a1110 Glucokinase Glk {Escherichia coli [TaxId: 562]} 94.46
d1sz2a1 319 Glucokinase Glk {Escherichia coli [TaxId: 562]} 94.28
d1huxa_ 259 Hydroxyglutaryl-CoA dehydratase component A {Acidaminoc 90.8
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escherichia 91.31
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bos tau 91.0
>d1vhxa_ c.55.3.8 (A:) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: Putative Holliday junction resolvase RuvX
domain: Hypothetical protein YrrK (RuvX)
species: Bacillus subtilis [TaxId: 1423]
Probab=100.00  E-value=2.6e-42  Score=273.94  Aligned_cols=138  Identities=36%  Similarity=0.554  Sum_probs=128.9

Q ss_pred             CCCEEEEECCCCEEEEEEEECCCCEECCCEEEECCCCC--HHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHH
Q ss_conf             98399998688768999630765110121011047741--5689899998651677589972135788888447999999
Q gi|254780976|r   16 NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVT--QTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAF   93 (160)
Q Consensus        16 ~~riLgiD~G~kriGiAisd~~~~~a~Pl~~i~~~~~~--~~~~~l~~ii~e~~i~~iVvGlP~~~~g~~~~~~~~v~~f   93 (160)
                      +.|+||||||+||||+|+||+.+.+|+|+.++.+++..  ..+.+|.+++++|+|+.||||+|++++|+++++++.++.|
T Consensus         1 ~mriLgiD~G~kriGvAisd~~~~~a~pl~~i~~~~~~~~~~~~~l~~ii~e~~i~~iViGlP~~~dg~~~~~~~~~~~f   80 (140)
T d1vhxa_           1 SLRILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGFPKNMNGTVGPRGEASQTF   80 (140)
T ss_dssp             CEEEEEEEECSSEEEEEEECTTSSSEEEEEEEECBGGGTBCCHHHHHHHHTTSEEEEEEEECCCCBTTBCCHHHHHHHHH
T ss_pred             CCEEEEEEECCCEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCHHHHHHHHHH
T ss_conf             95199998279989999945998822551668612566416899999999851656599835522478613677888999


Q ss_pred             HHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999840489977998367167999999998698644546437899899999999968645
Q gi|254780976|r   94 VHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISF  154 (160)
Q Consensus        94 ~~~L~~~~~~l~v~~~DEr~TS~~A~~~l~~~g~~~k~~k~~iD~~AA~iILq~~Ld~~~~  154 (160)
                      ++.|. +.+++||++|||||||++|++.+++.|++++++|+.+|++||++|||+|||++|.
T Consensus        81 ~~~l~-~~~~i~V~~~DEr~TS~~A~~~l~~~~~~~~~~k~~iD~~AA~iILe~~L~~~n~  140 (140)
T d1vhxa_          81 AKVLE-TTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVIDKMAAVMILQGYLDSLNE  140 (140)
T ss_dssp             HHHHH-HHHCSCEEEECCSSCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHC-CCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             99834-6778557984144379999999997699700034147799999999999997468



>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3bzka5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hjra_ c.55.3.6 (A:) RuvC resolvase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xc3a1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z6ra2 c.55.1.10 (A:82-210) Mlc protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z05a3 c.55.1.10 (A:81-208) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoea3 c.55.1.10 (A:72-199) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} Back     information, alignment and structure
>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sz2a1 c.55.1.7 (A:3-321) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 160 Holliday junction resolvase YqgF [Candidatus Liber
1nu0_A_138 (A:) Hypothetical protein YQGF; structural genomic 1e-30
1vhx_A_150 (A:) Putative holliday junction resolvase; structu 1e-23
3bzc_A_326-467142 (A:326-467) TEX; helix-turn-helix, helix-hairpin-h 1e-14
1iv0_A_98 (A:) Hypothetical protein; rnaseh-like, YQGF, stru 4e-21
>1nu0_A (A:) Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli}Length = 138 Back     alignment and structure
 Score =  126 bits (319), Expect = 1e-30
 Identities = 41/136 (30%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLXAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLN +G+E P     R F  N I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNXDGTEQPLTARARKFA-NRIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYXEQ 136


>1vhx_A (A:) Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis}Length = 150 Back     alignment and structure
>3bzc_A (A:326-467) TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa}Length = 142 Back     alignment and structure
>1iv0_A (A:) Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus}Length = 98 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target160 Holliday junction resolvase YqgF [Candidatus Liberibact
1nu0_A_138 Hypothetical protein YQGF; structural genomics, st 100.0
1vhx_A_150 Putative holliday junction resolvase; structural g 100.0
3bzc_A_326-467142 TEX; helix-turn-helix, helix-hairpin-helix, S1 dom 99.92
2hoe_A_86-211_358-380149 N-acetylglucosamine kinase; TM1224, structural gen 96.01
1iv0_A_98 Hypothetical protein; rnaseh-like, YQGF, structura 99.96
1hjr_A_158 Holliday junction resolvase (RUVC); site-specific 97.97
1sz2_A_1-122_314-332141 Glucokinase, glucose kinase; ATP-dependent, glucos 96.98
2gup_A_1-114_273-292134 ROK family protein; sugar kinase, APC80695, sucros 96.7
3eo3_A_1-144_315-333163 Bifunctional UDP-N-acetylglucosamine 2- epimerase/ 96.31
3lm2_A_1-9999 Putative kinase; structural genomics, joint center 96.08
2ch5_A_1-119_314-347153 NAGK protein; transferase, N-acetylglucosamine, gl 96.01
2e2o_A_1-105_275-299130 Hexokinase; acetate and sugar kinases, HSP70, acti 95.92
2ap1_A_1-128_313-327143 Putative regulator protein; zinc binding protein, 95.67
2kho_A_1-73_115-182_364-385163 Heat shock protein 70; molecular chaperone, HSP70, 95.23
3epq_A_1-120_276-302147 Putative fructokinase; SCRK, ADP binding, PSI2, MC 94.3
2aa4_A_1-119_275-289134 Mannac kinase, putative N-acetylmannosamine kinase 94.02
2qm1_A_1-131_308-326150 Glucokinase; alpha-beta structure, putative helix- 93.69
2q2r_A_1-154_358-373170 Glucokinase 1, putative; ATPase hexose kinase fami 93.36
1z6r_A_83-194112 MLC protein; transcriptional repressor, ROK family 92.4
1hux_A_1-95_239-270127 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 90.66
1jce_A_1-142_312-344175 ROD shape-determining protein MREB; MBL, actin, HS 93.52
1yuw_A_1-187_362-389215 Heat shock cognate 71 kDa protein; chaperone; 2.60 92.5
2v7y_A_1-156_333-359183 Chaperone protein DNAK; HSP70, heat shock protein, 90.93
1dkg_D_1-73_115-182_364-383161 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 91.85
>1nu0_A (A:) Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=3e-40  Score=263.84  Aligned_cols=136  Identities=29%  Similarity=0.385  Sum_probs=131.5

Q ss_pred             CCCEEEEECCCCEEEEEEEECCCCEECCCEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHH
Q ss_conf             98399998688768999630765110121011047741568989999865167758997213578888844799999999
Q gi|254780976|r   16 NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVH   95 (160)
Q Consensus        16 ~~riLgiD~G~kriGiAisd~~~~~a~Pl~~i~~~~~~~~~~~l~~ii~e~~i~~iVvGlP~~~~g~~~~~~~~v~~f~~   95 (160)
                      ++|+||||||+||||+|+||+.+.+|+|++++.+++..+.+..|..++++|+++.||||+|++++|+++++++.++.|++
T Consensus         2 ~krilgiD~G~kriGiAi~d~~~~ia~p~~~i~~~~~~~~~~~l~~li~~~~~~~iViGlP~~~~g~~~~~a~~v~~f~~   81 (138)
T 1nu0_A            2 SGTLXAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGLPLNXDGTEQPLTARARKFAN   81 (138)
T ss_dssp             CCEEEEEECCSSEEEEEEEETTTTEEEEEEEEEEETTEECHHHHHHHHHHHCCSEEEEEEEECTTSCBCHHHHHHHHHHH
T ss_pred             CCCEEEEEECCCEEEEEEECCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH
T ss_conf             97689999179979999947998740140789816772689999998642487389964434777875789999999999


Q ss_pred             HHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             998404899779983671679999999986986445464378998999999999686
Q gi|254780976|r   96 NMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRI  152 (160)
Q Consensus        96 ~L~~~~~~l~v~~~DEr~TS~~A~~~l~~~g~~~k~~k~~iD~~AA~iILq~~Ld~~  152 (160)
                      .|. +.+++||++||||+||++|++.+.+.+++++++++.+|++||++|||+|||+.
T Consensus        82 ~L~-~~~~l~v~~vDEr~TT~~A~~~l~~~~~~~~~~k~~iD~~AA~~ILq~~L~~~  137 (138)
T 1nu0_A           82 RIH-GRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGKVDSASAVIILESYXEQG  137 (138)
T ss_dssp             HHH-HHHCCCEEEEEEECCCCCC-------CCCCCCCHHHHTTHHHHHHHHHHHHTT
T ss_pred             HHH-HHHCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             999-86299969973664599999999973563210454364999999999999736



>1vhx_A (A:) Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} Back     alignment and structure
>3bzc_A (A:326-467) TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} Back     alignment and structure
>2hoe_A (A:86-211,A:358-380) N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics, JCSG; 2.46A {Thermotoga maritima} Back     alignment and structure
>1iv0_A (A:) Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} Back     alignment and structure
>1hjr_A (A:) Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} Back     alignment and structure
>1sz2_A (A:1-122,A:314-332) Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} Back     alignment and structure
>2gup_A (A:1-114,A:273-292) ROK family protein; sugar kinase, APC80695, sucrose, structural genomics, PSI, protein structure initiative; HET: SUC; 2.01A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>3eo3_A (A:1-144,A:315-333) Bifunctional UDP-N-acetylglucosamine 2- epimerase/N-acetylmannosamine kinase; non-protein kinase, sialic acid biosynthesis; 2.84A {Homo sapiens} Back     alignment and structure
>3lm2_A (A:1-99) Putative kinase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2, transferase; HET: MSE; 1.70A {Agrobacterium tumefaciens} Back     alignment and structure
>2ch5_A (A:1-119,A:314-347) NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, ribonuclease H fold, sugar kinase/HSP70/actin superfamily, domain rotation; HET: NAG NDG; 1.9A {Homo sapiens} Back     alignment and structure
>2e2o_A (A:1-105,A:275-299) Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuclease-H fold, sugar kinase, glucose, conformational change; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>2ap1_A (A:1-128,A:313-327) Putative regulator protein; zinc binding protein, structural genomics, PSI, protein structure initiative; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2kho_A (A:1-73,A:115-182,A:364-385) Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>2aa4_A (A:1-119,A:275-289) Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} Back     alignment and structure
>2qm1_A (A:1-131,A:308-326) Glucokinase; alpha-beta structure, putative helix-turn-helix, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis V583} Back     alignment and structure
>2q2r_A (A:1-154,A:358-373) Glucokinase 1, putative; ATPase hexose kinase family, transferase; HET: BGC ADP; 2.10A {Trypanosoma cruzi} Back     alignment and structure
>1z6r_A (A:83-194) MLC protein; transcriptional repressor, ROK family protein, DNA binding protein, helix-turn-helix, phosphotransferase system, metalloprotein; 2.70A {Escherichia coli} Back     alignment and structure
>1hux_A (A:1-95,A:239-270) Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} Back     alignment and structure
>1jce_A (A:1-142,A:312-344) ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} Back     alignment and structure
>1yuw_A (A:1-187,A:362-389) Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} Back     alignment and structure
>2v7y_A (A:1-156,A:333-359) Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1dkg_D (D:1-73,D:115-182,D:364-383) Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} Back     alignment and structure