254780996

254780996

hypothetical protein CLIBASIA_04485

GeneID in NCBI database:8210018Locus tag:CLIBASIA_04485
Protein GI in NCBI database:254780996Protein Accession:YP_003065409.1
Gene range:-(991444, 991773)Protein Length:109aa
Gene description:hypothetical protein
COG prediction:[G] ABC-type sugar transport systems, ATPase components
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ
ccccEEEEEEcccccccHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHEEcccccccccccccccccEEEEEEEEEcccEEEEEEEEEcccEEEEEcc
cccccEEEEEcccccccccccccccccccccccccccccccHcHHHHHHHHHHHHHHHHEcccccccccccccccccccEEEEEEEEcccEEEEEEEEcccccEEEEcc
mpedkwyifysgcgknpvwdsmkgclnfssyddnsgnidtdesdiNTAIAIRKDVARVLQvsyplpapqeitprmgnrkTVELLIEIDDQKVWLLNVHLKsscvvkkiq
MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYplpapqeitprmgnRKTVELLIEIDDQKVWLLNvhlksscvvkkiq
MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ
**EDKWYIFYSGCGKNPVWDSMKGCLNFSSYD*****IDTDESDINTAIAIRKDVARVLQVSYP***************TVELLIEIDDQKVWLLNVHLKSSCVVKKIQ
MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ
**EDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ
MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ
MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target109 hypothetical protein CLIBASIA_04485 [Candidatus Liberib
254781003 304 hypothetical protein CLIBASIA_04520 [Candidatus Li 2e-18
254780797231 hypothetical protein CLIBASIA_03440 [Candidatus Li 3e-14
>gi|254781003|ref|YP_003065416.1| hypothetical protein CLIBASIA_04520 [Candidatus Liberibacter asiaticus str. psy62] Length = 304 Back     alignment
 Score = 82.4 bits (202), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (58%), Gaps = 18/109 (16%)

Query: 1   MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60
            P++ W IFYS           +  +N S  D N+        DI+TAIA+RK   RVLQ
Sbjct: 84  FPKNTWCIFYS----------TERLINHSKRDSNN--------DIHTAIAVRKKNVRVLQ 125

Query: 61  VSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ 109
            SYPL   ++   R GNR+ VELL+EI+ +K+W+L++HLKS C +  ++
Sbjct: 126 QSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLE 174

>gi|254780797|ref|YP_003065210.1| hypothetical protein CLIBASIA_03440 [Candidatus Liberibacter asiaticus str. psy62] Length = 231 Back     alignment
 Score = 68.6 bits (166), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 56/110 (50%), Gaps = 27/110 (24%)

Query: 1   MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60
            P DKW I YSG                          +TD+  ++TAI IRK    +LQ
Sbjct: 67  FPNDKWDILYSGS-------------------------NTDKHAMHTAIVIRKGAIHLLQ 101

Query: 61  VSYPLPAPQE-ITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ 109
            SY LP   E +  + G R+ VE+L E+D +K+WLL++HLKS C +  I+
Sbjct: 102 KSY-LPMDTEGLDSKAGKRRAVEILFEVDGRKIWLLDIHLKSFCFLDSIE 150

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target109 hypothetical protein CLIBASIA_04485 [Candidatus Liberib
254781003 304 hypothetical protein CLIBASIA_04520 [Candidatus Liberib 1 2e-14
254780797231 hypothetical protein CLIBASIA_03440 [Candidatus Liberib 1 3e-10
315122019 315 hypothetical protein CKC_01345 [Candidatus Liberibacter 1 1e-09
>gi|254781003|ref|YP_003065416.1| hypothetical protein CLIBASIA_04520 [Candidatus Liberibacter asiaticus str. psy62] Length = 304 Back     alignment and organism information
 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (58%), Gaps = 18/109 (16%)

Query: 1   MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60
            P++ W IFYS           +  +N S  D N+        DI+TAIA+RK   RVLQ
Sbjct: 84  FPKNTWCIFYS----------TERLINHSKRDSNN--------DIHTAIAVRKKNVRVLQ 125

Query: 61  VSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ 109
            SYPL   ++   R GNR+ VELL+EI+ +K+W+L++HLKS C +  ++
Sbjct: 126 QSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLE 174


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254780797|ref|YP_003065210.1| hypothetical protein CLIBASIA_03440 [Candidatus Liberibacter asiaticus str. psy62] Length = 231 Back     alignment and organism information
>gi|315122019|ref|YP_004062508.1| hypothetical protein CKC_01345 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 315 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target109 hypothetical protein CLIBASIA_04485 [Candidatus Liberib
3mtc_A 313 Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP 92.08
>3mtc_A Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP5BA,phosphoinositide 5-phosphatase, inositol signalling, phosphatase, magnesium; HET: PIF; 2.40A {Homo sapiens} Back     alignment and structure
Probab=92.08  E-value=0.29  Score=27.95  Aligned_cols=60  Identities=18%  Similarity=0.288  Sum_probs=45.5

Q ss_pred             HCEEEEEEEECCHHHHHHHHCCCCCCCCCCHHCCCCEEEEEEEEECCEEEEEEEEEEEEE
Q ss_conf             000124456400011333224787710123000771368999997890899998741013
Q gi|254780996|r   43 SDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSS  102 (109)
Q Consensus        43 ~dihTAIaiRK~~~rvLQ~SYpl~~~~~~~sraGnRraVElL~Eidg~KiWlLdiHLKSf  102 (109)
                      ..+..+|.+|++.........+.....++....|+..+|.+.+++++.++.++++||-+.
T Consensus        88 ~g~~~~vf~r~~~~~~i~~~~~~~~~~g~~~~~~~kg~~~~~~~i~~~~~~~in~hl~~~  147 (313)
T 3mtc_A           88 VGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAH  147 (313)
T ss_dssp             TTEEEEEEEEGGGGGGEEEEEEEEEECSGGGTSTTSEEEEEEEEETTEEEEEEEEECCCS
T ss_pred             CEEEEEEEEECCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEECCEEEEEEEECCCCC
T ss_conf             316999998166566434566642544788766888519999999999999999626888




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00