254780987

254780987

hypothetical protein CLIBASIA_04440

GeneID in NCBI database:8210009Locus tag:CLIBASIA_04440
Protein GI in NCBI database:254780987Protein Accession:YP_003065400.1
Gene range:-(983468, 983800)Protein Length:110aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR
cccccccHHHHHcccccccccccccHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEccccHHHHHcHHHcccc
cccEccHHHHHcccccccccccccccHHHHHHHccccHHHHHHHHHHHHccHHHcccccccccEEcccccccccEEEccccccccccEEEEEEccccHHHHccHHccccc
MESVLGVnvlqdinlptpnnlpyytptqlgkklatkpsaIKVNKKLREWGFLLeehesgrkrdvltpkgakgggryfdtgkkrsdgtivqqikwhppiveslapefggvr
MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFlleehesgrkrdvltpkgakgggryfdtgkkrsdgtivqqikwhppiveslapefggvr
MESVLGVNVLQDInlptpnnlpyytptQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR
**SVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESG*KRDVLTPKGAKGGGRYFDTG***********IKWHPPIVESLAPEFG***
MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR
**SVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEF****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR
MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR
MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target110 hypothetical protein CLIBASIA_04440 [Candidatus Liberib
254780125262 prophage antirepressor [Candidatus Liberibacter as 2e-06
254780191 898 alanyl-tRNA synthetase [Candidatus Liberibacter as 0.015
>gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 42.7 bits (99), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 4   VLGVNVLQDIN---LPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR 60
           + GV+ L+ ++   LP+ +N  Y T TQ+G++L     A  +NK L + G  + +   G 
Sbjct: 154 ITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGY 213

Query: 61  KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESL 102
           +    TPKG + GG+  D   +  +G+  QQ+KW+  ++ S 
Sbjct: 214 RP---TPKGEERGGKMCDVPMQHVEGS-TQQLKWNSNLLVSF 251

>gi|254780191|ref|YP_003064604.1| alanyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 898 Back     alignment
 Score = 29.6 bits (65), Expect = 0.015,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 44  KKLREWGFLLEEHESGRKRDVL---TPKGAKGGGRYFDTGKKRSDGTIVQ 90
           K + + G ++EE  SG+K +V+   TP  A+ GG+  DTG    DG  +Q
Sbjct: 493 KAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQ 542

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target110 hypothetical protein CLIBASIA_04440 [Candidatus Liberib
315122913261 prophage antirepressor [Candidatus Liberibacter solanac 1 3e-24
315121946262 prophage antirepressor [Candidatus Liberibacter solanac 1 5e-24
70731106268 Sb46 [Pseudomonas fluorescens Pf-5] Length = 268 1 1e-04
255957559100 hypothetical protein [Candidatus Liberibacter asiaticus 1 0.003
168495146325 hypothetical protein APCd_gp43 [Azospirillum phage Cd] 2 4e-11
299530348255 hypothetical protein CTS44_06218 [Comamonas testosteron 2 9e-08
315122933264 prophage antirepressor [Candidatus Liberibacter solanac 2 1e-07
315121965263 prophage antirepressor [Candidatus Liberibacter solanac 2 1e-06
254780125262 prophage antirepressor [Candidatus Liberibacter asiatic 2 1e-06
255957589100 hypothetical protein [Candidatus Liberibacter asiaticus 2 1e-05
>gi|315122913|ref|YP_004063402.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 261 Back     alignment and organism information
 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 75/103 (72%), Gaps = 1/103 (0%)

Query: 1   MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHE-SG 59
           MESVLGVN    +++PTPNN  YYT T LG++L  K S  ++NK+L   GFLL EHE SG
Sbjct: 155 MESVLGVNPANTLDIPTPNNSQYYTATALGEQLPVKLSGREINKRLVRLGFLLVEHEPSG 214

Query: 60  RKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESL 102
           ++R++LT KG + GGR FD+GKK SDG+IVQ IKW   I++ L
Sbjct: 215 KRRNILTTKGKELGGRVFDSGKKHSDGSIVQSIKWQENILDIL 257


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315121946|ref|YP_004062435.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Back     alignment and organism information
>gi|70731106|ref|YP_260847.1| Sb46 [Pseudomonas fluorescens Pf-5] Length = 268 Back     alignment and organism information
>gi|255957559|dbj|BAH96620.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 100 Back     alignment and organism information
>gi|168495146|ref|YP_001686884.1| hypothetical protein APCd_gp43 [Azospirillum phage Cd] Length = 325 Back     alignment and organism information
>gi|299530348|ref|ZP_07043773.1| hypothetical protein CTS44_06218 [Comamonas testosteroni S44] Length = 255 Back     alignment and organism information
>gi|315122933|ref|YP_004063422.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 264 Back     alignment and organism information
>gi|315121965|ref|YP_004062454.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 263 Back     alignment and organism information
>gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment and organism information
>gi|255957589|dbj|BAH96644.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 100 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 110 hypothetical protein CLIBASIA_04440 [Candidatus Liberib
pfam03374112 ANT Phage antirepressor protein KilAC domain. This doma 96.28
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory elem 90.59
PRK03902142 manganese transport transcriptional regulator; Provisio 90.32
>pfam03374 ANT Phage antirepressor protein KilAC domain Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target110 hypothetical protein CLIBASIA_04440 [Candidatus Liberib
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-helix, 92.29
2h09_A155 Transcriptional regulator MNTR; transcription regulator 90.51
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
Probab=92.29  E-value=0.16  Score=28.23  Aligned_cols=57  Identities=21%  Similarity=0.214  Sum_probs=43.4

Q ss_pred             CCCCCHHHHHHHHCCCCCHHHHHH---HHHHCCCCHHHCCCCCCCEEECHHHHHHHHHHHHCC
Q ss_conf             765189999998777889899999---999879812202577532011611356445642010
Q gi|254780987|r   21 LPYYTPTQLGKKLATKPSAIKVNK---KLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTG   80 (110)
Q Consensus        21 ~~~ltPTqlGk~lg~k~SA~~vN~---lL~~~GlQ~~~~~~grkew~lT~~G~k~g~~~~dt~   80 (110)
                      .+..+|.+|.+.+|-..|...|..   .|.+.||-.   +.++-.|++|++|+.|-.--.|..
T Consensus        25 ~g~~t~~eIA~~lgi~~S~~~Vs~rl~~L~~~GLve---~~g~G~Y~iT~~G~~yL~gelDa~   84 (111)
T 3b73_A           25 EGNGSPKELEDRDEIRISKSSVSRRLKKLADHDLLQ---PLANGVYVITEEGEAYLNGEYDAG   84 (111)
T ss_dssp             HSCBCHHHHHTSTTCCSCHHHHHHHHHHHHHTTSEE---ECSTTCEEECHHHHHHHTTCEETT
T ss_pred             CCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHCCCEE---ECCCCCEEECHHHHHHHHHHHCCC
T ss_conf             499999999998688847999999999998787956---668700798966899998775226



>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target110 hypothetical protein CLIBASIA_04440 [Candidatus Liberib
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acidophil 92.48
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: MarR-like transcriptional regulators
domain: Ta1064 (RFK), N-terminal domain
species: Thermoplasma acidophilum [TaxId: 2303]
Probab=92.48  E-value=0.042  Score=30.09  Aligned_cols=62  Identities=19%  Similarity=0.202  Sum_probs=44.0

Q ss_pred             CCCCCCCCCCHHHHHHHHCCCCCHHHHHH---HHHHCCCCHHHCCCCCCCEEECHHHHHHHHHHHHC
Q ss_conf             88765765189999998777889899999---99987981220257753201161135644564201
Q gi|254780987|r   16 PTPNNLPYYTPTQLGKKLATKPSAIKVNK---KLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDT   79 (110)
Q Consensus        16 P~~~~~~~ltPTqlGk~lg~k~SA~~vN~---lL~~~GlQ~~~~~~grkew~lT~~G~k~g~~~~dt   79 (110)
                      +.-.+.+.+|+++|+++++  +|.-.|.+   .|.+.||-............+|++|+.....+...
T Consensus        14 ~~~~~~~~lt~~eLa~~l~--i~~~~vs~~l~~Le~~GlV~r~~D~R~~~i~LT~~G~~~l~~~~~~   78 (85)
T d3ctaa1          14 AEASNRAYLTSSKLADMLG--ISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFAD   78 (85)
T ss_dssp             TTTSSEEECCHHHHHHHHT--SCHHHHHHHHHHHHHTTSEEEEEETTEEEEEECHHHHHHHHHHHHH
T ss_pred             HHCCCCCCCCHHHHHHHHC--CCHHHHHHHHHHHHHCCCEEEECCCCCCCCEECHHHHHHHHHHHHH
T ss_conf             6015899988999999988--7887899999999987980431245543000789999999999999



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target110 hypothetical protein CLIBASIA_04440 [Candidatus Liberib
3b73_A_111 PHIH1 repressor-like protein; winged-helix-turn-he 92.73
3hrs_A_1-138138 Metalloregulator SCAR; DTXR/MNTR family member, tr 91.09
3cta_A_1-9191 Riboflavin kinase; structural genomics, transferas 91.05
>3b73_A (A:) PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
Probab=92.73  E-value=0.16  Score=29.04  Aligned_cols=58  Identities=21%  Similarity=0.232  Sum_probs=44.8

Q ss_pred             CCCCCCHHHHHHHHCCCCCHHHHHH---HHHHCCCCHHHCCCCCCCEEECHHHHHHHHHHHHCC
Q ss_conf             5765189999998777889899999---999879812202577532011611356445642010
Q gi|254780987|r   20 NLPYYTPTQLGKKLATKPSAIKVNK---KLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTG   80 (110)
Q Consensus        20 ~~~~ltPTqlGk~lg~k~SA~~vN~---lL~~~GlQ~~~~~~grkew~lT~~G~k~g~~~~dt~   80 (110)
                      +.+..+|.+|.+.+|-..|..+|.+   .|.+.||-   -+.++..|++|++|.++-.-+.+.-
T Consensus        24 ~~g~~s~~eIA~~lgi~~S~~~Vs~~l~~L~~~GLv---e~~~~g~Y~lT~~G~~~L~~~lda~   84 (111)
T 3b73_A           24 EEGNGSPKELEDRDEIRISKSSVSRRLKKLADHDLL---QPLANGVYVITEEGEAYLNGEYDAG   84 (111)
T ss_dssp             HHSCBCHHHHHTSTTCCSCHHHHHHHHHHHHHTTSE---EECSTTCEEECHHHHHHHTTCEETT
T ss_pred             HCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHHCCCC---CCCCCCCEEECHHHHHHHHCCCCCC
T ss_conf             737888889886136683388999999999977875---5379970671770899973410212



>3hrs_A (A:1-138) Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>3cta_A (A:1-91) Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure