254780992

254780992

acyl-CoA hydrolase

GeneID in NCBI database:8210014Locus tag:CLIBASIA_04465
Protein GI in NCBI database:254780992Protein Accession:YP_003065405.1
Gene range:-(988963, 989421)Protein Length:152aa
Gene description:acyl-CoA hydrolase
COG prediction:[I] Acyl-CoA hydrolase
KEGG prediction:acyl-CoA hydrolase; K10806 acyl-CoA thioesterase YciA [EC:3.1.2.-]
SEED prediction:acyl-CoA hydrolase
Pathway involved in KEGG:Biosynthesis of unsaturated fatty acids [PATH:las01040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE
ccccccccEEEEcccccHHHHHHHccccccccEEEEEEEcHHHHcccccEEHHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEccccccccEEEEEEEEEEEcccEEEEEEEEEEEccccccccEEEEEEEEEEEEEEcccccccccccc
cccHHHcHHHHHHHHHHcHHHHHcccccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEcEEEEEcEEEcccEEEEEEEEEEEccEEEEEEEEEEEEccccccccEEEEEEEEEEEEEEcccccccccccc
MVDISKNINLLLINIITKKEVLMVCQMHSsgvltlkiqtmptdvnldgnvfggwIMSQIDIACGIRASQLCKCRVVTKAVTELLfekpiqvsDLVHIYTQIRKIGKTSVTIYCdvwtcprnassdvLQKTCEATVVMVAVdekgnpksirte
MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEllfekpiqvsdlVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVavdekgnpksirte
MVDISKninllliniiTKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE
****SKNINL**************************IQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG*P******
MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE
MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEK*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE
MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE
MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target152 acyl-CoA hydrolase [Candidatus Liberibacter asiaticus s
315122485132 acyl-CoA hydrolase [Candidatus Liberibacter solanacearu 1 6e-47
15889285130 acyl-CoA hydrolase [Agrobacterium tumefaciens str. C58] 1 3e-28
325293361130 Acyl-CoA hydrolase [Agrobacterium sp. H13-3] Length = 1 1 3e-28
319781937131 thioesterase superfamily protein [Mesorhizobium ciceri 1 4e-28
209549772128 thioesterase [Rhizobium leguminosarum bv. trifolii WSM2 1 5e-28
327192693127 putative acyl-CoA hydrolase protein [Rhizobium etli CNP 1 8e-28
260463975131 thioesterase superfamily protein [Mesorhizobium opportu 1 8e-28
13472339131 acyl-CoA hydrolase [Mesorhizobium loti MAFF303099] Leng 1 8e-28
190892244127 acyl-CoA hydrolase [Rhizobium etli CIAT 652] Length = 1 1 2e-27
222086262129 acyl-CoA hydrolase protein [Agrobacterium radiobacter K 1 4e-27
>gi|315122485|ref|YP_004062974.1| acyl-CoA hydrolase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 132 Back     alignment and organism information
 Score =  190 bits (482), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (85%), Gaps = 1/125 (0%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           ++HSSG LTLK+QTMPTD+N+DGN+FGGWIMSQID+ACGI AS++ K RVVTKAV ELLF
Sbjct: 4   RLHSSGKLTLKVQTMPTDINIDGNIFGGWIMSQIDLACGICASEVAKSRVVTKAVKELLF 63

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           EKP+ V DLVHIYT +R IG+TS+TIYCDVWT  RNA  D LQKT EAT +MVAVD++G 
Sbjct: 64  EKPVYVGDLVHIYTDVRAIGRTSITIYCDVWTSTRNA-LDCLQKTSEATFIMVAVDKQGV 122

Query: 146 PKSIR 150
           P+ I+
Sbjct: 123 PQPIK 127


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15889285|ref|NP_354966.1| acyl-CoA hydrolase [Agrobacterium tumefaciens str. C58] Length = 130 Back     alignment and organism information
>gi|325293361|ref|YP_004279225.1| Acyl-CoA hydrolase [Agrobacterium sp. H13-3] Length = 130 Back     alignment and organism information
>gi|319781937|ref|YP_004141413.1| thioesterase superfamily protein [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 131 Back     alignment and organism information
>gi|209549772|ref|YP_002281689.1| thioesterase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 128 Back     alignment and organism information
>gi|327192693|gb|EGE59631.1| putative acyl-CoA hydrolase protein [Rhizobium etli CNPAF512] Length = 127 Back     alignment and organism information
>gi|260463975|ref|ZP_05812170.1| thioesterase superfamily protein [Mesorhizobium opportunistum WSM2075] Length = 131 Back     alignment and organism information
>gi|13472339|ref|NP_103906.1| acyl-CoA hydrolase [Mesorhizobium loti MAFF303099] Length = 131 Back     alignment and organism information
>gi|190892244|ref|YP_001978786.1| acyl-CoA hydrolase [Rhizobium etli CIAT 652] Length = 127 Back     alignment and organism information
>gi|222086262|ref|YP_002544794.1| acyl-CoA hydrolase protein [Agrobacterium radiobacter K84] Length = 129 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target152 acyl-CoA hydrolase [Candidatus Liberibacter asiaticus s
cd03442123 cd03442, BFIT_BACH, Brown fat-inducible thioesterase (B 3e-24
PRK10694133 PRK10694, PRK10694, acyl-CoA esterase; Provisional 1e-21
COG1607157 COG1607, COG1607, Acyl-CoA hydrolase [Lipid metabolism] 1e-29
pfam0306179 pfam03061, 4HBT, Thioesterase superfamily 6e-10
KOG2763357 KOG2763, KOG2763, KOG2763, Acyl-CoA thioesterase [Lipid 5e-07
COG0824137 COG0824, FcbC, Predicted thioesterase [General function 7e-04
>gnl|CDD|48037 cd03442, BFIT_BACH, Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>gnl|CDD|182653 PRK10694, PRK10694, acyl-CoA esterase; Provisional Back     alignment and domain information
>gnl|CDD|31795 COG1607, COG1607, Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|145944 pfam03061, 4HBT, Thioesterase superfamily Back     alignment and domain information
>gnl|CDD|37974 KOG2763, KOG2763, KOG2763, Acyl-CoA thioesterase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31166 COG0824, FcbC, Predicted thioesterase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 152 acyl-CoA hydrolase [Candidatus Liberibacter asiaticus s
PRK10694133 acyl-CoA thioester hydrolase; Provisional 100.0
COG1607157 Acyl-CoA hydrolase [Lipid metabolism] 100.0
cd03442123 BFIT_BACH Brown fat-inducible thioesterase (BFIT). Brai 100.0
KOG2763357 consensus 99.89
KOG2763 357 consensus 99.79
COG2050141 PaaI HGG motif-containing thioesterase, possibly involv 99.49
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameric acy 99.41
PRK11688154 hypothetical protein; Provisional 99.16
PRK10254137 hypothetical protein; Provisional 99.14
PRK10800130 acyl-CoA thioester hydrolase YbgC; Provisional 99.1
COG0824137 FcbC Predicted thioesterase [General function predictio 99.09
PRK10293136 hypothetical protein; Provisional 98.91
cd03440100 hot_dog The hotdog fold was initially identified in the 98.56
cd00586110 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyze 98.55
TIGR00369122 unchar_dom_1 uncharacterized domain 1; InterPro: IPR003 98.49
PRK04424185 fatty acid biosynthesis transcriptional regulator; Prov 98.39
PRK00006149 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed 98.01
cd01288131 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier prote 97.6
TIGR00051121 TIGR00051 conserved hypothetical protein; InterPro: IPR 97.46
PRK13188465 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylgluco 97.14
cd00493131 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein 97.0
TIGR02447141 yiiD_Cterm thioesterase domain, putative; InterPro: IPR 96.73
cd0055699 Thioesterase_II Thioesterase II (TEII) is thought to re 96.41
COG0764147 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier 95.86
pfam01643 247 Acyl-ACP_TE Acyl-ACP thioesterase. This family consists 95.75
COG5496130 Predicted thioesterase [General function prediction onl 95.18
PRK08190 465 bifunctional enoyl-CoA hydratase/phosphate acetyltransf 94.26
KOG3016 294 consensus 94.13
PRK07531489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 93.84
COG1946 289 TesB Acyl-CoA thioesterase [Lipid metabolism] 93.68
pfam0306179 4HBT Thioesterase superfamily. This family contains a w 99.42
KOG3328148 consensus 99.13
TIGR02286115 PaaD phenylacetic acid degradation protein PaaD; InterP 99.11
COG4109432 Predicted transcriptional regulator containing CBS doma 97.77
TIGR01750142 fabZ beta-hydroxyacyl-(acyl-carrier-protein) dehydratas 97.62
KOG4781237 consensus 97.39
cd03455123 SAV4209 SAV4209 is a Streptomyces avermitilis protein w 97.06
cd0344594 Thioesterase_II_repeat2 Thioesterase II (TEII) is thoug 96.75
pfam01575123 MaoC_dehydratas MaoC like domain. The maoC gene is part 96.31
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine oxid 96.15
cd03452142 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC ( 95.94
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fa 95.91
PRK10526 286 acyl-CoA thioesterase II; Provisional 95.82
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to the S 95.82
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA 95.15
COG2030159 MaoC Acyl dehydratase [Lipid metabolism] 94.82
cd03450149 NodN NodN (nodulation factor N) contains a single hot d 92.2
TIGR02799127 thio_ybgC tol-pal system-associated acyl-CoA thioestera 98.09
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydra 96.62
PRK13691166 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisio 92.52
PRK11563676 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase 90.09
cd03451146 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein wit 96.69
cd03454140 YdeM YdeM is a Bacillus subtilis protein that belongs t 95.0
>PRK10694 acyl-CoA thioester hydrolase; Provisional Back     alignment and domain information
>COG1607 Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>KOG2763 consensus Back     alignment and domain information
>KOG2763 consensus Back     alignment and domain information
>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>PRK11688 hypothetical protein; Provisional Back     alignment and domain information
>PRK10254 hypothetical protein; Provisional Back     alignment and domain information
>PRK10800 acyl-CoA thioester hydrolase YbgC; Provisional Back     alignment and domain information
>COG0824 FcbC Predicted thioesterase [General function prediction only] Back     alignment and domain information
>PRK10293 hypothetical protein; Provisional Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>TIGR00369 unchar_dom_1 uncharacterized domain 1; InterPro: IPR003736 This domain is found in the PAAI protein from Escherichia coli that may be involved in phenylacetic acid degradation and in a few others that may be transcription regulators Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>TIGR00051 TIGR00051 conserved hypothetical protein; InterPro: IPR006684 4-hydroxybenzoyl-CoA thioesterase (3 Back     alignment and domain information
>PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>TIGR02447 yiiD_Cterm thioesterase domain, putative; InterPro: IPR012660 This entry consists of a broadly distributed uncharacterised domain found often as a standalone protein Back     alignment and domain information
>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] Back     alignment and domain information
>pfam01643 Acyl-ACP_TE Acyl-ACP thioesterase Back     alignment and domain information
>COG5496 Predicted thioesterase [General function prediction only] Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>KOG3016 consensus Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] Back     alignment and domain information
>pfam03061 4HBT Thioesterase superfamily Back     alignment and domain information
>KOG3328 consensus Back     alignment and domain information
>TIGR02286 PaaD phenylacetic acid degradation protein PaaD; InterPro: IPR011973 This members of this family belong to the thioesterase superfamily IPR006683 from INTERPRO, and are nearly always found adjacent to other genes of the phenylacetic acid degradation pathway Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>TIGR01750 fabZ beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ; InterPro: IPR010084 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes Back     alignment and domain information
>KOG4781 consensus Back     alignment and domain information
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>pfam01575 MaoC_dehydratas MaoC like domain Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information
>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>PRK10526 acyl-CoA thioesterase II; Provisional Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>COG2030 MaoC Acyl dehydratase [Lipid metabolism] Back     alignment and domain information
>cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase; InterPro: IPR014166 The tol-pal system consists of five critical genes Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes Back     alignment and domain information
>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target152 acyl-CoA hydrolase [Candidatus Liberibacter asiaticus s
1yli_A153 Crystal Structure Of Hi0827, A Hexameric Broad Spec 4e-31
3bjk_A153 Crystal Structure Of Hi0827, A Hexameric Broad Spec 4e-30
2q2b_A179 Crystal Structure Of The C-Terminal Domain Of Mouse 3e-25
1vpm_A169 Crystal Structure Of Acyl-Coa Hydrolase (Np_241664. 9e-25
2qq2_A193 Crystal Structure Of C-Terminal Domain Of Human Acy 2e-24
3d6l_A137 Crystal Structure Of Cj0915, A Hexameric Hotdog Fol 4e-24
1y7u_A174 Crystal Structure Of Acyl-Coa Hydrolase From Bacill 7e-21
2eis_A133 X-Ray Structure Of Acyl-Coa Hydrolase-Like Protein, 1e-18
3b7k_A333 Human Acyl-Coenzyme A Thioesterase 12 Length = 333 8e-18
3b7k_A 333 Human Acyl-Coenzyme A Thioesterase 12 Length = 333 9e-15
2gvh_A288 Crystal Structure Of Acyl-Coa Hydrolase (15159470) 1e-16
2gvh_A 288 Crystal Structure Of Acyl-Coa Hydrolase (15159470) 3e-15
2v1o_A151 Crystal Structure Of N-Terminal Domain Of Acyl-Coa 2e-10
2hbo_A158 Crystal Structure Of A Thioesterase Superfamily Pro 9e-05
2h4u_A145 Crystal Structure Of Human Thioesterase Superfamily 0.001
1psu_A140 Structure Of The E. Coli Paai Protein From The Phye 0.002
2fs2_A151 Structure Of The E. Coli Paai Protein From The Phye 0.002
1j1y_A136 Crystal Structure Of Paai From Thermus Thermophilus 6e-04
>gi|60594417|pdb|1YLI|A Chain A, Crystal Structure Of Hi0827, A Hexameric Broad Specificity Acyl-Coenzyme A Thioesterase Length = 153 Back     alignment and structure
 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 50/126 (39%), Positives = 70/126 (55%), Gaps = 1/126 (0%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F K
Sbjct: 11  QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIK 70

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPR-NASSDVLQKTCEATVVMVAVDEKGNP 146
           PI V D+V  Y Q  K+G++S+ I  +VW     +          +A    VAVD  G  
Sbjct: 71  PISVGDVVCCYGQCLKVGRSSIKIKVEVWVKKVASEPIGERYCVTDAVFTFVAVDNNGRS 130

Query: 147 KSIRTE 152
           ++I  E
Sbjct: 131 RTIPRE 136


>gi|168988889|pdb|3BJK|A Chain A, Crystal Structure Of Hi0827, A Hexameric Broad Specificity Acyl-Coenzyme A Thioesterase: The Asp44ala Mutant Enzyme Length = 153 Back     alignment and structure
>gi|152149432|pdb|2Q2B|A Chain A, Crystal Structure Of The C-Terminal Domain Of Mouse Acyl- Coa Thioesterase 7 Length = 179 Back     alignment and structure
>gi|58177025|pdb|1VPM|A Chain A, Crystal Structure Of Acyl-Coa Hydrolase (Np_241664.1) From Bacillus Halodurans At 1.66 A Resolution Length = 169 Back     alignment and structure
>gi|157836239|pdb|2QQ2|A Chain A, Crystal Structure Of C-Terminal Domain Of Human Acyl-Coa Thioesterase 7 Length = 193 Back     alignment and structure
gi|229597706|pdb|3D6L|A Chain A, Crystal Structure Of Cj0915, A Hexameric Hotdog Fold Thioesterase Of Campylobacter Jejuni Length = 137 Back     alignment and structure
>gi|60594150|pdb|1Y7U|A Chain A, Crystal Structure Of Acyl-Coa Hydrolase From Bacillus Cereus Length = 174 Back     alignment and structure
>gi|170292135|pdb|2EIS|A Chain A, X-Ray Structure Of Acyl-Coa Hydrolase-Like Protein, Tt1379, From Thermus Thermophilus Hb8 Length = 133 Back     alignment and structure
>gi|160286550|pdb|3B7K|A Chain A, Human Acyl-Coenzyme A Thioesterase 12 Length = 333 Back     alignment and structure
>gi|160286550|pdb|3B7K|A Chain A, Human Acyl-Coenzyme A Thioesterase 12 Length = 333 Back     alignment and structure
>gi|109158099|pdb|2GVH|A Chain A, Crystal Structure Of Acyl-Coa Hydrolase (15159470) From Agrobacterium Tumefaciens At 2.65 A Resolution Length = 288 Back     alignment and structure
>gi|109158099|pdb|2GVH|A Chain A, Crystal Structure Of Acyl-Coa Hydrolase (15159470) From Agrobacterium Tumefaciens At 2.65 A Resolution Length = 288 Back     alignment and structure
>gi|151568118|pdb|2V1O|A Chain A, Crystal Structure Of N-Terminal Domain Of Acyl-Coa Thioesterase 7 Length = 151 Back     alignment and structure
>gi|114794310|pdb|2HBO|A Chain A, Crystal Structure Of A Thioesterase Superfamily Protein (Cc_3309) From Caulobacter Vibrioides At 1.85 A Resolution Length = 158 Back     alignment and structure
>gi|110590533|pdb|2H4U|A Chain A, Crystal Structure Of Human Thioesterase Superfamily Member 2 (Casp Target) Length = 145 Back     alignment and structure
>gi|33358147|pdb|1PSU|A Chain A, Structure Of The E. Coli Paai Protein From The Phyenylacetic Acid Degradation Operon Length = 140 Back     alignment and structure
>gi|90109611|pdb|2FS2|A Chain A, Structure Of The E. Coli Paai Protein From The Phyenylacetic Acid Degradation Operon Length = 151 Back     alignment and structure
gi|46014889|pdb|1J1Y|A Chain A, Crystal Structure Of Paai From Thermus Thermophilus Hb8 Length = 136 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target152 acyl-CoA hydrolase [Candidatus Liberibacter asiaticus s
3b7k_A333 Acyl-coenzyme A thioesterase 12; hotdog fold, structura 8e-26
3b7k_A 333 Acyl-coenzyme A thioesterase 12; hotdog fold, structura 1e-23
2gvh_A288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structural g 6e-23
2gvh_A 288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structural g 1e-21
2eis_A133 Hypothetical protein TTHB207; COA binding motif, NPPSFA 9e-23
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, trime 9e-23
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C 3e-22
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C 9e-22
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, acyl-CO 7e-21
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomics, j 1e-20
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; alternat 3e-20
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme A, pr 6e-18
2h4u_A145 Thioesterase superfamily member 2; structural genomics, 2e-08
3nwz_A176 BH2602 protein; structural genomics, PSI-2, protein str 5e-07
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hydrola 2e-06
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics, unk 3e-06
1wlu_A136 PAAI protein, phenylacetic acid degradation protein PAA 3e-06
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, 2e-05
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA08564, s 5e-04
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, 0.001
2hbo_A158 Hypothetical protein (NP_422103.1); structural genomics 7e-07
2qwz_A159 Phenylacetic acid degradation-related protein; YP_61338 2e-06
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, st 0.001
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consortium, SGC, cytoplasm, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Length = 333 Back     alignment and structure
 Score =  111 bits (278), Expect = 8e-26
 Identities = 28/112 (25%), Positives = 45/112 (40%), Gaps = 1/112 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P   N  GN FGG IM+ ++    I AS+LC      K+V    F  P  V D +    
Sbjct: 207 LPPHANHHGNTFGGQIMAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTA 266

Query: 100 QIRKIGKTSVTIYCDVWT-CPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
            +    +T V +   V     +  +    +    A ++  A D+K N  +  
Sbjct: 267 IVNNTFQTCVEVGVRVEAFDCQEWAEGRGRHINSAFLIYNAADDKENLITFP 318


>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consortium, SGC, cytoplasm, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Length = 333 Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Agrobacterium tumefaciens str} SCOP: d.38.1.1 d.38.1.1 Length = 288 Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Agrobacterium tumefaciens str} SCOP: d.38.1.1 d.38.1.1 Length = 288 Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein structural and functional analyses; HET: COA; 2.10A {Thermus thermophilus HB8} Length = 133 Back     alignment and structure
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural genomics, structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Length = 153 Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Length = 179 Back     alignment and structure
>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Length = 137 Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: COA; 1.66A {Bacillus halodurans c-125} SCOP: d.38.1.1 Length = 169 Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; alternative splicing, acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication; HET: COA; 1.78A {Mus musculus} Length = 151 Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural genomics, MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Length = 174 Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Length = 145 Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, unknown function; HET: COA; 2.57A {Bacillus halodurans} Length = 176 Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} PDB: 2f0x_A* 2cy9_A Length = 148 Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Length = 145 Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, structural genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Length = 136 Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown function; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Length = 131 Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Length = 216 Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Length = 167 Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); structural genomics, PSI- 2, protein structure initiative, joint center for structural genomics, JCSG; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Length = 158 Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; YP_613385.1, putative thioesterase, structural genomics, joint center for structural genomics; HET: MSE; 2.15A {Silicibacter SP} Length = 159 Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Length = 148 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 acyl-CoA hydrolase [Candidatus Liberibacter asiaticus s
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, trime 100.0
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, acyl-CO 100.0
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C 100.0
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C 100.0
2gvh_A288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structural g 100.0
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomics, j 100.0
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme A, pr 100.0
3b7k_A333 Acyl-coenzyme A thioesterase 12; hotdog fold, structura 100.0
2eis_A133 Hypothetical protein TTHB207; COA binding motif, NPPSFA 100.0
3b7k_A 333 Acyl-coenzyme A thioesterase 12; hotdog fold, structura 100.0
2gvh_A 288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structural g 100.0
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; alternat 100.0
2hbo_A158 Hypothetical protein (NP_422103.1); structural genomics 99.77
1wlu_A136 PAAI protein, phenylacetic acid degradation protein PAA 99.71
2h4u_A145 Thioesterase superfamily member 2; structural genomics, 99.69
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics, unk 99.68
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, 99.67
3e1e_A141 Thioesterase family protein; structural genomics, PSI-2 99.64
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hydrola 99.63
2qwz_A159 Phenylacetic acid degradation-related protein; putative 99.63
3nwz_A176 BH2602 protein; structural genomics, PSI-2, protein str 99.6
1zki_A133 Hypothetical protein PA5202; structural genomics, PSI, 99.59
3gek_A146 Putative thioesterase YHDA; X-RAY, structure genomics, 99.59
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon, str 99.56
1o0i_A138 Hypothetical protein HI1161; structural genomics, PSI, 99.56
2pim_A141 Phenylacetic acid degradation-related protein; thioeste 99.52
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, struct 99.52
1vh5_A148 Hypothetical protein YDII; PSI, protein structure initi 99.51
3bnv_A152 CJ0977; virulence factor, hot-DOG fold, flagella, unkno 99.5
1vh9_A149 P15, hypothetical protein YBDB; structural genomics, un 99.5
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arth 99.49
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, stru 99.45
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, st 99.44
3hdu_A157 Putative thioesterase; YP_461911.1, structural genomics 99.39
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene regulat 99.39
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA08564, s 99.38
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, PF0306 99.37
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, cataly 99.37
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG struc 99.35
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA 99.32
2fuj_A137 Conserved hypothetical protein; structural genomics, X- 99.27
2hx5_A152 Hypothetical protein; NP_895880.1, structural genomics, 99.25
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bacteria 99.23
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, 99.23
2xem_A150 DYNE7, TEBC; biosynthetic protein, polyketide biosynthe 99.21
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural genom 99.15
2ali_A158 Hypothetical protein PA2801; structural genomics, PSI, 99.15
1njk_A156 Hypothetical protein YBAW; structural genomics, thioest 99.14
3ck1_A150 Putative thioesterase; structural genomics, joint cente 99.14
1z54_A132 Probable thioesterase; hypothetical protein, structural 99.1
2hlj_A157 Hypothetical protein; putative thioesterase, structural 99.09
2w3x_A147 CALE7; hydrolase, hotdog fold, thioesterase, enediyne b 99.08
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural genom 99.08
2cye_A133 TTHA1846, putative thioesterase; structural genomics, N 99.04
1s5u_A138 Protein YBGC; structural genomics, hypothetical protein 99.03
2egj_A128 Hypothetical protein AQ_1494; structural genomics, NPPS 99.02
1t82_A155 Hypothetical acetyltransferase; structural genomics, al 98.96
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; structural 98.96
2gf6_A135 Conserved hypothetical protein; putative thioesterase, 98.95
1yoc_A147 Hypothetical protein PA1835; structural genomics, PSI, 98.95
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1.91A 98.91
1sh8_A154 Hypothetical protein PA5026; structural genomics, PSI, 98.83
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA 98.8
3lmb_A165 Uncharacterized protein; protein OLEI01261, unknown fun 98.68
2own_A 262 Putative oleoyl-[acyl-carrier protein] thioesterase; NP 98.68
2ess_A 248 Acyl-ACP thioesterase; NP_810988.1, structural genomics 98.59
2cwz_A141 Thioesterase family protein; structural genomics, NPPSF 98.17
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratas 97.9
3bbj_A 272 Putative thioesterase II; structural genomics, joint ce 97.69
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydr 97.68
3cjy_A 259 Putative thioesterase; YP_496845.1, structural genomics 97.62
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, beta-hyd 97.47
1c8u_A 285 Acyl-COA thioesterase II; internal repeats, hydrolase; 97.42
2q78_A153 Uncharacterized protein; TM0581, structural genomics, j 97.31
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratas 97.19
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural proteomics 97.14
2own_A262 Putative oleoyl-[acyl-carrier protein] thioesterase; NP 97.02
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhy 96.52
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, str 96.4
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural 96.38
3khp_A311 MAOC family protein; dehydrogenase, oxidoreductase, str 95.89
3esi_A129 Uncharacterized protein; protein from erwinia carotovor 95.78
1q6w_A161 Monoamine oxidase regulatory protein, putative; structu 95.66
2bi0_A337 Hypothetical protein RV0216; conserved hypothetical, ho 95.08
3kh8_A332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Ph 91.21
1tbu_A118 Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeas 96.97
2b3n_A159 Hypothetical protein AF1124; structural genomics, PSI, 96.21
2bi0_A 337 Hypothetical protein RV0216; conserved hypothetical, ho 96.67
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural genomics, structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-39  Score=249.75  Aligned_cols=128  Identities=38%  Similarity=0.614  Sum_probs=120.4

Q ss_pred             ECCCCCCCEEEEEEECHHHCCCCCCEEHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEECCCCCCCEEEEEEEEEEE
Q ss_conf             30589983489998483342747843089999999999999999973898325575203432146757389999999962
Q gi|254780992|r   25 CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKI  104 (152)
Q Consensus        25 ~~~~~~~~~~l~~~~~P~~~N~~G~lfGG~ll~~~D~aa~~~A~~~~~~~~vt~~id~i~F~~Pv~~Gd~l~~~a~V~~~  104 (152)
                      ....|+|+++++.+++|+|+|++|++|||+||+|||++|+++|++++++++||+++|+++|++|+++||+|+++|+|+|+
T Consensus         8 ~~~~~~g~~~~~~~v~P~~~N~~G~l~GG~l~~~~D~~a~~~a~~~~~~~~vt~svd~i~F~~pv~~Gd~i~~~a~V~~~   87 (153)
T 3bjk_A            8 NGRQSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQCLKV   87 (153)
T ss_dssp             ----CCSEEEEEEECCGGGBCTTSSBCHHHHHHHHHHHHHHHHHHHHTSCEEEEEEEEEEECSCCCTTCEEEEEEEEEEE
T ss_pred             CCCCCCCEEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEEECCCCCCCEEEEEEEEEEE
T ss_conf             88899856999998174235879808489999999999999999876994699997248873322799689999999984


Q ss_pred             CCCEEEEEEEEEEECCCC-CCCEEEEEEEEEEEEEEECCCCCCCCCCCC
Q ss_conf             165079999999953778-886089999999999998789880227999
Q gi|254780992|r  105 GKTSVTIYCDVWTCPRNA-SSDVLQKTCEATVVMVAVDEKGNPKSIRTE  152 (152)
Q Consensus       105 G~tSm~V~V~V~~~~~~~-~~~~~~~v~~a~fTfVavDe~g~P~pip~e  152 (152)
                      |+|||+|.++||+++... ..++.+++++|+||||++|++|+|+|||+|
T Consensus        88 GrsS~~V~v~v~~e~~~~~~~ge~~~~~~a~fTfVavD~~gkp~~vP~~  136 (153)
T 3bjk_A           88 GRSSIKIKVEVWVKKVASEPIGERYCVTDAVFTFVAVDNNGRSRTIPRE  136 (153)
T ss_dssp             CSSEEEEEEEEEEECSSSSSTTCEEEEEEEEEEEEEBCTTSCBCCCCCT
T ss_pred             CCEEEEEEEEEEEECCCCCCCCEEEEEEEEEEEEEEECCCCCEEECCCC
T ss_conf             1377899899999615777788499999999999998999797507998



>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Agrobacterium tumefaciens str} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: COA; 1.66A {Bacillus halodurans c-125} SCOP: d.38.1.1 Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural genomics, MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consortium, SGC, cytoplasm, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein structural and functional analyses; HET: COA; 2.10A {Thermus thermophilus HB8} Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consortium, SGC, cytoplasm, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Agrobacterium tumefaciens str} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; alternative splicing, acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication; HET: COA; 1.78A {Mus musculus} Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); structural genomics, PSI- 2, protein structure initiative, joint center for structural genomics, JCSG; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, structural genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown function; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, unknown function; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Pseudomonas aeruginosa PAO1} SCOP: d.38.1.5 Back     alignment and structure
>3gek_A Putative thioesterase YHDA; X-RAY, structure genomics, NESG, KR113, Q9CHK5_lacla, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural genomics, joint center for structural genomics, JCSG; 1.50A {Shewanella loihica pv-4} Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagella, unknown function; HET: MSE; 2.60A {Campylobacter jejuni} Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella bronchiseptica} Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>3hdu_A Putative thioesterase; YP_461911.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, X-RAY diffraction, hot DOG domain acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Back     alignment and structure
>2hx5_A Hypothetical protein; NP_895880.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 1.50A {Prochlorococcus marinus str} SCOP: d.38.1.1 Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioesterase, hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori 26695} Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Back     alignment and structure
>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha JMP134} Back     alignment and structure
>1z54_A Probable thioesterase; hypothetical protein, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus HB8} SCOP: d.38.1.1 Back     alignment and structure
>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.00A {Pseudomonas putida KT2440} SCOP: d.38.1.1 Back     alignment and structure
>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics, JCSG; 2.00A {Jannaschia} SCOP: d.38.1.1 Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2egj_A Hypothetical protein AQ_1494; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A Back     alignment and structure
>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis mr-1} SCOP: d.38.1.5 Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, PSI-2, protein structure initiative; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Pseudomonas aeruginosa PAO1} SCOP: d.38.1.5 Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A Back     alignment and structure
>3lmb_A Uncharacterized protein; protein OLEI01261, unknown function, chlorobaculum tepidum TLS, structural genomics, PSI2, MCSG; HET: MSE; 2.10A {Chlorobaculum tepidum} Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioesterase; NP_784467.1, oleoyl thioesterase (putative), structural genomics; 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides thetaiotaomicron vpi-5482} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.85A {Thermus thermophilus HB8} SCOP: d.38.1.7 Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, cytoplasm, lipid A biosynthesis, lipid synthesis; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca YX} Back     alignment and structure
>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydratase, fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 1zhg_A 2oki_A 2okh_A Back     alignment and structure
>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 Back     alignment and structure
>2q78_A Uncharacterized protein; TM0581, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 Back     alignment and structure
>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioesterase; NP_784467.1, oleoyl thioesterase (putative), structural genomics; 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structural genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus dsm 4304} SCOP: d.38.1.4 Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Back     alignment and structure
>1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 152 acyl-CoA hydrolase [Candidatus Liberibacter asiaticus s
d1ylia1142 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrola 2e-22
d2gvha2116 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_ 6e-21
d1vpma_155 d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halod 2e-20
d2gvha1135 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_20 3e-20
d1y7ua1164 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus 4e-19
d1ixla_130 d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyr 3e-06
d2hboa1142 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulob 8e-08
d1wlua1116 d.38.1.5 (A:2-117) Phenylacetic acid degradation protei 1e-05
d2fs2a1131 d.38.1.5 (A:1-131) Phenylacetic acid degradation protei 3e-05
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Length = 142 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: 4HBT-like
domain: Putative acyl-coa thioester hydrolase HI0827
species: Haemophilus influenzae [TaxId: 727]
 Score = 98.5 bits (245), Expect = 2e-22
 Identities = 49/123 (39%), Positives = 69/123 (56%), Gaps = 1/123 (0%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F K
Sbjct: 2   QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIK 61

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAVDEKGNP 146
           PI V D+V  Y Q  K+G++S+ I  +VW     +          +A    VAVD  G  
Sbjct: 62  PISVGDVVCCYGQCLKVGRSSIKIKVEVWVKKVASEPIGERYCVTDAVFTFVAVDNNGRS 121

Query: 147 KSI 149
           ++I
Sbjct: 122 RTI 124


>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Length = 116 Back     information, alignment and structure
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Length = 155 Back     information, alignment and structure
>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Length = 135 Back     information, alignment and structure
>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Length = 164 Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 130 Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Length = 142 Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Length = 116 Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Length = 131 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 acyl-CoA hydrolase [Candidatus Liberibacter asiaticus s
d1ylia1142 Putative acyl-coa thioester hydrolase HI0827 {Haemophil 100.0
d1y7ua1164 Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396 100.0
d1vpma_155 Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 100.0
d2gvha2116 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium t 100.0
d2gvha1135 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium t 100.0
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentus [Ta 99.76
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus horiko 99.7
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermus the 99.62
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [TaxId 99.62
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escherichia 99.58
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginosa [Ta 99.57
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId: 562 99.55
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId: 562 99.53
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenzae [Ta 99.52
d1q4ua_140 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., st 99.48
d2f41a1111 Transcription factor FapR, C-terminal domain {Bacillus 99.4
d2ov9a1203 Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 99.37
d1lo7a_140 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS 99.27
d2hx5a1144 Hypothetical protein PMT2055 {Prochlorococcus marinus [ 99.23
d2oafa1143 Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [Tax 99.22
d1njka_133 Hypothetical protein YbaW {Escherichia coli [TaxId: 562 99.19
d2cyea1132 Probable thioesterase TTHA1846 {Thermus thermophilus [T 99.16
d1s5ua_129 Hypothetical protein YbgC {Escherichia coli [TaxId: 562 99.15
d2alia1130 Hypothetical protein PA2801 {Pseudomonas aeruginosa [Ta 99.1
d1z54a1132 Probable thioesterase TTHA0908 {Thermus thermophilus [T 99.1
d2nuja1159 Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [Ta 99.08
d2essa1149 Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [Ta 99.06
d2hlja1156 Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 99.04
d2o5ua1139 Hypothetical thioesterase PA5185 {Pseudomonas aeruginos 99.03
d2owna1147 Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus 99.0
d2gf6a1134 Hypothetical protein SSO2295 {Archaeon Sulfolobus solfa 98.99
d2oiwa1131 GK1870 orthologue {Bacillus stearothermophilus [TaxId: 98.98
d1t82a_143 Putative thioesterase SO4397 {Shewanella oneidensis [Ta 98.94
d1yoca1145 Hypothetical protein PA1835 {Pseudomonas aeruginosa [Ta 98.92
d1sh8a_153 Hypothetical protein PA5026 {Pseudomonas aeruginosa [Ta 98.87
d2fuja1118 Hypothetical protein XCC1147 {Xanthomonas campestris pv 98.82
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilus [Ta 98.01
d2owna2109 Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus 97.78
d2q78a1130 Uncharacterized protein TM0581 {Thermotoga maritima [Ta 97.47
d2bi0a1178 Hypothetical protein Rv0216/MT0226 {Mycobacterium tuber 97.33
d1z6ba1146 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria paras 97.29
d1u1za_145 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas a 97.27
d1tbua1104 Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {B 97.18
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae [Tax 96.98
d2c2ia1149 Hypothetical protein Rv0130 {Mycobacterium tuberculosis 96.88
d2bi0a2152 Hypothetical protein Rv0216/MT0226 {Mycobacterium tuber 96.68
d2essa298 Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [Ta 96.61
d1q6wa_151 Monoamine oxidase regulatory protein {Archaeon Archaeog 96.18
d2b3na1154 Hypothetical protein AF1124 {Archaeon Archaeoglobus ful 94.92
d1c8ua1114 Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} 96.45
d1s9ca1126 2-enoyl-coa hydratase domain of multifunctional peroxis 92.46
d1pn2a2124 2-enoyl-coa hydratase domain of multifunctional peroxis 91.12
d1s9ca2154 2-enoyl-coa hydratase domain of multifunctional peroxis 92.53
d1pn2a1148 2-enoyl-coa hydratase domain of multifunctional peroxis 91.19
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: 4HBT-like
domain: Putative acyl-coa thioester hydrolase HI0827
species: Haemophilus influenzae [TaxId: 727]
Probab=100.00  E-value=2.6e-39  Score=247.22  Aligned_cols=125  Identities=40%  Similarity=0.653  Sum_probs=118.7

Q ss_pred             CCCCCEEEEEEECHHHCCCCCCEEHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEECCCCCCCEEEEEEEEEEECCC
Q ss_conf             89983489998483342747843089999999999999999973898325575203432146757389999999962165
Q gi|254780992|r   28 HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKT  107 (152)
Q Consensus        28 ~~~~~~~l~~~~~P~~~N~~G~lfGG~ll~~~D~aa~~~A~~~~~~~~vt~~id~i~F~~Pv~~Gd~l~~~a~V~~~G~t  107 (152)
                      +|+|+++++.++||+|+|++|++|||++|+|||++|+++|++|+++++||+++|+++|++|+++||+|+++|+|+++|+|
T Consensus         2 ~~~g~~~~~~~v~P~~~N~~G~l~GG~l~~~~D~~a~~~A~~~~~~~~vt~~vd~i~F~~pv~~Gd~l~~~a~v~~~G~s   81 (142)
T d1ylia1           2 QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQCLKVGRS   81 (142)
T ss_dssp             CCCSEEEEEEECCGGGBCTTSCBCHHHHHHHHHHHHHHHHHHHHTSCEEEEEECCEECCSCCCTTCEEEEEEEEEEECSS
T ss_pred             CCCCEEEEEEECCCCCCCCCCCEEHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEEEECCCCCCEEEEEEEEEECCCC
T ss_conf             98757999998274224988829489999999999999999863998628998358987302567289999999651563


Q ss_pred             EEEEEEEEEEECCCCC-CCEEEEEEEEEEEEEEECCCCCCCCCCCC
Q ss_conf             0799999999537788-86089999999999998789880227999
Q gi|254780992|r  108 SVTIYCDVWTCPRNAS-SDVLQKTCEATVVMVAVDEKGNPKSIRTE  152 (152)
Q Consensus       108 Sm~V~V~V~~~~~~~~-~~~~~~v~~a~fTfVavDe~g~P~pip~e  152 (152)
                      ||+|.++|++++.... .++.+++++|+||||++|++|+|+|||++
T Consensus        82 Sm~V~v~v~~~~~~~~~~ge~~~v~~a~ftfV~vd~~gkp~~VP~~  127 (142)
T d1ylia1          82 SIKIKVEVWVKKVASEPIGERYCVTDAVFTFVAVDNNGRSRTIPRE  127 (142)
T ss_dssp             EEEEEEEEEEECCSSSSTTCEEEEEEEEEEEEEBCTTSCBCCCCCT
T ss_pred             EEEEEEEEEEECCCCCCCCEEEEEEEEEEEEEEECCCCCEECCCCC
T ss_conf             0789899999725557667599999999999998999798637998



>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure