254780991

254780991

excinuclease ABC subunit B

GeneID in NCBI database:8210013Locus tag:CLIBASIA_04460
Protein GI in NCBI database:254780991Protein Accession:YP_003065404.1
Gene range:-(986465, 988882)Protein Length:805aa
Gene description:excinuclease ABC subunit B
COG prediction:[L] Helicase subunit of the DNA excision repair complex
KEGG prediction:uvrB; excinuclease ABC subunit B; K03702 excinuclease ABC subunit B
SEED prediction:Excinuclease ABC subunit B
Pathway involved in KEGG:Nucleotide excision repair [PATH:las03420]
Subsystem involved in SEED:DNA repair, UvrABC system
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-----
MPKKTRSFPKKDSRIQSISTRVDDLDYFSFEEKQLEVDKTMVADAMRRIRSEAGKHRKNAAKRMLIHQRENTASKGEFQSQSSISMSEKQTREISEQTMTPSVQALARLIQSDNPLLKNGKIWTPHRSWSINNHSKDITFFQMQTDYHPSGDQPAAIAQLLKGIHSREKVQLLLGVTGSGKTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVSYYDYYQPEAYVPRTDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMIVQLKIGDSVEQKELLSSLVKQQYKRQDIGIIRGTFRVCGDSIEIFPSHLEDVAWRVSMFGNDIEEISEFYPLTGQKIRNVETIKIYANSHYVTPRPTLNTAMKYIKEELKMRLIELEKEGRLLEAQRLEQRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYIPEDSLLFVDESHVTIPQISGMYRGDFHRKATLAEYGFRLPSCMDNRPLRFEEWNCLRPTTIVVSATPGSWELEQCQGIIVEQIIRPTGLVDPPVEIRSARTQVEDVYDEINLAAQQGLRILLTVLTKRMAEDLTEYLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSKTSLIQTIGRAARNVNSKVILYADTITKSIQLAIDETTRRREKQLEHNKKHNINPQSVKEKIMEVIDPILLEDAATTNISIDAQQLSLSKKKGKAHLKSLRKQMHLAADNLNFEEAARIRDEIKRLKSSPYFQGLDDS
cccccccccccccEEccccEEEEEHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccccHHHHHHHHHHHccccccccccHHHcccccHHHHHHHHHHHHccccccccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHcccccEEEEccHHHHcccccHHHHHHcEEEEEccccccHHHHHHHHHHcccEEccccccccEEEEEccEEEEEccccccccEEEEcccccEEHHEEEEcccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccccccHHHHHcccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHccccccccccEEEEcHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHcccccEEEEEcHHHcccccccccEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
cccccccccccccccccccccccccccccEcccEEEEEEccccccHHHHHccccccccccHHHHcccccccccccccccccccccccHcHHHcccccccEEEEccccccccccccHHcccccccccccccccccccccccEEEEcccccccccHHHHHHHHHcHHcccccEEEccccccccHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHcccccEEEEEEEHcccccccccccccccEEccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccHHHHHHHEEEccccccccHHHHHHHHHHHHHccccccccccEEEEEccEEEEEcccccccEEEEEEccccHHHHEEcccccccEcccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHcHHHHHHHccccccHHHHHHccccccccccccHHHcccccEEEEEEccccEcccccccccccHHHHHHHHHcccccccccccccccHHHHHHHcccEEEEEcccccccEccccccEEEEEEcccccccccEEEEccHHHHHHHHHHHHHHHHHcccEEEHHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHccHHHEEHHHHHHHcccccccEEEEEEEccccccccccHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHcccccHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccc
mpkktrsfpkkdsriqsistrvddldyfsfEEKQLEVDKTMVADAMRRIRSEAGKHRKNAAKRMLIHQrentaskgefqsqssismsEKQTREISEQTMTPSVQALARLIQsdnpllkngkiwtphrswsinnhskditffqmqtdyhpsgdqPAAIAQLLKGIHSREKVQLLLGVTGSGKTFTMAKVIEAMqrpaivmaPNKILAAQLYSEFknffphnaVEYFVSYydyyqpeayvprtdtyiekesSINEQIDRMRHSATRSLlerndcivvsSVSCIYGIGSVESYSQMIVQLKIGDSVEQKELLSSLVKQQYKRQDIGIIRGTFRVCGDSIEIFPSHLEDVAWRVSMFGndieeisefypltgqkirnVETIKIYAnshyvtprptlNTAMKYIKEELKMRLIELEKEGRLLEAQRLEQRITYDLEMLettgscqsienysryltgrnpgeppptlfeyipedsllfvdeshvtipqisgmyrgdfhrKATLAEygfrlpscmdnrplrfeewnclrpttivvsatpgsweleqCQGIIVEqiirptglvdppveirsartqVEDVYDEINLAAQQGLRILLTVLTKRMAEDLTEYLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLregldipecgLVAILDADKEGFLRSKTSLIQTIGRAARNVNSKVILYADTITKSIQLAIDETTRRREKQLEHnkkhninpqsvKEKIMEVIDpilledaattnisidAQQLSLSKKKGKAHLKSLRKQMHLAADNLNFEEAARIRDEIKrlksspyfqgldds
mpkktrsfpkkdsriqsistrvddldyfsfeekqlevdktmVADAMRRIRseagkhrknaAKRMLIhqrentaskgefqsqssiSMSEKQTREISEQTMTPSVQALARLIQSDNPLLKNGKIWTPHRSWSINNHSKDITFFQMQTDYHPSGDQPAAIAQLLKGIHSREKVQLLLGVTGSGKTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVSYYDYYQPEAYVPRTDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMIVQLKIGDSVEQKELLSSLVKqqykrqdigiIRGTFRVCGDSIEIFPSHLEDVAWRVSMFGNDIEEISEfypltgqkiRNVETIKIYanshyvtprptlnTAMKYIKEELKMRLIELEKEGRLLEAQRLEQRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYIPEDSLLFVDESHVTIpqisgmyrgDFHRKATLAEYGFRLPSCMDNRPLRFEEWNCLRPTTIVVSATPGSWELEQCQGIIVEQIirptglvdppVEIRSARTQVEDVYDEINLAAQQGLRILLTVLTKRMAEDLTEYlyernirvrymhsevktlerieiirdlrlgKFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSKTSLIQTigraarnvnskviLYADTITKSIQLAIDETTRRREKQlehnkkhninpqsvkeKIMEVIDPILLEDAATTNISIDAQQLSLSKKKGKAHLKSLRKQMHLAADNLNFEEAARIRDEIkrlksspyfqgldds
MPKKTRSFPKKDSRIQSISTRVDDLDYFSFEEKQLEVDKTMVADAMRRIRSEAGKHRKNAAKRMLIHQRENTASKGEFQSQSSISMSEKQTREISEQTMTPSVQALARLIQSDNPLLKNGKIWTPHRSWSINNHSKDITFFQMQTDYHPSGDQPAAIAQLLKGIHSREKVQLLLGVTGSGKTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVSYYDYYQPEAYVPRTDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMIVQLKIGDSVEQKELLSSLVKQQYKRQDIGIIRGTFRVCGDSIEIFPSHLEDVAWRVSMFGNDIEEISEFYPLTGQKIRNVETIKIYANSHYVTPRPTLNTAMKYIKEELKMRLIELEKEGRLLEAQRLEQRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYIPEDSLLFVDESHVTIPQISGMYRGDFHRKATLAEYGFRLPSCMDNRPLRFEEWNCLRPTTIVVSATPGSWELEQCQGIIVEQIIRPTGLVDPPVEIRSARTQVEDVYDEINLAAQQGLRILLTVLTKRMAEDLTEYLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSKTSLIQTIGRAARNVNSKVILYADTITKSIQLAIDETTRRREKQLEHNKKHNINPQSVKEKIMEVIDPILLEDAATTNISIDAQQLSLSKKKGKAHLKSLRKQMHLAADNLNFEEAARIRDEIKRLKSSPYFQGLDDS
**********************************************************************************************************ARLIQ*********************************TDYHPSGDQPAAIAQLLKGIHSREKVQLLLGVTGSGKTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVSYYDYYQPEAYVPRTDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMIVQLKIGDSVEQKELLSSLVKQQYKRQDIGIIRGTFRVCGDSIEIFPSHLEDVAWRVSMFGNDIEEISEFYPLTGQKIRNVETIKIYANSHYVTPRPTLNTAMKYIKEELKMRLIELEKEGRLLEAQRLEQRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYIPEDSLLFVDESHVTIPQISGMYRGDFHRKATLAEYGFRLPSCMDNRPLRFEEWNCLRPTTIVVSATPGSWELEQCQGIIVEQIIRPTGLVDPPVEIRSARTQVEDVYDEINLAAQQGLRILLTVLTKRMAEDLTEYLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSKTSLIQTIGRAARNVNSKVILYADTITKSIQLAIDETTRRREKQLEHNKKHNINPQSVKEKIMEVIDP*****************************KSLRKQMHLAADNLNFEEAARIRDEIKRLKSS**F******
**************IQSISTRVDDLDYFSFEEKQLEVDKTMVADAMRRIRSEAGKHRKNAAKRMLIHQREN***************************MTPSVQALARLIQSDNPLLKNGKIWTPHRSWSINNHSKDITFFQMQTDYHPSGDQPAAIAQLLKGIHSREKVQLLLGVTGSGKTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVSYYDYYQPEAYVPRTDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMIVQLKIGDSVEQKELLSSLVKQQYKRQDIGIIRGTFRVCGDSIEIFPSHLEDVAWRVSMFGNDIEEISEFYPLTGQKIRNVETIKIYANSHYVTPRPTLNTAMKYIKEELKMRLIELEKEGRLLEAQRLEQRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYIPEDSLLFVDESHVTIPQISGMYRGDFHRKATLAEYGFRLPSCMDNRPLRFEEWNCLRPTTIVVSATPGSWELEQCQGIIVEQIIRPTGLVDPPVEIRSARTQVEDVYDEINLAAQQGLRILLTVLTKRMAEDLTEYLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSKTSLIQTIGRAARNVNSKVILYADTITKSIQLAIDETTRRREKQLEHNKKHNINPQSVKEKIMEVIDPILLEDAATTNISIDAQQLS************LRKQMHLAADNLNFEEAARIRDEIKRLKSSPYFQGLDDS
************S*IQSISTRVDDLDYFSFEEKQLEVDKTMVADAMRRIRSEAGKHRKNAAKRMLIHQRENTASKGEFQSQSSISMSEKQTREISEQTMTPSVQALARLIQSDNPLLKNGKIWTPHRSWSINNHSKDITFFQMQTDYHPSGDQPAAIAQLLKGIHSREKVQLLLGVTGSGKTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVSYYDYYQPEAYVPRTDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMIVQLKIGDSVEQKELLSSLVKQQYKRQDIGIIRGTFRVCGDSIEIFPSHLEDVAWRVSMFGNDIEEISEFYPLTGQKIRNVETIKIYANSHYVTPRPTLNTAMKYIKEELKMRLIELEKEGRLLEAQRLEQRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYIPEDSLLFVDESHVTIPQISGMYRGDFHRKATLAEYGFRLPSCMDNRPLRFEEWNCLRPTTIVVSATPGSWELEQCQGIIVEQIIRPTGLVDPPVEIRSARTQVEDVYDEINLAAQQGLRILLTVLTKRMAEDLTEYLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSKTSLIQTIGRAARNVNSKVILYADTITKSIQLAIDETTRRREKQLEHNKKHNINPQSVKEKIMEVIDPILLEDAATTN*SIDAQQLSLSKKKGKAHLKSLRKQMHLAADNLNFEEAARIRDEIKRLKSSPYFQ*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKKTRSFPKKDSRIQSISTRVDDLDYFSFEEKQLEVDKTMVADAMRRIRSEAGKHRKNAAKRMLIHQRENTASKGEFQSQSSISMSEKQTREISEQTMTPSVQALARLIQSDNPLLKNGKIWTPHRSWSINNHSKDITFFQMQTDYHPSGDQPAAIAQLLKGIHSREKVQLLLGVTGSGKTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVSYYDYYQPEAYVPRTDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMIVQLKIGDSVEQKELLSSLVKQQYKRQDIGIIRGTFRVCGDSIEIFPSHLEDVAWRVSMFGNDIEEISEFYPLTGQKIRNVETIKIYANSHYVTPRPTLNTAMKYIxxxxxxxxxxxxxxxxxxxxxRLEQRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYIPEDSLLFVDESHVTIPQISGMYRGDFHRKATLAEYGFRLPSCMDNRPLRFEEWNCLRPTTIVVSATPGSWELEQCQGIIVEQIIRPTGLVDPPVEIRSARTQVEDVYDEINLAAQQGLRILLTVLTKRMAEDLTEYLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSKTSLIQTIGRAARNVNSKVILYADTITKSIQLAIDETTRRREKQLEHNKKHNINPQSVKEKIMEVIDPILLEDAATTNISIDAQQLSLSKKKGKAHLKSLRKQMHLAADNLNFEEAARIRDEIKRLKSSPYFQGLDDS
MPKKTRSFPKKDSRIQSISTRVDDLDYFSFEEKQLEVDKTMVADAMRRIRSEAGKHRKNAAKRMLIHQRENTASKGEFQSQSSISMSEKQTREISEQTMTPSVQALARLIQSDNPLLKNGKIWTPHRSWSINNHSKDITFFQMQTDYHPSGDQPAAIAQLLKGIHSREKVQLLLGVTGSGKTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVSYYDYYQPEAYVPRTDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMIVQLKIGDSVEQKELLSSLVKQQYKRQDIGIIRGTFRVCGDSIEIFPSHLEDVAWRVSMFGNDIEEISEFYPLTGQKIRNVETIKIYANSHYVTPRPTLNTAMKYIKEELKMRLIELEKEGRLLEAQRLEQRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYIPEDSLLFVDESHVTIPQISGMYRGDFHRKATLAEYGFRLPSCMDNRPLRFEEWNCLRPTTIVVSATPGSWELEQCQGIIVEQIIRPTGLVDPPVEIRSARTQVEDVYDEINLAAQQGLRILLTVLTKRMAEDLTEYLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSKTSLIQTIGRAARNVNSKVILYADTITKSIQLAIDETTRRREKQLEHNKKHNINPQSVKEKIMEVIDPILLEDAATTNISIDAQQLSLSKKKGKAHLKSLRKQMHLAADNLNFEEAARIRDEIKRLKSSPYFQGLDDS
MPKKTRSFPKKDSRIQSISTRVDDLDYFSFEEKQLEVDKTMVADAMRRIRSEAGKHRKNAAKRMLIHQRENTASKGEFQSQSSISMSEKQTREISEQTMTPSVQALARLIQSDNPLLKNGKIWTPHRSWSINNHSKDITFFQMQTDYHPSGDQPAAIAQLLKGIHSREKVQLLLGVTGSGKTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVSYYDYYQPEAYVPRTDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMIVQLKIGDSVEQKELLSSLVKQQYKRQDIGIIRGTFRVCGDSIEIFPSHLEDVAWRVSMFGNDIEEISEFYPLTGQKIRNVETIKIYANSHYVTPRPTLNTAMKYIKEELKMRLIELEKEGRLLEAQRLEQRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYIPEDSLLFVDESHVTIPQISGMYRGDFHRKATLAEYGFRLPSCMDNRPLRFEEWNCLRPTTIVVSATPGSWELEQCQGIIVEQIIRPTGLVDPPVEIRSARTQVEDVYDEINLAAQQGLRILLTVLTKRMAEDLTEYLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSKTSLIQTIGRAARNVNSKVILYADTITKSIQLAIDETTRRREKQLEHNKKHNINPQSVKEKIMEVIDPILLEDAATTNISIDAQQLSLSKKKGKAHLKSLRKQMHLAADNLNFEEAARIRDEIKRLKSSPYFQGLDDS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target805 excinuclease ABC subunit B [Candidatus Liberibacter asi
254780945700 ATP-dependent DNA helicase RecG [Candidatus Liberi 2e-04
254780382465 ATP dependent RNA helicase protein [Candidatus Lib 5e-04
254780619731 primosome assembly protein PriA [Candidatus Liberi 0.003
254780619731 primosome assembly protein PriA [Candidatus Liberi 0.024
254780947 1187 transcription-repair coupling factor [Candidatus L 0.040
>gi|254780945|ref|YP_003065358.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Back     alignment
 Score = 39.7 bits (91), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 147 YHPSGDQPAAIAQLLKGIHSREK-VQLLLGVTGSGKTFT----MAKVIEAMQRPAIVMAP 201
           + P+  Q +AI  +L+ +  + + +++L G  GSGKT      MA  +EA  + A++MAP
Sbjct: 271 FSPTKSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQ-AVIMAP 329

Query: 202 NKILAAQLYSEFKNF 216
             ILA Q Y   K +
Sbjct: 330 IGILAQQHYEFIKKY 344

>gi|254780382|ref|YP_003064795.1| ATP dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 465 Back     alignment
 Score = 38.1 bits (87), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 51/117 (43%), Gaps = 8/117 (6%)

Query: 592 KRMAEDLTEYLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLREGLDIPEC 651
           K+   +L   L ++   V  +H  +    R++I+ + + G   ++V  +L   GLDIP+ 
Sbjct: 255 KKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDV 314

Query: 652 GLVAILDADKEGFLRSKTSLIQTIGRAARN------VNSKVILYADTITKSIQLAID 702
           G V   D        +    I   GRA R+      V  + I + D I K I+  +D
Sbjct: 315 GHVFNFDVPNRA--ENYIHRIGRTGRAGRHGKAFTLVAKEDIKHIDAIEKLIEKKVD 369

>gi|254780619|ref|YP_003065032.1| primosome assembly protein PriA [Candidatus Liberibacter asiaticus str. psy62] Length = 731 Back     alignment
 Score = 35.8 bits (81), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 70/171 (40%), Gaps = 27/171 (15%)

Query: 82  SSISMSEKQTREISEQTMTPSVQALARLIQSDNPLLKNGKIWTPH---RSWSINNHSKDI 138
           S++S +EK   +I    + P +  +ARL   D   +K+GKIW      R+  +++H  D 
Sbjct: 112 SALSETEKMEEKIQFTGIFPRINTVARLRVLDK--IKDGKIWEKRDLIRASQVSSHVIDG 169

Query: 139 -----TFFQMQTDYHPSGDQPA--------------AIAQLLKGIHSREKVQLLLGVTGS 179
                   Q+     P  D P                + Q++        V L+ GVTGS
Sbjct: 170 LKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGS 229

Query: 180 GKTFTMAKVIEA---MQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVS 227
           GKT    +++ A   + +  +++ P   L + +   F+  F     E+  S
Sbjct: 230 GKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSS 280

>gi|254780619|ref|YP_003065032.1| primosome assembly protein PriA [Candidatus Liberibacter asiaticus str. psy62] Length = 731 Back     alignment
 Score = 32.7 bits (73), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 11/113 (9%)

Query: 577 LAAQQGLRILLTVLTKRMAEDLTEYLYERNIRVRYMHSEVKTLE-RIEI-IRDLRLGKFD 634
           +    G  I      +R+AE++ EY      R+  + S+++    R+++ +  +  G+ D
Sbjct: 481 VCGSSGKMIACGFGIERIAEEVCEYF--PLARISILSSDLEGGGGRLQLQLSAIAKGEID 538

Query: 635 VLVGINLLREGLDIPECGLVAILDAD---KEGFLRSKTS----LIQTIGRAAR 680
           +++G  L+ +G + P   LV ++D D       LRS       L Q  GRA R
Sbjct: 539 IIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGR 591

>gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter asiaticus str. psy62] Length = 1187 Back     alignment
 Score = 32.0 bits (71), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 631 GKFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSKTSLIQTIGRAARNVNSKVILY 689
           G++DVL+  +++  GLD+P+   + +  AD  G       L Q  GR  R+  +   L+
Sbjct: 885 GQYDVLLSTSIVESGLDLPKANTMIVQRADMFGL----AQLYQLRGRVGRSKIASFALF 939

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target805 excinuclease ABC subunit B [Candidatus Liberibacter asi
315122486817 excinuclease ABC subunit B [Candidatus Liberibacter sol 1 0.0
327192675 1013 excinuclease ABC protein, B subunit [Rhizobium etli CNP 1 0.0
190892262 1013 excinuclease ABC protein, B subunit [Rhizobium etli CIA 1 0.0
15965654 985 excinuclease ABC subunit B [Sinorhizobium meliloti 1021 1 0.0
241205212 997 excinuclease ABC subunit B [Rhizobium leguminosarum bv. 1 0.0
116252704 1009 excinuclease ABC subunit B [Rhizobium leguminosarum bv. 1 0.0
15889291 988 excinuclease ABC subunit B [Agrobacterium tumefaciens s 1 0.0
86358172 961 excinuclease ABC subunit B [Rhizobium etli CFN 42] Leng 1 0.0
227822296 994 excinuclease ABC subunit B [Sinorhizobium fredii NGR234 1 0.0
150396826 978 excinuclease ABC subunit B [Sinorhizobium medicae WSM41 1 0.0
>gi|315122486|ref|YP_004062975.1| excinuclease ABC subunit B [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 817 Back     alignment and organism information
 Score = 1351 bits (3497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/805 (81%), Positives = 723/805 (89%), Gaps = 12/805 (1%)

Query: 13  SRIQSI-STRVDDLDYFSFEEKQLEVDKTMVADAMRRIRSEAGKHRKNAAKRM----LIH 67
           S I+S  S+  DD DY SFE+KQ   DK +VA+ MR+IRSEAGKHRKN AKR+     +H
Sbjct: 13  SHIESTRSSFTDDQDYLSFEKKQFYADKEIVANTMRQIRSEAGKHRKNVAKRINKEKSLH 72

Query: 68  QRENTASKGEFQSQSSISMSEKQT-------REISEQTMTPSVQALARLIQSDNPLLKNG 120
             +  +SK   QS+   +  +K+T       +EI+E  MTPSVQALARLIQSDNPL KNG
Sbjct: 73  NSDPKSSKIALQSKKPTTQDKKRTALNNIPKKEIAENAMTPSVQALARLIQSDNPLFKNG 132

Query: 121 KIWTPHRSWSINNHSKDITFFQMQTDYHPSGDQPAAIAQLLKGIHSREKVQLLLGVTGSG 180
           KIWTPHRS SI+NH K I+ FQM TDY PSGDQP+AI+Q+++ IH+ EK+QLLLGVTGSG
Sbjct: 133 KIWTPHRSLSIHNHPKKISPFQMHTDYQPSGDQPSAISQIVESIHAEEKIQLLLGVTGSG 192

Query: 181 KTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVSYYDYYQPEAYVPR 240
           KTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFP+NAVEYFVSYYDYYQPEAYVPR
Sbjct: 193 KTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFPNNAVEYFVSYYDYYQPEAYVPR 252

Query: 241 TDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMIVQLKIG 300
           TDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMI+++KIG
Sbjct: 253 TDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMILKIKIG 312

Query: 301 DSVEQKELLSSLVKQQYKRQDIGIIRGTFRVCGDSIEIFPSHLEDVAWRVSMFGNDIEEI 360
           D +EQKELLSSLVKQQYKRQD+GI+RG+FRVCGDSIEIFPSHLE+ AWR+SMFGNDIEEI
Sbjct: 313 DQIEQKELLSSLVKQQYKRQDMGIVRGSFRVCGDSIEIFPSHLENTAWRISMFGNDIEEI 372

Query: 361 SEFYPLTGQKIRNVETIKIYANSHYVTPRPTLNTAMKYIKEELKMRLIELEKEGRLLEAQ 420
           +EF PLTGQK RN+E IKIYANSHYVTPRPTLN AMK IKEEL +RLIELEKEGRLLE+Q
Sbjct: 373 AEFDPLTGQKNRNLEEIKIYANSHYVTPRPTLNAAMKCIKEELNVRLIELEKEGRLLESQ 432

Query: 421 RLEQRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYIPEDSLLFVDESHVTI 480
           RL QRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYI E++LLFVDESHVTI
Sbjct: 433 RLAQRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYISENALLFVDESHVTI 492

Query: 481 PQISGMYRGDFHRKATLAEYGFRLPSCMDNRPLRFEEWNCLRPTTIVVSATPGSWELEQC 540
           PQISGMYRGDF RKATLAEYGFRLPSCMDNRPLRFEEW+CLRPTTIVVSATPG+WELE+C
Sbjct: 493 PQISGMYRGDFRRKATLAEYGFRLPSCMDNRPLRFEEWDCLRPTTIVVSATPGAWELEKC 552

Query: 541 QGIIVEQIIRPTGLVDPPVEIRSARTQVEDVYDEINLAAQQGLRILLTVLTKRMAEDLTE 600
           QG+IVEQIIRPTGLVDPPVEIRSARTQVED+ +EINL  Q GLRILLTVLTKRMAEDLTE
Sbjct: 553 QGMIVEQIIRPTGLVDPPVEIRSARTQVEDIKEEINLTIQNGLRILLTVLTKRMAEDLTE 612

Query: 601 YLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLREGLDIPECGLVAILDAD 660
           YLYE NIRVRYMHSEV TLERIEIIRDLRLGKFDVLVGINLLREGLDIPECGLVAILDAD
Sbjct: 613 YLYEHNIRVRYMHSEVHTLERIEIIRDLRLGKFDVLVGINLLREGLDIPECGLVAILDAD 672

Query: 661 KEGFLRSKTSLIQTIGRAARNVNSKVILYADTITKSIQLAIDETTRRREKQLEHNKKHNI 720
           KEGFLRS+TSLIQTIGRAARNV+SKVILYADT+TKSI+LAIDETTRRREKQ E+N+K+NI
Sbjct: 673 KEGFLRSRTSLIQTIGRAARNVDSKVILYADTMTKSIKLAIDETTRRREKQQEYNRKNNI 732

Query: 721 NPQSVKEKIMEVIDPILLEDAATTNISIDAQQLSLSKKKGKAHLKSLRKQMHLAADNLNF 780
            P+SVKEKI+EVIDPIL E+ + + I+I+ +QL  SKK+ + HLKSLRKQM +AADN+NF
Sbjct: 733 KPESVKEKIIEVIDPILQENNSKSEITINTEQLPQSKKERELHLKSLRKQMLIAADNMNF 792

Query: 781 EEAARIRDEIKRLKSSPYFQGLDDS 805
           EEAARIRDEIKRLK++  +  LD S
Sbjct: 793 EEAARIRDEIKRLKNAFSYDTLDSS 817


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327192675|gb|EGE59613.1| excinuclease ABC protein, B subunit [Rhizobium etli CNPAF512] Length = 1013 Back     alignment and organism information
>gi|190892262|ref|YP_001978804.1| excinuclease ABC protein, B subunit [Rhizobium etli CIAT 652] Length = 1013 Back     alignment and organism information
>gi|15965654|ref|NP_386007.1| excinuclease ABC subunit B [Sinorhizobium meliloti 1021] Length = 985 Back     alignment and organism information
>gi|241205212|ref|YP_002976308.1| excinuclease ABC subunit B [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 997 Back     alignment and organism information
>gi|116252704|ref|YP_768542.1| excinuclease ABC subunit B [Rhizobium leguminosarum bv. viciae 3841] Length = 1009 Back     alignment and organism information
>gi|15889291|ref|NP_354972.1| excinuclease ABC subunit B [Agrobacterium tumefaciens str. C58] Length = 988 Back     alignment and organism information
>gi|86358172|ref|YP_470064.1| excinuclease ABC subunit B [Rhizobium etli CFN 42] Length = 961 Back     alignment and organism information
>gi|227822296|ref|YP_002826267.1| excinuclease ABC subunit B [Sinorhizobium fredii NGR234] Length = 994 Back     alignment and organism information
>gi|150396826|ref|YP_001327293.1| excinuclease ABC subunit B [Sinorhizobium medicae WSM419] Length = 978 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target805 excinuclease ABC subunit B [Candidatus Liberibacter asi
PRK05298652 PRK05298, PRK05298, excinuclease ABC subunit B; Provisi 0.0
TIGR00631655 TIGR00631, uvrb, excinuclease ABC, B subunit 0.0
COG0556663 COG0556, UvrB, Helicase subunit of the DNA excision rep 0.0
COG1197 1139 COG1197, Mfd, Transcription-repair coupling factor (sup 9e-19
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal domain 2e-18
KOG0331519 KOG0331, KOG0331, KOG0331, ATP-dependent RNA helicase [ 1e-08
KOG0335482 KOG0335, KOG0335, KOG0335, ATP-dependent RNA helicase [ 3e-07
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase require 1e-06
KOG0328400 KOG0328, KOG0328, KOG0328, Predicted ATP-dependent RNA 2e-05
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 2e-05
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA replica 3e-05
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replication, r 3e-05
KOG0332477 KOG0332, KOG0332, KOG0332, ATP-dependent RNA helicase [ 5e-05
COG1200677 COG1200, RecG, RecG-like helicase [DNA replication, rec 1e-04
COG1198730 COG1198, PriA, Primosomal protein N' (replication facto 6e-04
KOG0333673 KOG0333, KOG0333, KOG0333, U5 snRNP-like RNA helicase s 0.001
TIGR00595505 TIGR00595, priA, primosomal protein N' 0.002
pfam1234444 pfam12344, UvrB, Ultra-violet resistance protein B 5e-15
smart0049082 smart00490, HELICc, helicase superfamily c-terminal dom 3e-14
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-terminal do 8e-14
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 2e-04
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicases [DN 5e-11
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-09
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-08
COG1200677 COG1200, RecG, RecG-like helicase [DNA replication, rec 6e-07
COG1198730 COG1198, PriA, Primosomal protein N' (replication facto 1e-05
PRK10917681 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Pr 1e-05
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 7e-05
pfam00270167 pfam00270, DEAD, DEAD/DEAH box helicase 1e-04
pfam04851103 pfam04851, ResIII, Type III restriction enzyme, res sub 5e-04
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily II [ 9e-04
TIGR00595505 TIGR00595, priA, primosomal protein N' 0.002
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily II [ 5e-08
KOG0354 746 KOG0354, KOG0354, KOG0354, DEAD-box like helicase [Gene 6e-07
KOG0338691 KOG0338, KOG0338, KOG0338, ATP-dependent RNA helicase [ 2e-04
KOG0340442 KOG0340, KOG0340, KOG0340, ATP-dependent RNA helicase [ 8e-04
COG1197 1139 COG1197, Mfd, Transcription-repair coupling factor (sup 0.002
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function pred 8e-07
KOG0344593 KOG0344, KOG0344, KOG0344, ATP-dependent RNA helicase [ 2e-05
KOG0327397 KOG0327, KOG0327, KOG0327, Translation initiation facto 4e-05
PRK00558 598 PRK00558, uvrC, excinuclease ABC subunit C; Validated 2e-06
pfam0215136 pfam02151, UVR, UvrB/uvrC motif 1e-05
PRK14671 621 PRK14671, uvrC, excinuclease ABC subunit C; Provisional 3e-05
COG0322 581 COG0322, UvrC, Nuclease subunit of the excinuclease com 9e-04
TIGR00194 574 TIGR00194, uvrC, excinuclease ABC, C subunit 0.002
COG1205 851 COG1205, COG1205, Distinct helicase family with a uniqu 9e-06
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 4e-05
TIGR00580 926 TIGR00580, mfd, transcription-repair coupling factor (m 6e-05
COG1203733 COG1203, COG1203, Predicted helicases [General function 2e-04
COG4096875 COG4096, HsdR, Type I site-specific restriction-modific 0.001
COG4889 1518 COG4889, COG4889, Predicted helicase [General function 0.001
>gnl|CDD|180000 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional Back     alignment and domain information
>gnl|CDD|161969 TIGR00631, uvrb, excinuclease ABC, B subunit Back     alignment and domain information
>gnl|CDD|30902 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31390 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|28960 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|35552 KOG0331, KOG0331, KOG0331, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35556 KOG0335, KOG0335, KOG0335, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|33855 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35549 KOG0328, KOG0328, KOG0328, Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|30860 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31308 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35553 KOG0332, KOG0332, KOG0332, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31393 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|31391 COG1198, PriA, Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35554 KOG0333, KOG0333, KOG0333, U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|161946 TIGR00595, priA, primosomal protein N' Back     alignment and domain information
>gnl|CDD|152779 pfam12344, UvrB, Ultra-violet resistance protein B Back     alignment and domain information
>gnl|CDD|128766 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|144016 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|161975 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|30859 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|28927 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|31393 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|31391 COG1198, PriA, Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|182836 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>gnl|CDD|161975 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|144015 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|147155 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information
>gnl|CDD|31261 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|161946 TIGR00595, priA, primosomal protein N' Back     alignment and domain information
>gnl|CDD|31261 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35575 KOG0354, KOG0354, KOG0354, DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|35559 KOG0338, KOG0338, KOG0338, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35561 KOG0340, KOG0340, KOG0340, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31390 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|31394 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|35565 KOG0344, KOG0344, KOG0344, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35548 KOG0327, KOG0327, KOG0327, Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179065 PRK00558, uvrC, excinuclease ABC subunit C; Validated Back     alignment and domain information
>gnl|CDD|145355 pfam02151, UVR, UvrB/uvrC motif Back     alignment and domain information
>gnl|CDD|184786 PRK14671, uvrC, excinuclease ABC subunit C; Provisional Back     alignment and domain information
>gnl|CDD|30670 COG0322, UvrC, Nuclease subunit of the excinuclease complex [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|161756 TIGR00194, uvrC, excinuclease ABC, C subunit Back     alignment and domain information
>gnl|CDD|31398 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|184313 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|161938 TIGR00580, mfd, transcription-repair coupling factor (mfd) Back     alignment and domain information
>gnl|CDD|31396 COG1203, COG1203, Predicted helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|33853 COG4096, HsdR, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|34498 COG4889, COG4889, Predicted helicase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 805 excinuclease ABC subunit B [Candidatus Liberibacter asi
TIGR00631667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 100.0
PRK05298657 excinuclease ABC subunit B; Provisional 100.0
COG0556663 UvrB Helicase subunit of the DNA excision repair comple 100.0
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 100.0
PRK05580699 primosome assembly protein PriA; Validated 100.0
TIGR00595524 priA primosomal protein N'; InterPro: IPR005259 All pro 100.0
PRK13766 764 Hef nuclease; Provisional 99.96
KOG0328400 consensus 99.91
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recombinati 99.91
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 99.9
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 99.62
KOG0387 923 consensus 99.27
KOG0385 971 consensus 98.14
KOG0386 1157 consensus 97.64
KOG03921549 consensus 96.98
TIGR01407944 dinG_rel DnaQ family exonuclease/DinG family helicase, 96.76
PRK10689 1148 transcription-repair coupling factor; Provisional 100.0
COG1197 1139 Mfd Transcription-repair coupling factor (superfamily I 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK04537 574 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00110602 helicase; Provisional 99.98
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 99.97
KOG0331519 consensus 99.96
KOG0338691 consensus 99.92
KOG0335482 consensus 99.92
KOG0330476 consensus 99.91
KOG0344593 consensus 99.91
KOG0340442 consensus 99.89
KOG0346569 consensus 99.88
KOG0342543 consensus 99.87
KOG0336629 consensus 99.87
KOG0347731 consensus 99.86
PRK13767 878 ATP-dependent helicase; Provisional 99.86
KOG0334 997 consensus 99.85
KOG0345567 consensus 99.83
KOG0348708 consensus 99.83
KOG0341610 consensus 99.82
KOG0350620 consensus 99.81
KOG0339731 consensus 99.81
KOG0327397 consensus 99.81
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 99.79
KOG4284 980 consensus 99.79
PRK02362 736 ski2-like helicase; Provisional 99.77
KOG0332477 consensus 99.74
PRK01172 674 ski2-like helicase; Provisional 99.74
KOG0343 758 consensus 99.71
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 99.71
COG1205 851 Distinct helicase family with a unique C-terminal domai 99.7
COG1202 830 Superfamily II helicase, archaea-specific [General func 99.67
KOG0351 941 consensus 99.66
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.65
KOG0326459 consensus 99.6
PRK04914 955 ATP-dependent helicase HepA; Validated 99.58
KOG0337529 consensus 99.58
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.36
KOG0352 641 consensus 99.35
PRK08074932 bifunctional ATP-dependent DNA helicase/DNA polymerase 99.32
KOG0952 1230 consensus 99.29
KOG0951 1674 consensus 99.21
KOG0349725 consensus 99.2
KOG0353 695 consensus 99.16
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.1
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 99.07
COG4889 1518 Predicted helicase [General function prediction only] 99.05
COG1199654 DinG Rad3-related DNA helicases [Transcription / DNA re 99.04
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 98.87
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polymerase 98.87
KOG0920 924 consensus 98.86
TIGR01587424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 98.77
PRK09200 799 preprotein translocase subunit SecA; Reviewed 98.73
PRK12906 823 secA preprotein translocase subunit SecA; Reviewed 98.7
PRK12899 969 secA preprotein translocase subunit SecA; Reviewed 98.65
KOG0924 1042 consensus 98.61
KOG0923 902 consensus 98.45
KOG0926 1172 consensus 98.38
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 98.15
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, RNA h 98.13
TIGR00643 721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 97.85
KOG0950 1008 consensus 97.67
KOG4150 1034 consensus 97.67
KOG4439901 consensus 97.58
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family [Tra 97.27
KOG1000689 consensus 96.95
TIGR01970 858 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IP 96.81
KOG1002791 consensus 96.05
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 95.77
COG3972660 Superfamily I DNA and RNA helicases [General function p 95.25
KOG03881185 consensus 95.21
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 95.1
KOG0389941 consensus 94.03
KOG0921 1282 consensus 93.98
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 99.96
COG1200677 RecG RecG-like helicase [DNA replication, recombination 99.93
PRK10689 1148 transcription-repair coupling factor; Provisional 99.93
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 99.93
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.93
COG1197 1139 Mfd Transcription-repair coupling factor (superfamily I 99.91
TIGR00580997 mfd transcription-repair coupling factor; InterPro: IPR 99.9
KOG0354 746 consensus 99.88
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 99.88
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, reco 99.84
TIGR00614497 recQ_fam ATP-dependent DNA helicase, RecQ family; Inter 99.62
TIGR01389 607 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR0062 99.59
PRK09694878 hypothetical protein; Provisional 99.47
KOG0947 1248 consensus 99.11
KOG0390776 consensus 98.46
KOG0384 1373 consensus 96.47
KOG0333673 consensus 99.93
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 99.62
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.78
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.75
PRK12900 983 secA preprotein translocase subunit SecA; Reviewed 98.73
PRK12326 775 preprotein translocase subunit SecA; Reviewed 98.72
PRK12901 1111 secA preprotein translocase subunit SecA; Reviewed 98.72
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.68
PRK12903 885 secA preprotein translocase subunit SecA; Reviewed 98.67
PRK12904 833 preprotein translocase subunit SecA; Reviewed 98.63
PRK12898673 secA preprotein translocase subunit SecA; Reviewed 98.61
KOG0391 1958 consensus 97.83
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 96.04
COG1204 766 Superfamily II helicase [General function prediction on 99.68
PRK00254 717 ski2-like helicase; Provisional 99.68
smart0049082 HELICc helicase superfamily c-terminal domain. 99.39
pfam0027178 Helicase_C Helicase conserved C-terminal domain. The Pr 99.32
KOG0949 1330 consensus 98.86
KOG0922 674 consensus 98.69
KOG0953 700 consensus 97.5
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 97.23
COG3587 985 Restriction endonuclease [Defense mechanisms] 96.95
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.48
smart00491142 HELICc2 helicase superfamily c-terminal domain. 95.03
KOG0701 1606 consensus 93.53
TIGR00580 997 mfd transcription-repair coupling factor; InterPro: IPR 99.67
PRK114481126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 99.64
COG4096875 HsdR Type I site-specific restriction-modification syst 99.57
PRK09401 1176 reverse gyrase; Reviewed 99.45
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 99.41
KOG0948 1041 consensus 99.15
COG0610962 Type I site-specific restriction-modification system, R 97.99
pfam00176295 SNF2_N SNF2 family N-terminal domain. This domain is fo 97.94
PRK09401 1176 reverse gyrase; Reviewed 97.02
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.42
PRK09354350 recA recombinase A; Provisional 95.56
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 95.34
pfam00308219 Bac_DnaA Bacterial dnaA protein. 95.16
KOG18051100 consensus 94.75
PRK13767 878 ATP-dependent helicase; Provisional 94.72
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 94.46
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 94.3
PRK06645507 DNA polymerase III subunits gamma and tau; Validated 94.22
PRK08727233 hypothetical protein; Validated 94.08
PRK13851343 type IV secretion system protein VirB11; Provisional 93.9
PRK13833323 conjugal transfer protein TrbB; Provisional 93.64
PRK06893229 DNA replication initiation factor; Validated 93.44
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 93.31
PRK08084235 DNA replication initiation factor; Provisional 92.99
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 92.86
PRK05541176 adenylylsulfate kinase; Provisional 92.68
TIGR01389607 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR0062 92.64
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 92.34
PRK09302501 circadian clock protein KaiC; Reviewed 91.57
PRK12323721 DNA polymerase III subunits gamma and tau; Provisional 91.45
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 90.82
PRK08770663 DNA polymerase III subunits gamma and tau; Validated 90.68
PRK13900332 type IV secretion system ATPase VirB11; Provisional 90.19
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell moti 90.18
COG0630312 VirB11 Type IV secretory pathway, VirB11 components, an 90.01
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 99.5
smart00487201 DEXDc DEAD-like helicases superfamily. 99.31
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 99.28
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 99.15
KOG0329387 consensus 99.09
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 99.01
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 98.66
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 97.8
KOG0925699 consensus 96.61
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 96.11
COG2805353 PilT Tfp pilus assembly protein, pilus retraction ATPas 95.14
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 94.27
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 93.62
PRK00149447 dnaA chromosomal replication initiation protein; Review 92.67
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 91.7
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 90.97
pfam1234444 UvrB Ultra-violet resistance protein B. This domain fam 98.75
pfam04851103 ResIII Type III restriction enzyme, res subunit. 98.65
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.31
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.31
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle po 97.1
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like subgro 96.9
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily. Me 96.82
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 96.82
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 96.81
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-l 96.79
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup 96.78
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain 96.74
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 96.74
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like group. K 96.62
PRK07952242 DNA replication protein DnaC; Validated 96.52
cd00106328 KISc Kinesin motor domain. This catalytic (head) domain 96.51
pfam00225321 Kinesin Kinesin motor domain. 96.5
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subg 96.39
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.35
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Microtubu 96.35
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subg 96.34
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like protei 96.25
KOG0242675 consensus 96.02
PRK08939306 primosomal protein DnaI; Reviewed 95.99
COG3973747 Superfamily I DNA and RNA helicases [General function p 95.99
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 95.98
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup 95.8
PRK08116262 hypothetical protein; Validated 95.79
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 95.78
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 95.78
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 95.73
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 95.69
KOG1803649 consensus 95.67
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 95.67
KOG0243 1041 consensus 95.66
PRK06835330 DNA replication protein DnaC; Validated 95.65
pfam06745231 KaiC KaiC. This family represents a conserved region wi 95.64
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_lik 95.61
cd01394218 radB RadB. The archaeal protein radB shares similarity 95.59
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 95.57
KOG0247809 consensus 95.47
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup 95.47
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 95.34
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.31
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 95.28
PRK11784333 tRNA 2-selenouridine synthase; Provisional 95.13
PRK11054684 helD DNA helicase IV; Provisional 95.1
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 95.03
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 94.99
PRK12377248 putative replication protein; Provisional 94.98
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 94.89
smart00382148 AAA ATPases associated with a variety of cellular activ 94.84
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 94.77
COG1484254 DnaC DNA replication protein [DNA replication, recombin 94.75
PRK08006471 replicative DNA helicase; Provisional 94.75
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 94.69
cd03115173 SRP The signal recognition particle (SRP) mediates the 94.57
PRK06921265 hypothetical protein; Provisional 94.55
TIGR02759613 TraD_Ftype type IV conjugative transfer system coupling 94.54
pfam10412386 TrwB_AAD_bind Type IV secretion-system coupling protein 94.54
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 94.46
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 94.44
KOG4280574 consensus 94.43
KOG0240607 consensus 94.37
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 94.35
pfam01935218 DUF87 Domain of unknown function DUF87. The function of 94.34
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial con 93.98
PRK13894320 conjugal transfer ATPase TrbB; Provisional 93.93
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 93.89
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 93.85
PRK06067241 flagellar accessory protein FlaH; Validated 93.77
CHL00095823 clpC Clp protease ATP binding subunit 93.74
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 93.7
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 93.63
PRK08769319 DNA polymerase III subunit delta'; Validated 93.6
PRK10865857 protein disaggregation chaperone; Provisional 93.57
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 93.54
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 93.53
PRK12402337 replication factor C small subunit 2; Reviewed 93.41
PRK08082453 consensus 93.29
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 93.26
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 93.22
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell 93.22
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 93.21
PRK00440318 rfc replication factor C small subunit; Reviewed 93.13
PRK13700732 conjugal transfer protein TraD; Provisional 93.08
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 93.07
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 93.04
PRK05748448 replicative DNA helicase; Provisional 92.89
COG0210655 UvrD Superfamily I DNA and RNA helicases [DNA replicati 92.86
pfam00004131 AAA ATPase family associated with various cellular acti 92.83
KOG1802935 consensus 92.62
pfam10236274 DAP3 Mitochondrial ribosomal death-associated protein 3 92.47
PRK04328250 hypothetical protein; Provisional 92.33
PRK06762166 hypothetical protein; Provisional 92.3
PRK11773722 uvrD DNA-dependent helicase II; Provisional 92.28
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 92.25
PRK07667190 uridine kinase; Provisional 92.22
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 92.19
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 92.06
cd01124187 KaiC KaiC is a circadian clock protein primarily found 91.96
PRK08840464 replicative DNA helicase; Provisional 91.94
PRK07263453 consensus 91.85
PHA00350402 putative assembly protein 91.85
TIGR02773 1192 addB_Gpos ATP-dependent nuclease subunit B; InterPro: I 91.84
PRK08694468 consensus 91.84
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 91.71
PRK09183258 transposase/IS protein; Provisional 91.63
pfam01745232 IPT Isopentenyl transferase. Isopentenyl transferase / 91.6
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 91.5
PRK08903227 hypothetical protein; Validated 91.49
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 91.4
COG0714329 MoxR-like ATPases [General function prediction only] 91.29
PRK08691704 DNA polymerase III subunits gamma and tau; Validated 91.22
PRK06526254 transposase; Provisional 91.19
PRK08506473 replicative DNA helicase; Provisional 91.17
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 91.1
PRK08533230 flagellar accessory protein FlaH; Reviewed 91.0
PRK08760476 replicative DNA helicase; Provisional 90.87
PRK05595444 replicative DNA helicase; Provisional 90.77
PRK07004460 replicative DNA helicase; Provisional 90.73
PRK04195403 replication factor C large subunit; Provisional 90.66
PRK06749428 replicative DNA helicase; Provisional 90.59
PRK00139481 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 90.41
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 90.4
KOG0244 913 consensus 90.24
PRK08181269 transposase; Validated 90.14
PRK06696227 uridine kinase; Validated 90.05
CHL00122 891 secA preprotein translocase subunit SecA; Validated 98.58
PRK12902 946 secA preprotein translocase subunit SecA; Reviewed 98.52
PRK10917 677 ATP-dependent DNA helicase RecG; Provisional 97.78
COG1200 677 RecG RecG-like helicase [DNA replication, recombination 97.35
TIGR00963 904 secA preprotein translocase, SecA subunit; InterPro: IP 96.41
PRK12306519 uvrC excinuclease ABC subunit C; Reviewed 97.48
PRK00558609 uvrC excinuclease ABC subunit C; Validated 97.44
COG3880176 Modulator of heat shock repressor CtsR, McsA [Signal tr 97.25
pfam0215136 UVR UvrB/uvrC motif. 97.09
PRK07883 575 hypothetical protein; Validated 96.83
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 97.21
PRK05580699 primosome assembly protein PriA; Validated 96.8
COG0322581 UvrC Nuclease subunit of the excinuclease complex [DNA 97.17
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 95.97
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.8
TIGR00348813 hsdR type I site-specific deoxyribonuclease, HsdR famil 95.96
KOG0245 1221 consensus 94.9
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 96.7
PRK10436461 hypothetical protein; Provisional 96.34
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 95.15
PTZ00301210 uridine kinase; Provisional 91.05
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 96.02
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 95.25
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 94.78
KOG0239670 consensus 94.47
TIGR00631667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 94.31
cd01363186 Motor_domain Myosin and Kinesin motor domain. These ATP 94.27
KOG0246676 consensus 93.79
COG38571108 AddB ATP-dependent nuclease, subunit B [DNA replication 94.11
TIGR00595524 priA primosomal protein N'; InterPro: IPR005259 All pro 93.89
>TIGR00631 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 All proteins in this family for which functions are known are DNA helicases that function in the nucleotide excision repair and are endonucleases that make the 3' incision next to DNA damage Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N'; InterPro: IPR005259 All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0328 consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0387 consensus Back     alignment and domain information
>KOG0385 consensus Back     alignment and domain information
>KOG0386 consensus Back     alignment and domain information
>KOG0392 consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative; InterPro: IPR006310 These are a family of proteins in Gram-positive bacteria Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0331 consensus Back     alignment and domain information
>KOG0338 consensus Back     alignment and domain information
>KOG0335 consensus Back     alignment and domain information
>KOG0330 consensus Back     alignment and domain information
>KOG0344 consensus Back     alignment and domain information
>KOG0340 consensus Back     alignment and domain information
>KOG0346 consensus Back     alignment and domain information
>KOG0342 consensus Back     alignment and domain information
>KOG0336 consensus Back     alignment and domain information
>KOG0347 consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0334 consensus Back     alignment and domain information
>KOG0345 consensus Back     alignment and domain information
>KOG0348 consensus Back     alignment and domain information
>KOG0341 consensus Back     alignment and domain information
>KOG0350 consensus Back     alignment and domain information
>KOG0339 consensus Back     alignment and domain information
>KOG0327 consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG4284 consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0332 consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0343 consensus Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0351 consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0326 consensus Back     alignment and domain information