254780977

254780977

putative glutamyl-tRNA(Gln) amidotransferase subunit C protein

GeneID in NCBI database:8209999Locus tag:CLIBASIA_04390
Protein GI in NCBI database:254780977Protein Accession:YP_003065390.1
Gene range:+(974262, 974549)Protein Length:95aa
Gene description:putative glutamyl-tRNA(Gln) amidotransferase subunit C protein
COG prediction:[J] Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
KEGG prediction:gatC; putative glutamyl-tRNA(Gln) amidotransferase subunit C protein; K02435 aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
SEED prediction:Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) or Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Glu and Gln;
tRNA aminoacylation, Asp and Asn
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE
ccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHccHHHcccEEEccEEcc
ccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHccccccccccccHHHHHHccccHccccEEccEEcc
MLIDVVDVKRIahfsrisikeeDIPLFLLRLNNTLSVLEKISevnvegvepmvsvvpmkmvhrpdvvcdgdkvesilsnaphveknffvvpkave
mlidvvdvkriahfsrisikeedipLFLLRLNNTLSVLEKIsevnvegvepMVSVVPMKMVHRPDVVCDGDKVESilsnaphveknffvvpkave
MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE
*LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE
MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE
*LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE
MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE
MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target95 putative glutamyl-tRNA(Gln) amidotransferase subunit C
254780377152 flagellar basal body P-ring biosynthesis protein F 0.031
>gi|254780377|ref|YP_003064790.1| flagellar basal body P-ring biosynthesis protein FlgA [Candidatus Liberibacter asiaticus str. psy62] Length = 152 Back     alignment
 Score = 28.1 bits (61), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 55  VVPMKMVHRPDVVCDGDKVESILSNA 80
           V+P+ ++HRP V+  G KV  IL+  
Sbjct: 81  VIPLSVLHRPYVISRGAKVRIILTQG 106

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target95 putative glutamyl-tRNA(Gln) amidotransferase subunit C
31512252195 putative glutamyl-tRNA(Gln) amidotransferase subunit C 1 1e-34
1596506495 putative glutamyl-tRNA(Gln) amidotransferase subunit C 1 6e-21
3993617495 aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhod 1 7e-21
15918470895 glutamyl-tRNA-Gln-amidotransferase chain C [Agrobacteri 1 2e-20
15039616695 aspartyl/glutamyl-tRNA amidotransferase subunit C [Sino 1 2e-20
32529267895 Glu-tRNA Gln amidotransferase subunit C [Agrobacterium 1 2e-20
31978369695 glutamyl-tRNA(Gln) amidotransferase subunit C [Mesorhiz 1 3e-20
22782166495 aspartyl/glutamyl-tRNA amidotransferase subunit C [Sino 1 3e-20
7746282195 aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhod 1 4e-20
20988492895 C subunit of glutamyl-tRNA(Gln) amidotransferase [Oligo 1 4e-20
>gi|315122521|ref|YP_004063010.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 95 Back     alignment and organism information
 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/95 (78%), Positives = 83/95 (87%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M++DVVDVKRIAH SRI I+EEDIPL L R N TLSVL KISEVNV+GVEPM SV+PMKM
Sbjct: 1  MVMDVVDVKRIAHLSRILIEEEDIPLLLSRFNQTLSVLNKISEVNVDGVEPMTSVLPMKM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V RPD+VCDG KV+SILSNAPHVE NFF+VPK VE
Sbjct: 61 VLRPDIVCDGGKVDSILSNAPHVENNFFLVPKIVE 95


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15965064|ref|NP_385417.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein [Sinorhizobium meliloti 1021] Length = 95 Back     alignment and organism information
>gi|39936174|ref|NP_948450.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhodopseudomonas palustris CGA009] Length = 95 Back     alignment and organism information
>gi|159184708|ref|NP_354324.2| glutamyl-tRNA-Gln-amidotransferase chain C [Agrobacterium tumefaciens str. C58] Length = 95 Back     alignment and organism information
>gi|150396166|ref|YP_001326633.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Sinorhizobium medicae WSM419] Length = 95 Back     alignment and organism information
>gi|325292678|ref|YP_004278542.1| Glu-tRNA Gln amidotransferase subunit C [Agrobacterium sp. H13-3] Length = 95 Back     alignment and organism information
>gi|319783696|ref|YP_004143172.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 95 Back     alignment and organism information
>gi|227821664|ref|YP_002825634.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Sinorhizobium fredii NGR234] Length = 95 Back     alignment and organism information
>gi|77462821|ref|YP_352325.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhodobacter sphaeroides 2.4.1] Length = 95 Back     alignment and organism information
>gi|209884928|ref|YP_002288785.1| C subunit of glutamyl-tRNA(Gln) amidotransferase [Oligotropha carboxidovorans OM5] Length = 95 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target95 putative glutamyl-tRNA(Gln) amidotransferase subunit C
PRK0003495 PRK00034, gatC, aspartyl/glutamyl-tRNA amidotransferase 5e-21
TIGR0013593 TIGR00135, gatC, glutamyl-tRNA(Gln) and/or aspartyl-tRN 2e-16
pfam0268672 pfam02686, Glu-tRNAGln, Glu-tRNAGln amidotransferase C 8e-14
KOG4247175 KOG4247, KOG4247, KOG4247, Mitochondrial DNA polymerase 0.001
pfam05443130 pfam05443, ROS_MUCR, ROS/MUCR transcriptional regulator 0.003
COG072196 COG0721, GatC, Asp-tRNAAsn/Glu-tRNAGln amidotransferase 7e-16
>gnl|CDD|178810 PRK00034, gatC, aspartyl/glutamyl-tRNA amidotransferase subunit C; Reviewed Back     alignment and domain information
>gnl|CDD|129241 TIGR00135, gatC, glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C subunit Back     alignment and domain information
>gnl|CDD|145703 pfam02686, Glu-tRNAGln, Glu-tRNAGln amidotransferase C subunit Back     alignment and domain information
>gnl|CDD|39448 KOG4247, KOG4247, KOG4247, Mitochondrial DNA polymerase accessory subunit [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|147562 pfam05443, ROS_MUCR, ROS/MUCR transcriptional regulator protein Back     alignment and domain information
>gnl|CDD|31065 COG0721, GatC, Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 95 putative glutamyl-tRNA(Gln) amidotransferase subunit C
PRK0003495 gatC aspartyl/glutamyl-tRNA amidotransferase subunit C; 99.97
COG072196 GatC Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit 99.96
TIGR0013593 gatC glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amido 99.9
pfam0268672 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit. Thi 99.83
PRK12821479 aspartyl/glutamyl-tRNA amidotransferase subunit C-like 99.5
PRK12820706 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl 99.45
KOG4247175 consensus 98.18
TIGR0182775 gatC_rel Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase, 97.91
>PRK00034 gatC aspartyl/glutamyl-tRNA amidotransferase subunit C; Reviewed Back     alignment and domain information
>COG0721 GatC Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00135 gatC glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C subunit; InterPro: IPR003837 Glu-tRNAGln amidotransferase is a heterotrimeric enzyme that is required for correct decoding of glutamine codons during translation Back     alignment and domain information
>pfam02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit Back     alignment and domain information
>PRK12821 aspartyl/glutamyl-tRNA amidotransferase subunit C-like protein; Provisional Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>KOG4247 consensus Back     alignment and domain information
>TIGR01827 gatC_rel Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase, subunit C, putative; InterPro: IPR010120 This entry represents a family related to GatC, the third subunit of an enzyme for completing the charging of tRNA(Gln) by amidating the Glu-tRNA(Gln) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target95 putative glutamyl-tRNA(Gln) amidotransferase subunit C
3h0l_C94 Structure Of Trna-Dependent Amidotransferase Gatcab 3e-21
2df4_C100 Structure Of Trna-Dependent Amidotransferase Gatcab 6e-20
3al0_C 592 Crystal Structure Of The Glutamine Transamidosome F 1e-17
3kfu_G92 Crystal Structure Of The Transamidosome Length = 92 1e-08
gi|254574885|pdb|3H0L|C Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab From Aquifex Aeolicus Length = 94 Back     alignment and structure
 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 1/94 (1%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          ++D   V +IA  +R+ +KEE+I +F  +L++ L  ++++ E++ E VEP +        
Sbjct: 1  MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEET-P 59

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R D        E  L NAP  +  FFVVP+ VE
Sbjct: 60 MREDEPHPSLDREKALMNAPERKDGFFVVPRVVE 93


gi|112490473|pdb|2DF4|C Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Mn2+ Length = 100 Back     alignment and structure
>gi|307776357|pdb|3AL0|C Chain C, Crystal Structure Of The Glutamine Transamidosome From Thermotoga Maritima In The Glutamylation State Length = 592 Back     alignment and structure
gi|304445802|pdb|3KFU|G Chain G, Crystal Structure Of The Transamidosome Length = 92 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target95 putative glutamyl-tRNA(Gln) amidotransferase subunit C
3ip4_C100 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subuni 2e-18
3h0l_C94 Glutamyl-tRNA(Gln) amidotransferase subunit C; multi pr 5e-17
3kfu_G92 Glutamyl-tRNA(Gln) amidotransferase subunit C; ASPRS, g 6e-16
>3ip4_C Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_C 2dqn_C* 2g5h_C 2g5i_C* 2f2a_C Length = 100 Back     alignment and structure
 Score = 86.0 bits (213), Expect = 2e-18
 Identities = 26/93 (27%), Positives = 41/93 (44%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          +   +V+ IA+ +R+ I  E+       L + L   ++    + EGVEP   V+ ++ V 
Sbjct: 4  VTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVL 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R D    G   E  L NA   E   F VP  + 
Sbjct: 64 REDKAIKGIPQELALKNAKETEDGQFKVPTIMN 96


>3h0l_C Glutamyl-tRNA(Gln) amidotransferase subunit C; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_C 3h0r_C* Length = 94 Back     alignment and structure
>3kfu_G Glutamyl-tRNA(Gln) amidotransferase subunit C; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} Length = 92 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target95 putative glutamyl-tRNA(Gln) amidotransferase subunit C
3ip4_C100 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subuni 99.97
3h0l_C94 Glutamyl-tRNA(Gln) amidotransferase subunit C; multi pr 99.97
3kfu_G92 Glutamyl-tRNA(Gln) amidotransferase subunit C; ASPRS, g 99.96
3al0_C 592 Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA 97.81
>3ip4_C Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_C 2dqn_C* 2g5h_C 2g5i_C* 2f2a_C Back     alignment and structure
Probab=99.97  E-value=5.1e-32  Score=194.40  Aligned_cols=95  Identities=28%  Similarity=0.396  Sum_probs=93.3

Q ss_pred             CC-CCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             98-88899999999852778899999999999999999999952354789852112224466778736899998999840
Q gi|254780977|r    1 ML-IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSN   79 (95)
Q Consensus         1 M~-i~~~~i~~la~LarL~l~eee~~~~~~~l~~il~~v~~l~~vdt~~vep~~~~~~~~~~lReD~~~~~~~~e~~l~n   79 (95)
                      |+ |++++|+|||+||||+|+++|++.++++|++||+||++|+++||+||+||+|+.+..++||+|++.++.+++++|+|
T Consensus         1 Ms~Is~e~i~~lA~LarL~l~eeE~~~~~~~l~~Il~~~~~L~~vdt~~vep~~~~~~~~~~lReD~~~~~~~~e~~l~n   80 (100)
T 3ip4_C            1 MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDKAIKGIPQELALKN   80 (100)
T ss_dssp             --CCCHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHHGGGGGSCCTTCCCCSCCSCCCCCCBCSCCCCCCCHHHHHTT
T ss_pred             CCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHC
T ss_conf             99799999999999817899999999999999999999999853565788977443233667989868999899999874


Q ss_pred             CHHHCCCEEECCEECC
Q ss_conf             8332075685350049
Q gi|254780977|r   80 APHVEKNFFVVPKAVE   95 (95)
Q Consensus        80 ap~~~~~yf~VPkViE   95 (95)
                      ||++++|||+||||||
T Consensus        81 AP~~~~~~f~VPkVie   96 (100)
T 3ip4_C           81 AKETEDGQFKVPTIMN   96 (100)
T ss_dssp             CSSEETTEEEEECC--
T ss_pred             CCHHCCCEEEECCCCC
T ss_conf             8540199577162648



>3h0l_C Glutamyl-tRNA(Gln) amidotransferase subunit C; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_C 3h0r_C* Back     alignment and structure
>3kfu_G Glutamyl-tRNA(Gln) amidotransferase subunit C; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} Back     alignment and structure
>3al0_C Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA synthetase 2; protein-RNA complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga maritima} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 95 putative glutamyl-tRNA(Gln) amidotransferase subunit C
d2f2ac192 a.137.12.1 (C:3-94) Glu-tRNAGln amidotransferase C subu 2e-18
>d2f2ac1 a.137.12.1 (C:3-94) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]} Length = 92 Back     information, alignment and structure

class: All alpha proteins
fold: Non-globular all-alpha subunits of globular proteins
superfamily: Glu-tRNAGln amidotransferase C subunit
family: Glu-tRNAGln amidotransferase C subunit
domain: Glu-tRNAGln amidotransferase C subunit, GatC
species: Staphylococcus aureus [TaxId: 1280]
 Score = 84.4 bits (209), Expect = 2e-18
 Identities = 26/90 (28%), Positives = 40/90 (44%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          +   +V+ IA+ +R+ I  E+       L + L   ++    + EGVEP   V+ ++ V 
Sbjct: 2  VTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVL 61

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D    G   E  L NA   E   F VP 
Sbjct: 62 REDKAIKGIPQELALKNAKETEDGQFKVPT 91


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target95 putative glutamyl-tRNA(Gln) amidotransferase subunit C
d2f2ac192 Glu-tRNAGln amidotransferase C subunit, GatC {Staphyloc 99.96
>d2f2ac1 a.137.12.1 (C:3-94) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: All alpha proteins
fold: Non-globular all-alpha subunits of globular proteins
superfamily: Glu-tRNAGln amidotransferase C subunit
family: Glu-tRNAGln amidotransferase C subunit
domain: Glu-tRNAGln amidotransferase C subunit, GatC
species: Staphylococcus aureus [TaxId: 1280]
Probab=99.96  E-value=1.4e-30  Score=185.30  Aligned_cols=92  Identities=28%  Similarity=0.381  Sum_probs=90.7

Q ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCH
Q ss_conf             88889999999985277889999999999999999999995235478985211222446677873689999899984083
Q gi|254780977|r    2 LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAP   81 (95)
Q Consensus         2 ~i~~~~i~~la~LarL~l~eee~~~~~~~l~~il~~v~~l~~vdt~~vep~~~~~~~~~~lReD~~~~~~~~e~~l~nap   81 (95)
                      +|++++|+|||+||||+|+++|++.++++|++||+||++|+++||+||+||+||.+..++||+|++.++.+++++|+|||
T Consensus         1 KIs~e~i~~lA~LarL~l~deE~~~~~~~l~~Il~~~~~L~~vDt~~vep~~~~~~~~~~lReD~~~~~~~~~~~l~naP   80 (92)
T d2f2ac1           1 KVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDKAIKGIPQELALKNAK   80 (92)
T ss_dssp             CCCHHHHHHHHHHTTCCCCTTHHHHHHHHHHHHHHHHGGGGGSCCTTCCCCSCSSCCCCCCBCCCCCCCCCHHHHHTTCS
T ss_pred             CCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCC
T ss_conf             97999999999980679999999999999999999999983477678898754334456797986899989999987387


Q ss_pred             HHCCCEEECCEE
Q ss_conf             320756853500
Q gi|254780977|r   82 HVEKNFFVVPKA   93 (95)
Q Consensus        82 ~~~~~yf~VPkV   93 (95)
                      ++++|||+||||
T Consensus        81 ~~~~~~f~VPkV   92 (92)
T d2f2ac1          81 ETEDGQFKVPTI   92 (92)
T ss_dssp             SEETTEEEEECC
T ss_pred             CCCCCEEECCCC
T ss_conf             223994655889



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 95 putative glutamyl-tRNA(Gln) amidotransferase subun
3ip4_C_100 (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfer 3e-19
3h0l_C_94 (C:) Glutamyl-tRNA(Gln) amidotransferase subunit C 4e-18
>3ip4_C (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_C 2dqn_C* 2g5h_C 2g5i_C* 2f2a_CLength = 100 Back     alignment and structure
 Score = 88.3 bits (219), Expect = 3e-19
 Identities = 26/93 (27%), Positives = 41/93 (44%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          +   +V+ IA+ +R+ I  E+       L + L   ++    + EGVEP   V+ ++ V 
Sbjct: 4  VTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVL 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R D    G   E  L NA   E   F VP  + 
Sbjct: 64 REDKAIKGIPQELALKNAKETEDGQFKVPTIMN 96


>3h0l_C (C:) Glutamyl-tRNA(Gln) amidotransferase subunit C; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_C 3h0r_C*Length = 94 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target95 putative glutamyl-tRNA(Gln) amidotransferase subunit C
3ip4_C_100 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase s 99.97
3h0l_C_94 Glutamyl-tRNA(Gln) amidotransferase subunit C; mul 99.96
>3ip4_C (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_C 2dqn_C* 2g5h_C 2g5i_C* 2f2a_C Back     alignment and structure
Probab=99.97  E-value=2e-30  Score=186.56  Aligned_cols=94  Identities=28%  Similarity=0.382  Sum_probs=92.6

Q ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCH
Q ss_conf             88889999999985277889999999999999999999995235478985211222446677873689999899984083
Q gi|254780977|r    2 LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAP   81 (95)
Q Consensus         2 ~i~~~~i~~la~LarL~l~eee~~~~~~~l~~il~~v~~l~~vdt~~vep~~~~~~~~~~lReD~~~~~~~~e~~l~nap   81 (95)
                      +|++++|+|||+||||+|+++|+++++++|++|+.|+++|++|||+||+||+|+.+..++||+|++.++.+++.+|+|||
T Consensus         3 ~i~~e~i~~la~LarL~l~eee~~~~~~~l~~il~~~~~L~evdt~~Vep~~~~~~~~~~lReD~~~~~~~~e~il~nap   82 (100)
T 3ip4_C            3 KVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDKAIKGIPQELALKNAK   82 (100)
T ss_dssp             CCCHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHHGGGGGSCCTTCCCCSCCSCCCCCCBCSCCCCCCCHHHHHTTCS
T ss_pred             CCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCC
T ss_conf             79999999999982789999999999999999999999983477678887643222356787986899989999987286


Q ss_pred             HHCCCEEECCEECC
Q ss_conf             32075685350049
Q gi|254780977|r   82 HVEKNFFVVPKAVE   95 (95)
Q Consensus        82 ~~~~~yf~VPkViE   95 (95)
                      ++++|||+||||||
T Consensus        83 ~~~~~yf~VPkVie   96 (100)
T 3ip4_C           83 ETEDGQFKVPTIMN   96 (100)
T ss_dssp             SEETTEEEEECC--
T ss_pred             CCCCCEEEECCCCC
T ss_conf             31299377061648



>3h0l_C (C:) Glutamyl-tRNA(Gln) amidotransferase subunit C; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_C 3h0r_C* Back     alignment and structure