254780993

254780993

hypothetical protein CLIBASIA_04470

GeneID in NCBI database:8210015Locus tag:CLIBASIA_04470
Protein GI in NCBI database:254780993Protein Accession:YP_003065406.1
Gene range:+(989524, 990363)Protein Length:279aa
Gene description:hypothetical protein
COG prediction:[R] Predicted permeases
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM8 TM-Helix
TOPPRED7 TM-Helix
HMMTOP10 TM-Helix
MEMSAT10 TM-Helix
MEMSAT_SVM8 TM-Helix
PHOBIUS8 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MYDLLYNFSLMVFLSKDCVVDYICLIIVASFLSGTLSGLFGVGGGLVMVPVLSKAFQLMGIDDSICMHVAMGTSLGVIAPTSVMSFMEHRRHGTINMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILMLKRDRLYCERKFPDNYVKYIWGMVTGFLSGALGVGGGIFTNLLMLFYGASIYKATATSAGVSALIAFPALLVRIYSGWGLNGLPPWSLGFVNIGAVLIILPISILITPLATKLSYMIGKKYLTIGFSMIMFTTSFVFA
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHc
ccccccccccHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccHcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHcc
MYDLLYNFSLMVFLSKDCVVDYICLIIVASFLSGTlsglfgvgggLVMVPVLSKAFQlmgiddsicMHVAMGtslgviaptsvmsfmehrrhgtiNMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILMLKrdrlycerkfpdnyVKYIWGMVTGFLSGALGVGGGIFTNLLMLFYGASIYKATATSAGVSALIAFPALLVRIYsgwglnglppwslgfvnIGAVLIILPISILITPLATKLSYMIGKKYLTIGFSMIMFTTSFVFA
MYDLLYNFSLMVFLSKDCVVDYICLIIVASFLSGTLSGLFGVGGGLVMVPVLSKAFQLMGIDDSICMHVAMGTSLGVIAPTSVMSFMEHRRHGTINMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILMLKRDRLYCERKFPDNYVKYIWGMVTGFLSGALGVGGGIFTNLLMLFYGASIYKATATSAGVSALIAFPALLVRIYSGWGLNGLPPWSLGFVNIGAVLIILPISILITPLATKLSYMIGKKYLTIGFSMIMFTTSFVFA
MYDLLYNFSLMVFLSKDCVVDYICLIIVAsflsgtlsglfgvggglvmvpvlsKAFQLMGIDDSICMHVAMGTSLGVIAPTSVMSFMEHRRHGTINMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILMLKRDRLYCERKFPDNYVKYIWGMVTgflsgalgvgggIFTNLLMLFYGASIYKATATSAGVSALIAFPALLVRIYSGWGLNGLPPWSLGFVNIGAVliilpisilitplATKLSYMIGKKYLTIGFSMIMFTTSFVFA
*YDLLYNFSLMVFLSKDCVVDYICLIIVASFLSGTLSGLFGVGGGLVMVPVLSKAFQLMGIDDSICMHVAMGTSLGVIAPTSVMSFMEHRRHGTINMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILML****************KYIWGMVTGFLSGALGVGGGIFTNLLMLFYGASIYKATATSAGVSALIAFPALLVRIYSGWGLNGLPPWSLGFVNIGAVLIILPISILITPLATKLSYMIGKKYLTIGFSMIMFTTSFVFA
MYDLLYNFSLMVFLSKDCVVDYICLIIVASFLSGTLSGLFGVGGGLVMVPVLSKAFQLMGIDDSICMHVAMGTSLGVIAPTSVMSFMEHRRHGTINMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILMLKRDRLYCERKFPDNYVKYIWGMVTGFLSGALGVGGGIFTNLLMLFYGASIYKATATSAGVSALIAFPALLVRIYSGWGLNGLPPWSLGFVNIGAVLIILPISILITPLATKLSYMIGKKYLTIGFSMIMFTTSFVFA
*YDLLYNFSLMVFLSKDCVVDYICLIIVASFLSGTLSGLFGVGGGLVMVPVLSKAFQLMGIDDSICMHVAMGTSLGVIAPTSVMSFMEHRRHGTINMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILMLKRDRLYCERKFPDNYVKYIWGMVTGFLSGALGVGGGIFTNLLMLFYGASIYKATATSAGVSALIAFPALLVRIYSGWGLNGLPPWSLGFVNIGAVLIILPISILITPLATKLSYMIGKKYLTIGFSMIMFTTSFVFA
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHx
oooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHo
ooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoo
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYDLLYNFSLMVFLSKDCVVDYICLIIVASFLSGTLSGLFGVGGGLVMVPVLSKAFQLMGIDDSICMHVAMGTSLGVIAPTSVMSFMEHRRHGTINMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILMLKRDRLYCERKFPDNYVKYIWGMVTGFLSGALGVGGGIFTNLLMLFYGASIYKATATSAGVSALIAFPALLVRIYSGWGLNGLPPWSLGFVNIGAVLIILPISILITPLATKLSYMIGKKYLTIGFSMIMFTTSFVFA
MYDLLYNFSLMVFLSKDCVVDYICLIIVASFLSGTLSGLFGVGGGLVMVPVLSKAFQLMGIDDSICMHVAMGTSLGVIAPTSVMSFMEHRRHGTINMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILMLKRDRLYCERKFPDNYVKYIWGMVTGFLSGALGVGGGIFTNLLMLFYGASIYKATATSAGVSALIAFPALLVRIYSGWGLNGLPPWSLGFVNIGAVLIILPISILITPLATKLSYMIGKKYLTIGFSMIMFTTSFVFA
MYDLLYNFSLMVFLSKDCVVDYICLIIVASFLSGTLSGLFGVGGGLVMVPVLSKAFQLMGIDDSICMHVAMGTSLGVIAPTSVMSFMEHRRHGTINMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILMLKRDRLYCERKFPDNYVKYIWGMVTGFLSGALGVGGGIFTNLLMLFYGASIYKATATSAGVSALIAFPALLVRIYSGWGLNGLPPWSLGFVNIGAVLIILPISILITPLATKLSYMIGKKYLTIGFSMIMFTTSFVFA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target279 hypothetical protein CLIBASIA_04470 [Candidatus Liberib
315122484260 hypothetical protein CKC_03680 [Candidatus Liberibacter 1 2e-95
163759722272 hypothetical protein HPDFL43_10222 [Hoeflea phototrophi 1 1e-45
328544450276 Membrane protein [polymorphum gilvum SL003B-26A1] Lengt 1 1e-44
227822290273 protein of unknown function DUF81 [Sinorhizobium fredii 1 4e-43
254473459273 membrane protein [Pseudovibrio sp. JE062] Length = 273 1 5e-43
310816083279 putative transmembrane protein [Ketogulonicigenium vulg 1 3e-41
299134803284 protein of unknown function DUF81 [Afipia sp. 1NLS2] Le 1 2e-39
325293298273 hypothetical protein AGROH133_07076 [Agrobacterium sp. 1 2e-38
15889204273 hypothetical protein Atu1908 [Agrobacterium tumefaciens 1 2e-37
90418089274 conserved hypothetical membrane protein [Aurantimonas m 1 7e-37
>gi|315122484|ref|YP_004062973.1| hypothetical protein CKC_03680 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 260 Back     alignment and organism information
 Score =  353 bits (905), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 186/259 (71%), Positives = 225/259 (86%)

Query: 21  DYICLIIVASFLSGTLSGLFGVGGGLVMVPVLSKAFQLMGIDDSICMHVAMGTSLGVIAP 80
           DYI  II+ASF+SG  SG+FGVGGGL MVP+L+K FQLMG+DDSI  +VAMGTSLGVIAP
Sbjct: 2   DYIYYIIIASFISGAFSGIFGVGGGLAMVPILNKVFQLMGVDDSISTYVAMGTSLGVIAP 61

Query: 81  TSVMSFMEHRRHGTINMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGIL 140
           TS MSFMEHRRH  I+MKI+KDWI V+P+T +VTS+M++H+D+SFLNK+F+IFC L+G L
Sbjct: 62  TSFMSFMEHRRHSEIDMKIVKDWIIVIPVTVIVTSIMVTHIDQSFLNKSFSIFCSLIGCL 121

Query: 141 MLKRDRLYCERKFPDNYVKYIWGMVTGFLSGALGVGGGIFTNLLMLFYGASIYKATATSA 200
           ML +DR   ++ FPDNY+KY WG+V GFLSG+LGVGGG+F  +LMLFYG+SIYKATA S+
Sbjct: 122 MLVKDRFCYKKSFPDNYLKYFWGVVIGFLSGSLGVGGGVFCTILMLFYGSSIYKATAISS 181

Query: 201 GVSALIAFPALLVRIYSGWGLNGLPPWSLGFVNIGAVLIILPISILITPLATKLSYMIGK 260
            VS LI+FP +LVRIYSGWG+ GLPP S+GFVNIGA+  ILPISIL+TP  TKLSYMIGK
Sbjct: 182 AVSVLISFPGVLVRIYSGWGVEGLPPLSIGFVNIGAIFFILPISILVTPFFTKLSYMIGK 241

Query: 261 KYLTIGFSMIMFTTSFVFA 279
           KYL+IGFSM+MFTTSF+FA
Sbjct: 242 KYLSIGFSMLMFTTSFLFA 260


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163759722|ref|ZP_02166807.1| hypothetical protein HPDFL43_10222 [Hoeflea phototrophica DFL-43] Length = 272 Back     alignment and organism information
>gi|328544450|ref|YP_004304559.1| Membrane protein [polymorphum gilvum SL003B-26A1] Length = 276 Back     alignment and organism information
>gi|227822290|ref|YP_002826261.1| protein of unknown function DUF81 [Sinorhizobium fredii NGR234] Length = 273 Back     alignment and organism information
>gi|254473459|ref|ZP_05086856.1| membrane protein [Pseudovibrio sp. JE062] Length = 273 Back     alignment and organism information
>gi|310816083|ref|YP_003964047.1| putative transmembrane protein [Ketogulonicigenium vulgare Y25] Length = 279 Back     alignment and organism information
>gi|299134803|ref|ZP_07027995.1| protein of unknown function DUF81 [Afipia sp. 1NLS2] Length = 284 Back     alignment and organism information
>gi|325293298|ref|YP_004279162.1| hypothetical protein AGROH133_07076 [Agrobacterium sp. H13-3] Length = 273 Back     alignment and organism information
>gi|15889204|ref|NP_354885.1| hypothetical protein Atu1908 [Agrobacterium tumefaciens str. C58] Length = 273 Back     alignment and organism information
>gi|90418089|ref|ZP_01226001.1| conserved hypothetical membrane protein [Aurantimonas manganoxydans SI85-9A1] Length = 274 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target279 hypothetical protein CLIBASIA_04470 [Candidatus Liberib
COG0730258 COG0730, COG0730, Predicted permeases [General function 2e-09
pfam01925236 pfam01925, TauE, Sulfite exporter TauE/SafE 3e-20
pfam01925236 pfam01925, TauE, Sulfite exporter TauE/SafE 7e-05
>gnl|CDD|31074 COG0730, COG0730, Predicted permeases [General function prediction only] Back     alignment and domain information
>gnl|CDD|145216 pfam01925, TauE, Sulfite exporter TauE/SafE Back     alignment and domain information
>gnl|CDD|145216 pfam01925, TauE, Sulfite exporter TauE/SafE Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 279 hypothetical protein CLIBASIA_04470 [Candidatus Liberib
COG0730258 Predicted permeases [General function prediction only] 100.0
PRK10621269 hypothetical protein; Provisional 100.0
pfam01925236 TauE Sulfite exporter TauE/SafE. This is a family of in 100.0
COG0730258 Predicted permeases [General function prediction only] 99.56
PRK10621269 hypothetical protein; Provisional 99.44
pfam01925236 TauE Sulfite exporter TauE/SafE. This is a family of in 99.36
COG2119190 Predicted membrane protein [Function unknown] 97.89
PRK00281268 undecaprenyl pyrophosphate phosphatase; Reviewed 97.78
pfam02673255 BacA Bacitracin resistance protein BacA. Bacitracin res 97.39
PRK12554277 undecaprenyl pyrophosphate phosphatase; Reviewed 96.95
pfam04018250 DUF368 Domain of unknown function (DUF368). Predicted t 96.72
TIGR00427206 TIGR00427 conserved hypothetical protein TIGR00427; Int 94.92
COG2095203 MarC Multiple antibiotic transporter [Intracellular tra 92.38
COG1968270 BacA Undecaprenyl pyrophosphate phosphatase [Lipid tran 91.04
PRK10739197 putative dITP- and XTP- hydrolase; Provisional 96.45
PRK10995222 multiple drug resistance protein MarC; Provisional 95.38
PRK11111214 hypothetical protein; Provisional 95.07
pfam01914203 MarC MarC family integral membrane protein. Integral me 95.03
COG1971190 Predicted membrane protein [Function unknown] 91.68
PRK10520205 rhtB homoserine/homoserine lactone efflux protein; Prov 95.73
pfam01810191 LysE LysE type translocator. This family consists of va 95.56
PRK11469206 hypothetical protein; Provisional 93.46
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transport a 92.7
PRK06814 1139 acylglycerophosphoethanolamine acyltransferase; Provisi 92.33
PRK09556463 uhpT sugar phosphate antiporter; Reviewed 90.27
>COG0730 Predicted permeases [General function prediction only] Back     alignment and domain information
>PRK10621 hypothetical protein; Provisional Back     alignment and domain information
>pfam01925 TauE Sulfite exporter TauE/SafE Back     alignment and domain information
>COG0730 Predicted permeases [General function prediction only] Back     alignment and domain information
>PRK10621 hypothetical protein; Provisional Back     alignment and domain information
>pfam01925 TauE Sulfite exporter TauE/SafE Back     alignment and domain information
>COG2119 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK00281 undecaprenyl pyrophosphate phosphatase; Reviewed Back     alignment and domain information
>pfam02673 BacA Bacitracin resistance protein BacA Back     alignment and domain information
>PRK12554 undecaprenyl pyrophosphate phosphatase; Reviewed Back     alignment and domain information
>pfam04018 DUF368 Domain of unknown function (DUF368) Back     alignment and domain information
>TIGR00427 TIGR00427 conserved hypothetical protein TIGR00427; InterPro: IPR002771 Members of this family are integral membrane proteins that includes the antibiotic resistance protein MarC Back     alignment and domain information
>COG2095 MarC Multiple antibiotic transporter [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1968 BacA Undecaprenyl pyrophosphate phosphatase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10739 putative dITP- and XTP- hydrolase; Provisional Back     alignment and domain information
>PRK10995 multiple drug resistance protein MarC; Provisional Back     alignment and domain information
>PRK11111 hypothetical protein; Provisional Back     alignment and domain information
>pfam01914 MarC MarC family integral membrane protein Back     alignment and domain information
>COG1971 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK10520 rhtB homoserine/homoserine lactone efflux protein; Provisional Back     alignment and domain information
>pfam01810 LysE LysE type translocator Back     alignment and domain information
>PRK11469 hypothetical protein; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00