254780988

254780988

hypothetical protein CLIBASIA_04445

GeneID in NCBI database:8210010Locus tag:CLIBASIA_04445
Protein GI in NCBI database:254780988Protein Accession:YP_003065401.1
Gene range:+(984460, 984915)Protein Length:151aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MISFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRKGV
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHcHcHHHHHHHHHHHHHHHHHHHHcccc
MISFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGvekgyltkdpltllapFTQDIIACILGFWFTDTIVQRRKGV
misfltgsiarfFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRKGV
MISFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRKGV
**SFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQ*TTQVDLKALESETPVRLARL*********ERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRR***
MISFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRKGV
*ISFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRK**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
hhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxx
oooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRKGV
MISFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRKGV
MISFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRKGV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target151 hypothetical protein CLIBASIA_04445 [Candidatus Liberib
254781199157 hypothetical protein CLIBASIA_05530 [Candidatus Li 6e-42
>gi|254781199|ref|YP_003065612.1| hypothetical protein CLIBASIA_05530 [Candidatus Liberibacter asiaticus str. psy62] Length = 157 Back     alignment
 Score =  160 bits (406), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 114/158 (72%), Gaps = 15/158 (9%)

Query: 3   SFLTGSIARFFIKFVPSLF----NLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALE 58
           SFL G + RF ++F+PS F    +++ EY+ K++SIE+D+L+LE+AK  S+TQ+DL  ++
Sbjct: 4   SFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIK 63

Query: 59  S-------ETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGV 111
           +       + P+RLAR++ Q    + +   K +  F ALIRP TT FWII+YPLL+WW V
Sbjct: 64  AGIEELKIDKPIRLARIEAQ----KVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSV 119

Query: 112 EKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRK 149
           ++G    DPLTLL+PFTQ+IIACILGFW+TD IVQ++K
Sbjct: 120 KEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK 157

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target151 hypothetical protein CLIBASIA_04445 [Candidatus Liberib
254781199157 hypothetical protein CLIBASIA_05530 [Candidatus Liberib 1 4e-38
317120705158 hypothetical protein SC2_gp005 [Liberibacter phage SC2] 1 1e-37
315121924158 hypothetical protein CKC_00870 [Candidatus Liberibacter 1 3e-37
315122886158 hypothetical protein CKC_05710 [Candidatus Liberibacter 1 3e-36
317120748157 hypothetical protein SC2_gp250 [Liberibacter phage SC2] 1 4e-36
315122566130 hypothetical protein CKC_04090 [Candidatus Liberibacter 1 1e-27
315122344125 hypothetical protein CKC_02980 [Candidatus Liberibacter 1 8e-26
315122770124 hypothetical protein CKC_05125 [Candidatus Liberibacter 1 3e-21
315122303115 hypothetical protein CKC_02775 [Candidatus Liberibacter 1 2e-09
31512232340 hypothetical protein CKC_02875 [Candidatus Liberibacter 1 5e-07
>gi|254781199|ref|YP_003065612.1| hypothetical protein CLIBASIA_05530 [Candidatus Liberibacter asiaticus str. psy62] Length = 157 Back     alignment and organism information
 Score =  160 bits (406), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 114/158 (72%), Gaps = 15/158 (9%)

Query: 3   SFLTGSIARFFIKFVPSLF----NLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALE 58
           SFL G + RF ++F+PS F    +++ EY+ K++SIE+D+L+LE+AK  S+TQ+DL  ++
Sbjct: 4   SFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIK 63

Query: 59  S-------ETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGV 111
           +       + P+RLAR++ Q    + +   K +  F ALIRP TT FWII+YPLL+WW V
Sbjct: 64  AGIEELKIDKPIRLARIEAQ----KVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSV 119

Query: 112 EKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRK 149
           ++G    DPLTLL+PFTQ+IIACILGFW+TD IVQ++K
Sbjct: 120 KEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK 157


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|317120705|gb|ADV02527.1| hypothetical protein SC2_gp005 [Liberibacter phage SC2] Length = 158 Back     alignment and organism information
>gi|315121924|ref|YP_004062413.1| hypothetical protein CKC_00870 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 158 Back     alignment and organism information
>gi|315122886|ref|YP_004063375.1| hypothetical protein CKC_05710 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 158 Back     alignment and organism information
>gi|317120748|gb|ADV02570.1| hypothetical protein SC2_gp250 [Liberibacter phage SC2] Length = 157 Back     alignment and organism information
>gi|315122566|ref|YP_004063055.1| hypothetical protein CKC_04090 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 130 Back     alignment and organism information
>gi|315122344|ref|YP_004062833.1| hypothetical protein CKC_02980 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 125 Back     alignment and organism information
>gi|315122770|ref|YP_004063259.1| hypothetical protein CKC_05125 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 124 Back     alignment and organism information
>gi|315122303|ref|YP_004062792.1| hypothetical protein CKC_02775 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 115 Back     alignment and organism information
>gi|315122323|ref|YP_004062812.1| hypothetical protein CKC_02875 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 40 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00