254780995

254780995

Endonuclease/exonuclease/phosphatase

GeneID in NCBI database:8210017Locus tag:CLIBASIA_04480
Protein GI in NCBI database:254780995Protein Accession:YP_003065408.1
Gene range:-(991050, 991427)Protein Length:125aa
Gene description:Endonuclease/exonuclease/phosphatase
COG prediction:none
KEGG prediction:endonuclease/exonuclease/phosphatase
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MLSQQGEWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQEKESTCNVIKRNKSSLDYFVIDRDNKNFLIDNSFSIVSYDQSDLDTRRSKLSTHCPLTIEYDFEKGNV
ccccHHHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHccccEEEEEccccccccHHHHHcccccccEEEEEcccccEEEEccEEEEEEcccHHHHHHHHccccccEEEEEEcccccc
cHHHHHHHHHHHHHHHHHccccEEEHccHHHHHHHHcccccHHHHcccccccEccccHHHcEEEEEEcccccccEEEEccHHHHHHHHcccEEEEcccccHHHHHHHHcccccEEEEEEcccccc
MLSQQGEWLKKWADQkiktgipfviagdfnrkinsigdtddfwqkmdpdgllirfpqekestcnvikrnkssldyfvidrdnknflidnsfsivsydqsdldtrrsklsthcpltieydfekgnv
MLSQQGEWLKKWADQKIKTgipfviagdfnrKINSIGDTDDFWQKMDPDGLLIrfpqekestcnvikrnkssldyFVIDRDNKNFLIDNSFSIVsydqsdldtrrsklsthcpltieydfekgnv
MLSQQGEWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQEKESTCNVIKRNKSSLDYFVIDRDNKNFLIDNSFSIVSYDQSDLDTRRSKLSTHCPLTIEYDFEKGNV
**SQQGEWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQE*E***NVIKRNKSSLDYFVIDRDNKNFLIDNSFSIVSYDQSDLDTRRSKLSTHCPLTIEYDFE****
MLSQQGEWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQEKESTCNVIKRNKSSLDYFVIDRDNKNFLIDNSFSIVSYDQSDLDTRRSKLSTHCPLTIEYDFEKGNV
MLSQQGEWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQEKESTCNVIKRNKSSLDYFVIDRDNKNFLIDNSFSIVSYDQSDLDTRRSKLSTHCPLTIEYDFE****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSQQGEWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQEKESTCNVIKRNKSSLDYFVIDRDNKNFLIDNSFSIVSYDQSDLDTRRSKLSTHCPLTIEYDFEKGNV
MLSQQGEWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQEKESTCNVIKRNKSSLDYFVIDRDNKNFLIDNSFSIVSYDQSDLDTRRSKLSTHCPLTIEYDFEKGNV
MLSQQGEWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQEKESTCNVIKRNKSSLDYFVIDRDNKNFLIDNSFSIVSYDQSDLDTRRSKLSTHCPLTIEYDFEKGNV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target125 Endonuclease/exonuclease/phosphatase [Candidatus Liberi
254781003304 hypothetical protein CLIBASIA_04520 [Candidatus Li 3e-37
254780797231 hypothetical protein CLIBASIA_03440 [Candidatus Li 1e-14
>gi|254781003|ref|YP_003065416.1| hypothetical protein CLIBASIA_04520 [Candidatus Liberibacter asiaticus str. psy62] Length = 304 Back     alignment
 Score =  145 bits (365), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 92/122 (75%), Gaps = 2/122 (1%)

Query: 1   MLSQQGEWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQEKE 60
           +LSQQ +WLK W  QK ++ +PFVIAGDFNRKIN +G+ DDFW+ +DP+  LIRFP+EK+
Sbjct: 183 LLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKD 242

Query: 61  STCNVIK--RNKSSLDYFVIDRDNKNFLIDNSFSIVSYDQSDLDTRRSKLSTHCPLTIEY 118
           S CN  K  RNK  +DYFV+D++   FLI  SFS + Y++ D+ +R  +LS HCP++I+Y
Sbjct: 243 SRCNANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDY 302

Query: 119 DF 120
           DF
Sbjct: 303 DF 304

>gi|254780797|ref|YP_003065210.1| hypothetical protein CLIBASIA_03440 [Candidatus Liberibacter asiaticus str. psy62] Length = 231 Back     alignment
 Score = 70.5 bits (171), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 2/61 (3%)

Query: 1   MLSQQGEWLKKWADQKIKTGIPFVIAGDFNRKIN--SIGDTDDFWQKMDPDGLLIRFPQE 58
           ML+ Q  WLK+W DQK    +PF+IAGDFNRKIN    G  D+ WQK++ D  L+R P +
Sbjct: 159 MLNLQATWLKQWVDQKNNLNMPFIIAGDFNRKINHSHSGIKDELWQKINQDNTLMRLPHK 218

Query: 59  K 59
           K
Sbjct: 219 K 219

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target125 Endonuclease/exonuclease/phosphatase [Candidatus Liberi
254781003304 hypothetical protein CLIBASIA_04520 [Candidatus Liberib 1 2e-33
315122019315 hypothetical protein CKC_01345 [Candidatus Liberibacter 1 2e-28
254780797231 hypothetical protein CLIBASIA_03440 [Candidatus Liberib 1 8e-11
90412878320 hypothetical protein P3TCK_26405 [Photobacterium profun 1 1e-08
162147973290 endonuclease/exonuclease/phosphatase family protein [Gl 1 3e-08
262195540406 endonuclease/exonuclease/phosphatase [Haliangium ochrac 1 4e-08
54309887319 hypothetical protein PBPRA2733 [Photobacterium profundu 1 4e-07
296115009293 Endonuclease/exonuclease/phosphatase [Gluconacetobacter 1 3e-04
254508339295 metal-dependent hydrolase [Vibrio parahaemolyticus 16] 1 5e-04
114798114442 endonuclease/exonuclease/phosphatase family protein [Hy 1 0.003
>gi|254781003|ref|YP_003065416.1| hypothetical protein CLIBASIA_04520 [Candidatus Liberibacter asiaticus str. psy62] Length = 304 Back     alignment and organism information
 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 92/122 (75%), Gaps = 2/122 (1%)

Query: 1   MLSQQGEWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQEKE 60
           +LSQQ +WLK W  QK ++ +PFVIAGDFNRKIN +G+ DDFW+ +DP+  LIRFP+EK+
Sbjct: 183 LLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKD 242

Query: 61  STCNVIK--RNKSSLDYFVIDRDNKNFLIDNSFSIVSYDQSDLDTRRSKLSTHCPLTIEY 118
           S CN  K  RNK  +DYFV+D++   FLI  SFS + Y++ D+ +R  +LS HCP++I+Y
Sbjct: 243 SRCNANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDY 302

Query: 119 DF 120
           DF
Sbjct: 303 DF 304


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122019|ref|YP_004062508.1| hypothetical protein CKC_01345 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 315 Back     alignment and organism information
>gi|254780797|ref|YP_003065210.1| hypothetical protein CLIBASIA_03440 [Candidatus Liberibacter asiaticus str. psy62] Length = 231 Back     alignment and organism information
>gi|90412878|ref|ZP_01220878.1| hypothetical protein P3TCK_26405 [Photobacterium profundum 3TCK] Length = 320 Back     alignment and organism information
>gi|162147973|ref|YP_001602434.1| endonuclease/exonuclease/phosphatase family protein [Gluconacetobacter diazotrophicus PAl 5] Length = 290 Back     alignment and organism information
>gi|262195540|ref|YP_003266749.1| endonuclease/exonuclease/phosphatase [Haliangium ochraceum DSM 14365] Length = 406 Back     alignment and organism information
>gi|54309887|ref|YP_130907.1| hypothetical protein PBPRA2733 [Photobacterium profundum SS9] Length = 319 Back     alignment and organism information
>gi|296115009|ref|ZP_06833653.1| Endonuclease/exonuclease/phosphatase [Gluconacetobacter hansenii ATCC 23769] Length = 293 Back     alignment and organism information
>gi|254508339|ref|ZP_05120461.1| metal-dependent hydrolase [Vibrio parahaemolyticus 16] Length = 295 Back     alignment and organism information
>gi|114798114|ref|YP_760171.1| endonuclease/exonuclease/phosphatase family protein [Hyphomonas neptunium ATCC 15444] Length = 442 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 125 Endonuclease/exonuclease/phosphatase [Candidatus Liberi
TIGR00633279 xth exodeoxyribonuclease III (xth); InterPro: IPR004808 99.83
TIGR00195281 exoDNase_III exodeoxyribonuclease III; InterPro: IPR000 99.83
COG0708261 XthA Exonuclease III [DNA replication, recombination, a 99.75
PRK11756268 exonuclease III; Provisional 99.72
PRK13911250 hypothetical protein; Provisional 99.59
COG3568259 ElsH Metal-dependent hydrolase [General function predic 99.45
pfam03372255 Exo_endo_phos Endonuclease/Exonuclease/phosphatase fami 99.36
TIGR03395283 sphingomy sphingomyelin phosphodiesterase. Members of t 99.31
COG2374798 Predicted extracellular nuclease [General function pred 99.18
smart00476276 DNaseIc deoxyribonuclease I. Deoxyribonuclease I cataly 99.07
PRK05421254 hypothetical protein; Provisional 98.93
COG3021309 Uncharacterized protein conserved in bacteria [Function 98.77
KOG3873 422 consensus 98.02
KOG0620361 consensus 97.94
COG5239378 CCR4 mRNA deadenylase, exonuclease subunit and related 97.42
PTZ00297 1452 pantothenate kinase; Provisional 97.06
KOG1294335 consensus 96.69
KOG2756349 consensus 95.98
KOG2338495 consensus 97.71
KOG0566 1080 consensus 97.58
smart00128310 IPPc Inositol polyphosphate phosphatase, catalytic doma 97.4
COG5411 460 Phosphatidylinositol 5-phosphate phosphatase [Signal tr 94.9
>TIGR00633 xth exodeoxyribonuclease III (xth); InterPro: IPR004808 All proteins in this family for which functions are known are 5' AP endonucleases that function in base excision repair and the repair of abasic sites in DNA Back     alignment and domain information
>TIGR00195 exoDNase_III exodeoxyribonuclease III; InterPro: IPR000097 DNA damaging agents such as the antitumor drugs bleomycin and neocarzinostatin or those that generate oxygen radicals produce a variety of lesions in DNA Back     alignment and domain information
>COG0708 XthA Exonuclease III [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11756 exonuclease III; Provisional Back     alignment and domain information
>PRK13911 hypothetical protein; Provisional Back     alignment and domain information
>COG3568 ElsH Metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>pfam03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family Back     alignment and domain information
>TIGR03395 sphingomy sphingomyelin phosphodiesterase Back     alignment and domain information
>COG2374 Predicted extracellular nuclease [General function prediction only] Back     alignment and domain information
>smart00476 DNaseIc deoxyribonuclease I Back     alignment and domain information
>PRK05421 hypothetical protein; Provisional Back     alignment and domain information
>COG3021 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3873 consensus Back     alignment and domain information
>KOG0620 consensus Back     alignment and domain information
>COG5239 CCR4 mRNA deadenylase, exonuclease subunit and related nucleases [RNA processing and modification] Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>KOG1294 consensus Back     alignment and domain information
>KOG2756 consensus Back     alignment and domain information
>KOG2338 consensus Back     alignment and domain information
>KOG0566 consensus Back     alignment and domain information
>smart00128 IPPc Inositol polyphosphate phosphatase, catalytic domain homologues Back     alignment and domain information
>COG5411 Phosphatidylinositol 5-phosphate phosphatase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target125 Endonuclease/exonuclease/phosphatase [Candidatus Liberi
1ako_A268 Exonuclease Iii From Escherichia Coli Length = 268 1e-11
2jc4_A256 3'-5' Exonuclease (Nexo) From Neisseria Meningitidi 1e-11
2jc5_A259 Apurinic Apyrimidinic (Ap) Endonuclease (Nape) From 2e-08
1e9n_A318 A Second Divalent Metal Ion In The Active Site Of A 6e-08
2isi_A317 Crystal Structure Of Ape1 From Homo Sapiens In A Ne 7e-08
1bix_A287 The Crystal Structure Of The Human Dna Repair Endon 1e-07
2o3h_A285 Crystal Structure Of The Human C65a Ape Length = 28 1e-07
1dew_A279 Crystal Structure Of Human Ape1 Bound To Abasic Dna 1e-07
1de8_B276 Human ApurinicAPYRIMIDINIC ENDONUCLEASE-1 (Ape1) Bo 2e-07
3fzi_A265 1.9 Angstrom Structure Of The Thermophilic Exonucle 8e-07
3g91_A265 1.2 Angstrom Structure Of The Exonuclease Iii Homol 9e-07
2voa_A257 Structure Of An Ap Endonuclease From Archaeoglobus 1e-06
2o3c_A282 Crystal Structure Of Zebrafish Ape Length = 282 2e-06
3g00_A265 Mth0212 In Complex With A 9bp Blunt End Dsdna At 1. 3e-06
3mpr_A298 Crystal Structure Of EndonucleaseEXONUCLEASEPHOSPHA 1e-04
3g6s_A267 Crystal Structure Of The EndonucleaseEXONUCLEASEPHO 2e-04
gi|157829928|pdb|1AKO|A Chain A, Exonuclease Iii From Escherichia Coli Length = 268 Back     alignment and structure
 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 17/138 (12%), Positives = 35/138 (25%), Gaps = 25/138 (18%)

Query: 7   EWLKKWADQKIKTGIPFVIAGDFNRKINSIGD----------------------TDDFWQ 44
           + L+ + + ++K   P +I GD N     +                         +   +
Sbjct: 130 QNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFLPEEREWMDR 189

Query: 45  KMDPDGLLIRFPQEKES---TCNVIKRNKSSLDYFVIDRDNKNFLIDNSFSIVSYDQSDL 101
            M    +        ++         R+K   D   +  D        +   V       
Sbjct: 190 LMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAECCVETGIDYE 249

Query: 102 DTRRSKLSTHCPLTIEYD 119
                K S H P+   + 
Sbjct: 250 IRSMEKPSDHAPVWATFR 267


gi|134104765|pdb|2JC4|A Chain A, 3'-5' Exonuclease (Nexo) From Neisseria Meningitidis Length = 256 Back     alignment and structure
gi|157883966|pdb|2JC5|A Chain A, Apurinic Apyrimidinic (Ap) Endonuclease (Nape) From Neisseria Meningitidis Length = 259 Back     alignment and structure
gi|13399540|pdb|1E9N|A Chain A, A Second Divalent Metal Ion In The Active Site Of A New Crystal Form Of Human ApurinicAPYRIMIDINIC ENDONUCLEASE, Ape1, And Its Implications For The Catalytic Mechanism Length = 318 Back     alignment and structure
>gi|118138505|pdb|2ISI|A Chain A, Crystal Structure Of Ape1 From Homo Sapiens In A New Crystal Form Complexed With A Ligand Length = 317 Back     alignment and structure
>gi|157830335|pdb|1BIX|A Chain A, The Crystal Structure Of The Human Dna Repair Endonuclease Hap1 Suggests The Recognition Of Extra-Helical Deoxyribose At Dna Abasic Sites Length = 287 Back     alignment and structure
>gi|162329924|pdb|2O3H|A Chain A, Crystal Structure Of The Human C65a Ape Length = 285 Back     alignment and structure
>gi|6980832|pdb|1DEW|A Chain A, Crystal Structure Of Human Ape1 Bound To Abasic Dna Length = 279 Back     alignment and structure
>gi|6980804|pdb|1DE8|B Chain B, Human ApurinicAPYRIMIDINIC ENDONUCLEASE-1 (Ape1) Bound To Abasic Dna Length = 276 Back     alignment and structure
>gi|290789945|pdb|3FZI|A Chain A, 1.9 Angstrom Structure Of The Thermophilic Exonuclease Iii Homologue Mth0212 Length = 265 Back     alignment and structure
>gi|290789984|pdb|3G91|A Chain A, 1.2 Angstrom Structure Of The Exonuclease Iii Homologue Mth0212 Length = 265 Back     alignment and structure
>gi|217035255|pdb|2VOA|A Chain A, Structure Of An Ap Endonuclease From Archaeoglobus Fulgidus Length = 257 Back     alignment and structure
>gi|162329921|pdb|2O3C|A Chain A, Crystal Structure Of Zebrafish Ape Length = 282 Back     alignment and structure
>gi|290789946|pdb|3G00|A Chain A, Mth0212 In Complex With A 9bp Blunt End Dsdna At 1.7 Angstrom Length = 265 Back     alignment and structure
>gi|296863686|pdb|3MPR|A Chain A, Crystal Structure Of EndonucleaseEXONUCLEASEPHOSPHATASE FA Protein From Bacteroides Thetaiotaomicron, Northeast Struct Genomics Consortium Target Btr318a Length = 298 Back     alignment and structure
>gi|223674122|pdb|3G6S|A Chain A, Crystal Structure Of The EndonucleaseEXONUCLEASEPHOSPHATASE (BVU_0621) FROM Bacteroides Vulgatus. Northeast Structural Genomics Consortium Target Bvr56d Length = 267 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target125 Endonuclease/exonuclease/phosphatase [Candidatus Liberi
2j63_A467 AP-endonuclease; base excision repair, lyase; 2.48A {Le 99.59
3l1w_A257 Uncharacterized protein; APC29019.2, conserved protein, 99.54
3g6s_A267 Putative endonuclease/exonuclease/phosphatase family pr 99.47
3mpr_A298 Putative endonuclease/exonuclease/phosphatase FAM prote 99.43
2ddr_A306 Sphingomyelin phosphodiesterase; DNAse I like folding, 99.43
3i41_A317 Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1. 99.42
1ako_A268 Exonuclease III; AP-endonuclease, DNA repair; 1.70A {Es 99.4
1zwx_A301 SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpi 99.38
3ngq_A398 CCR4-NOT transcription complex subunit 6-like; alpha/be 99.38
2jc4_A256 Exodeoxyribonuclease III; hydrolase, repair phosphodies 99.38
2a40_B260 Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse I, A 99.36
1hd7_A318 DNA-(apurinic or apyrimidinic site) lyase; DNA repair, 99.33
1sr4_B261 CDT B, cytolethal distending toxin protein B; bacterial 99.27
2voa_A257 AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP endo 99.21
2f1n_A262 CDT B, cytolethal distending toxin subunit B; E.coli, D 99.15
3g91_A265 MTH0212, exodeoxyribonuclease; double-strand specific 3 99.15
2o3h_A285 DNA-(apurinic or apyrimidinic site) lyase; APE, endonuc 99.15
1wdu_A245 TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA bind 99.06
1vyb_A238 ORF2 contains A reverse transcriptase domain; endonucle 98.99
2imq_X282 Salivary nitrophorin; ferrous heme, beta-sandwich, tran 98.98
3nr8_B316 Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; stru 98.89
1i9z_A347 Synaptojanin, phosphatidylinositol phosphate phosphatas 98.78
2ei9_A240 Non-LTR retrotransposon R1BMKS ORF2 protein; four layer 98.63
3mtc_A313 Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP 98.97
2xsw_A357 72 kDa inositol polyphosphate 5-phosphatase; inositol s 98.55
2jc5_A259 Exodeoxyribonuclease; hydrolase, repair phosphodiestera 98.51
>2j63_A AP-endonuclease; base excision repair, lyase; 2.48A {Leishmania major} Back     alignment and structure
Probab=99.59  E-value=3.1e-15  Score=100.46  Aligned_cols=98  Identities=16%  Similarity=0.202  Sum_probs=57.2

Q ss_pred             CCCCCEEEEEECCCCCCCCCCCCH-------------------HHHHCCCCC---CCHHH-CCCCCCCCCCCCCCCCCCC
Q ss_conf             169988999614777688310027-------------------876326554---10000-2576768710388755433
Q gi|254780995|r   18 KTGIPFVIAGDFNRKINSIGDTDD-------------------FWQKMDPDG---LLIRF-PQEKESTCNVIKRNKSSLD   74 (125)
Q Consensus        18 ~~~~pvIi~GDFN~~~~~~~~~~~-------------------~~~~l~~~~---~~~~~-~~~~~~~~~~~~~~~~~~d   74 (125)
                      ..+.|+|||||||+.+.+.+.+..                   +.+.+...+   .++.. +.....+|||..+...+..
T Consensus       345 ~~~~~vIl~GDfNv~~~~~D~~~~~~~~~~~~~~g~~~eER~~~~~~l~~~glvDafR~~hP~~~~~YT~W~~r~~~r~~  424 (467)
T 2j63_A          345 SSPHGFIWAGDLNVAERDYDRYYAGTFKSMQECSGFAPEERMSFRETMQRTNSVDIFRQLYPQAGPVYSFWSQRINGRPR  424 (467)
T ss_dssp             CCSCEEEEEEECCCCCSTTSBCCCSCHHHHTTSTTSCHHHHHHHHHHHHHTTEEEHHHHHCTTBCSCCSBCCTTTTTTTT
T ss_pred             CCCCCEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             25774687244355752110222232430367877898999999999986798994430359989983882877784325


Q ss_pred             CCCCCCHHHHCCCCCCC--EEEEECCCCCCCCCCCCCCCCCEEEEEECC
Q ss_conf             35521012100257321--154302474112586788756499999616
Q gi|254780995|r   75 YFVIDRDNKNFLIDNSF--SIVSYDQSDLDTRRSKLSTHCPLTIEYDFE  121 (125)
Q Consensus        75 ~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~SDH~PV~~~l~f~  121 (125)
                        ..+.|||+++++..+  ++..+.+.    ...++||||||+++|.|.
T Consensus       425 --n~G~RIDyilvS~~L~~~V~~~~I~----~~~~gSDH~PV~l~Lr~p  467 (467)
T 2j63_A          425 --NLGWRLDYFVVSSRLASYVVDCFPM----PTVMGSDHCPFQMWMRHP  467 (467)
T ss_dssp             --TCCBCCEEEEEEGGGGGGEEEEEEC----TTCCSSSBCCEEEEEECC
T ss_pred             --CCCEEEEEEEECHHHHHHCEEEEEC----CCCCCCCCCCEEEEEECC
T ss_conf             --9866025999776997023089986----899968804649998689



>3l1w_A Uncharacterized protein; APC29019.2, conserved protein, enterococcus faecalis V583, PSI-2, MCSG, structural genomics; 1.60A {Enterococcus faecalis} Back     alignment and structure
>3g6s_A Putative endonuclease/exonuclease/phosphatase family protein; alpha-beta protein, structural genomics, PSI-2; 2.50A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3mpr_A Putative endonuclease/exonuclease/phosphatase FAM protein; structural genomics, PSI-2, protein structure initiative; HET: MSE PEG; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ddr_A Sphingomyelin phosphodiesterase; DNAse I like folding, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.40A {Bacillus cereus} SCOP: d.151.1.3 PDB: 2dds_A 2ddt_A* 2uyr_X Back     alignment and structure
>3i41_A Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1.75A {Staphylococcus aureus RN4220} PDB: 3i46_A 3i48_A Back     alignment and structure
>1ako_A Exonuclease III; AP-endonuclease, DNA repair; 1.70A {Escherichia coli K12} SCOP: d.151.1.1 Back     alignment and structure
>1zwx_A SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpin, hydrolase; 1.90A {Listeria ivanovii} SCOP: d.151.1.3 Back     alignment and structure
>3ngq_A CCR4-NOT transcription complex subunit 6-like; alpha/beta sandwich fold, hydrolase; HET: 1PS; 1.80A {Homo sapiens} PDB: 3ngo_A 3ngn_A Back     alignment and structure
>2jc4_A Exodeoxyribonuclease III; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: 1PE; 1.90A {Neisseria meningitidis} Back     alignment and structure
>2a40_B Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse I, ARP2/3, structural protein; HET: HIC NAG ATP; 1.80A {Bos taurus} SCOP: d.151.1.1 PDB: 1dnk_A* 2a3z_B* 2a41_B* 2a42_B* 2d1k_B* 2dnj_A* 3cjc_D* 3dni_A* 1atn_D* Back     alignment and structure
>1hd7_A DNA-(apurinic or apyrimidinic site) lyase; DNA repair, endonuclease, APE1, HAP1, REF-1; 1.95A {Homo sapiens} SCOP: d.151.1.1 PDB: 1e9n_A 2isi_A Back     alignment and structure
>1sr4_B CDT B, cytolethal distending toxin protein B; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: d.151.1.1 PDB: 2f2f_B Back     alignment and structure
>2voa_A AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP endonuclease, lyase; 1.7A {Archaeoglobus fulgidus} Back     alignment and structure
>2f1n_A CDT B, cytolethal distending toxin subunit B; E.coli, DNAse I, microbatch; 1.73A {Escherichia coli} SCOP: d.151.1.1 Back     alignment and structure
>3g91_A MTH0212, exodeoxyribonuclease; double-strand specific 3'-5' exonuclease, AP endonuclease; HET: PG4; 1.23A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fzi_A 3g0a_A 3g1k_A 3g2c_A 3g3c_A* 3g3y_A* 3g4t_A* 3g00_A 3g0r_A* 3g2d_A* 3g38_A 3g8v_A* 3ga6_A Back     alignment and structure
>2o3h_A DNA-(apurinic or apyrimidinic site) lyase; APE, endonuclease; 1.90A {Homo sapiens} PDB: 1bix_A 1dew_A* 1de8_B* 1de9_A* 2o3c_A Back     alignment and structure
>1wdu_A TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA binding protein; 2.40A {Bombyx mori} SCOP: d.151.1.1 Back     alignment and structure
>1vyb_A ORF2 contains A reverse transcriptase domain; endonuclease, APE-1 type, retrotransposition, retrotransposon, transferase; 1.8A {Homo sapiens} SCOP: d.151.1.1 PDB: 2v0s_A 2v0r_A Back     alignment and structure
>2imq_X Salivary nitrophorin; ferrous heme, beta-sandwich, transport protein; HET: HEM; 1.30A {Cimex lectularius} SCOP: d.151.1.2 PDB: 1ntf_A* 1y21_A* 1yjh_A* 1si6_X* Back     alignment and structure
>3nr8_B Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; structural genomics consortium, SGC, trisphosphate 5-phosphatase 2, SHIP2, INPPL1, SHIP-2; 2.80A {Homo sapiens} Back     alignment and structure
>1i9z_A Synaptojanin, phosphatidylinositol phosphate phosphatase; spsynaptojanin, IPP5C, IP3, IP2,, hydrolase; HET: 2IP; 1.80A {Schizosaccharomyces pombe} SCOP: d.151.1.2 PDB: 1i9y_A* Back     alignment and structure
>2ei9_A Non-LTR retrotransposon R1BMKS ORF2 protein; four layered alpha beta sandwich, gene regulation; 2.00A {Bombyx mori} Back     alignment and structure
>3mtc_A Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP5BA,phosphoinositide 5-phosphatase, inositol signalling, phosphatase, magnesium; HET: PIF; 2.40A {Homo sapiens} Back     alignment and structure
>2xsw_A 72 kDa inositol polyphosphate 5-phosphatase; inositol signalling, SGC stockholm, structural genomics CONS hydrolase; 1.90A {Homo sapiens} Back     alignment and structure
>2jc5_A Exodeoxyribonuclease; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: BCN DIO GOL; 1.50A {Neisseria meningitidis} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target125 Endonuclease/exonuclease/phosphatase [Candidatus Liberi
d2a40b1260 Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} 99.46
d2ddra1299 Sphingomyelin phosphodiesterase C {Bacillus cereus [Tax 99.45
d1zwxa1293 Sphingomyelin phosphodiesterase C {Listeria ivanovii [T 99.42
d1sr4b_261 Cytolethal distending toxin subunit B {Haemophilus ducr 99.23
d2f1na1250 Cytolethal distending toxin subunit B {Escherichia coli 99.18
d1hd7a_275 DNA repair endonuclease Hap1 {Human (Homo sapiens) [Tax 99.08
d2imqx1280 Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId 99.07
d1vyba_236 Endonuclease domain of LINE-1 reverse transcriptase hom 98.99
d1wdua_228 Endonuclease domain of TRAS1 retrotransposon (ORF2) {Si 98.88
d1akoa_268 DNA-repair enzyme exonuclease III {Escherichia coli [Ta 98.78
d1i9za_345 Synaptojanin, IPP5C domain {Fission yeast (Schizosaccha 98.62
>d2a40b1 d.151.1.1 (B:1-260) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: DNase I-like
superfamily: DNase I-like
family: DNase I-like
domain: Deoxyribonuclease I
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.46  E-value=3.3e-14  Score=93.71  Aligned_cols=113  Identities=12%  Similarity=0.027  Sum_probs=63.7

Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             99999999999851169988999614777688310027876326554100002576768710388755433355210121
Q gi|254780995|r    4 QQGEWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQEKESTCNVIKRNKSSLDYFVIDRDNK   83 (125)
Q Consensus         4 ~Q~~~L~~~i~~~~~~~~pvIi~GDFN~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~   83 (125)
                      +|...+.+++.+. ..+.|+|+|||||..+.+..........+.....  .........+++.......+||+++++.+.
T Consensus       145 ~~~~~~~~~~~~~-~~~~~~iv~GDfN~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~iD~i~~s~~~~  221 (260)
T d2a40b1         145 NSLYDVYLDVQQK-WHLNDVMLMGDFNADCSYVTSSQWSSIRLRTSST--FQWLIPDSADTTATSTNCAYDRIVVAGSLL  221 (260)
T ss_dssp             HHHHHHHHHHHHH-HCCCCEEEEEECCCSTTTSCGGGGGGCHHHHSTT--EEESSCTTCCCBSSSCCCCCEEEEEESHHH
T ss_pred             HHHHHHHHHHHHH-CCCCCEEECCCCCCCCCCHHHHHHHHHCCCCCCC--CCCCCCCCCCCCCCCCCCCEEEEEECCHHH
T ss_conf             8899999999863-4578879766556786523455554414322211--112678887633479998556899684461


Q ss_pred             HCC-CCCCCEEEEECCC--CCCCCCCCCCCCCCEEEEEE
Q ss_conf             002-5732115430247--41125867887564999996
Q gi|254780995|r   84 NFL-IDNSFSIVSYDQS--DLDTRRSKLSTHCPLTIEYD  119 (125)
Q Consensus        84 ~~~-~~~~~~~~~~~~~--~~~~~~~~~SDH~PV~~~l~  119 (125)
                      ... ......+..+...  .....+..+||||||+++|.
T Consensus       222 ~~~~~~~~~~v~~~~~~~~~~~~~~~~~SDH~PV~v~ls  260 (260)
T d2a40b1         222 QSSVVPGSAAPFDFQAAYGLSNEMALAISDHYPVEVTLT  260 (260)
T ss_dssp             HHHBCTTCCEECCHHHHTTCCHHHHHHHCSBCCEEEEBC
T ss_pred             CCEEECCEEEEEECCCCCCCCCCCCCCCCCCCCEEEEEC
T ss_conf             542632501442023212556335798077426799959



>d2ddra1 d.151.1.3 (A:7-305) Sphingomyelin phosphodiesterase C {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]} Back     information, alignment and structure
>d1sr4b_ d.151.1.1 (B:) Cytolethal distending toxin subunit B {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d2f1na1 d.151.1.1 (A:1-250) Cytolethal distending toxin subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hd7a_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2imqx1 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]} Back     information, alignment and structure
>d1vyba_ d.151.1.1 (A:) Endonuclease domain of LINE-1 reverse transcriptase homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdua_ d.151.1.1 (A:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori) [TaxId: 7091]} Back     information, alignment and structure
>d1akoa_ d.151.1.1 (A:) DNA-repair enzyme exonuclease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i9za_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target125 Endonuclease/exonuclease/phosphatase [Candidatus Liberi
1zwx_A_301 SMCL, sphingomyelinase-C; dnase1-like fold, beta-h 99.43
2jc4_A_256 Exodeoxyribonuclease III; hydrolase, repair phosph 99.41
3g6s_A_267 Putative endonuclease/exonuclease/phosphatase fami 99.36
2ddr_A_306 Sphingomyelin phosphodiesterase; DNAse I like fold 99.36
1hd7_A_318 DNA-(apurinic or apyrimidinic site) lyase; DNA rep 99.32
1ako_A_268 Exonuclease III; AP-endonuclease, DNA repair; 1.70 99.25
2voa_A_257 AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP 99.24
2o3h_A_285 DNA-(apurinic or apyrimidinic site) lyase; APE, en 99.05
2jc5_A_259 Exodeoxyribonuclease; hydrolase, repair phosphodie 98.93
2ei9_A_240 Non-LTR retrotransposon R1BMKS ORF2 protein; four 98.92
2imq_X_282 Salivary nitrophorin; ferrous heme, beta-sandwich, 98.85
3l1w_A_257 Uncharacterized protein; APC29019.2, conserved pro 98.83
1i9z_A_18-321304 Synaptojanin, phosphatidylinositol phosphate phosp 98.64
1wdu_A_245 TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA 98.54
1vyb_A_238 ORF2 contains A reverse transcriptase domain; endo 98.25
2f1n_A_262 CDT B, cytolethal distending toxin subunit B; E.co 97.73
2j63_A_1-134_233-439341 AP-endonuclease; base excision repair, lyase; 2.48 98.5
2a40_B_88-227140 Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse 96.89
2a40_B_1-87_228-260120 Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse 91.97
>1zwx_A (A:) SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpin, hydrolase; 1.90A {Listeria ivanovii} Back     alignment and structure
Probab=99.43  E-value=6.7e-13  Score=88.82  Aligned_cols=113  Identities=14%  Similarity=0.001  Sum_probs=61.4

Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHCCCCCCCHHHCCCCCCC-------CCCCCCCCCCCCCCCCC
Q ss_conf             99999999851169988999614777688310027876326554100002576768-------71038875543335521
Q gi|254780995|r    7 EWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQEKEST-------CNVIKRNKSSLDYFVID   79 (125)
Q Consensus         7 ~~L~~~i~~~~~~~~pvIi~GDFN~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~-------~~~~~~~~~~~d~~~~~   79 (125)
                      +.+..+.......+.|+|||||||..+.+...........................       ++........+||++++
T Consensus       174 ~~~~~~~~~~~~~~~~vii~GDfN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~i~~s  253 (301)
T 1zwx_A          174 EIQTFIAKKNIPKDEIIFIGGDLNVNYGTDEYHDMLKLLNVSSPANFNGQMATWDPTTNSMLKESYPKAAPEYLDYIFVE  253 (301)
T ss_dssp             HHHHHHHHHTCCTTSEEEEEEECCCCTTSHHHHHHHHHHTBCCCTTCCTTSCSBCTTTCHHHHHHCTTSCCBCCEEEEEB
T ss_pred             HHHHHHHHCCCCCCCEEEEEEECCCCCCCHHHHHHHHHCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEE
T ss_conf             86422210135777459999777988873678989864476650102566643354224555656578998538999973


Q ss_pred             CHHH--------HCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEEECC
Q ss_conf             0121--------00257321154302474112586788756499999616
Q gi|254780995|r   80 RDNK--------NFLIDNSFSIVSYDQSDLDTRRSKLSTHCPLTIEYDFE  121 (125)
Q Consensus        80 ~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~SDH~PV~~~l~f~  121 (125)
                      ....        ....+.....  .........+..+|||+||+++|+|+
T Consensus       254 ~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~SDH~pV~~~~~l~  301 (301)
T 1zwx_A          254 NGHARPHSWHNKVLHTKSPQWS--VKSWFKTYTYQDFSDHYPVVGFTDNN  301 (301)
T ss_dssp             TTSCCCSCEEEEECCCCCCCEE--EEETTEEEEECCSSSSCCEEEEEC--
T ss_pred             CCCCCCCCCCEEEEEECCCCCC--CCCCCCCCCCCCCCCCCCEEEEEECC
T ss_conf             5212643221148740465311--13444567889948704249997079



>2jc4_A (A:) Exodeoxyribonuclease III; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: 1PE; 1.90A {Neisseria meningitidis} Back     alignment and structure
>3g6s_A (A:) Putative endonuclease/exonuclease/phosphatase family protein; alpha-beta protein, structural genomics, PSI-2; 2.50A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2ddr_A (A:) Sphingomyelin phosphodiesterase; DNAse I like folding, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.40A {Bacillus cereus} Back     alignment and structure
>1hd7_A (A:) DNA-(apurinic or apyrimidinic site) lyase; DNA repair, endonuclease, APE1, HAP1, REF-1; 1.95A {Homo sapiens} Back     alignment and structure
>1ako_A (A:) Exonuclease III; AP-endonuclease, DNA repair; 1.70A {Escherichia coli} Back     alignment and structure
>2voa_A (A:) AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP endonuclease, lyase; 1.7A {Archaeoglobus fulgidus} Back     alignment and structure
>2o3h_A (A:) DNA-(apurinic or apyrimidinic site) lyase; APE, endonuclease; 1.90A {Homo sapiens} PDB: 1bix_A 1dew_A* 1de8_B* 1de9_A* 2o3c_A Back     alignment and structure
>2jc5_A (A:) Exodeoxyribonuclease; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: BCN DIO GOL; 1.50A {Neisseria meningitidis} Back     alignment and structure
>2ei9_A (A:) Non-LTR retrotransposon R1BMKS ORF2 protein; four layered alpha beta sandwich, gene regulation; 2.00A {Bombyx mori} Back     alignment and structure
>2imq_X (X:) Salivary nitrophorin; ferrous heme, beta-sandwich, transport protein; HET: HEM; 1.30A {Cimex lectularius} Back     alignment and structure
>3l1w_A (A:) Uncharacterized protein; APC29019.2, conserved protein, enterococcus faecalis V583, PSI-2, MCSG, structural genomics; 1.60A {Enterococcus faecalis} Back     alignment and structure
>1i9z_A (A:18-321) Synaptojanin, phosphatidylinositol phosphate phosphatase; spsynaptojanin, IPP5C, IP3, IP2,, hydrolase; HET: 2IP; 1.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1wdu_A (A:) TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA binding protein; 2.40A {Bombyx mori} Back     alignment and structure
>1vyb_A (A:) ORF2 contains A reverse transcriptase domain; endonuclease, APE-1 type, retrotransposition, retrotransposon, transferase; 1.8A {Homo sapiens} Back     alignment and structure
>2f1n_A (A:) CDT B, cytolethal distending toxin subunit B; E.coli, DNAse I, microbatch; 1.73A {Escherichia coli} Back     alignment and structure
>2j63_A (A:1-134,A:233-439) AP-endonuclease; base excision repair, lyase; 2.48A {Leishmania major} Back     alignment and structure
>2a40_B (B:88-227) Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse I, ARP2/3, structural protein; HET: HIC NAG ATP; 1.80A {Bos taurus} Back     alignment and structure
>2a40_B (B:1-87,B:228-260) Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse I, ARP2/3, structural protein; HET: HIC NAG ATP; 1.80A {Bos taurus} Back     alignment and structure