254780998

254780998

hypothetical protein CLIBASIA_04495

GeneID in NCBI database:8210020Locus tag:CLIBASIA_04495
Protein GI in NCBI database:254780998Protein Accession:YP_003065411.1
Gene range:-(992846, 993286)Protein Length:146aa
Gene description:hypothetical protein
COG prediction:[R] SufE protein probably involved in Fe-S center assembly
KEGG prediction:hypothetical protein; K02426 cysteine desulfuration protein SufE
SEED prediction:Sulfur acceptor protein SufE for iron-sulfur cluster assembly
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Fe-S cluster assembly
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MIPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQEYLNVHIKER
cccHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHcHHHcccccccEEEEEEEEccccccccEEEEEEcccHHHHHHHHHHHHHHHccccHHHHHHccHHHHHHHHcHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccc
cccHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHccHHccccccccEEEEEEEcccccccccEEEEEcccHHHHHHHHHHHHHHHHccccHHHHHHccHHHHHHHHccHHccccccccHHHHHHHHHHHHHHHHHccEEEcc
MIPINDIIEDMEMIEDLHDRYHYLIELGkklplfpkeymtdqNIVAGCMSKLWMVIEWenkgdqdpimIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHlgltenlsqKRMNGLYTIVNKIQDLTQEYLNVHIKER
MIPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQEYLNVHIKER
mipindiiedmemiedLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQEYLNVHIKER
*IPINDIIEDMEMIEDLHDRYHYLIELGKKLPL******T**NIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQ**********
MIPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQEYLNVHIKER
MIPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQEYLNVHIKER
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQEYLNVHIKER
MIPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQEYLNVHIKER
MIPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQEYLNVHIKER

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target146 hypothetical protein CLIBASIA_04495 [Candidatus Liberib
315122405146 hypothetical protein CKC_03285 [Candidatus Liberibacter 1 1e-36
15888257138 hypothetical protein Atu0919 [Agrobacterium tumefaciens 1 1e-25
116251148145 hypothetical protein RL1380 [Rhizobium leguminosarum bv 1 1e-25
209548485140 Fe-S metabolism associated SufE [Rhizobium leguminosaru 1 1e-25
49475257136 hypothetical protein BH04600 [Bartonella henselae str. 1 2e-25
241203746140 Fe-S metabolism associated SufE [Rhizobium leguminosaru 1 3e-25
227821335172 putative cysteine desulfuration protein SufE [Sinorhizo 1 3e-25
327193892160 putative Fe-S metabolism associated protein [Rhizobium 1 4e-25
190890963160 Fe-S metabolism associated protein [Rhizobium etli CIAT 1 4e-25
218680219140 Fe-S metabolism associated SufE [Rhizobium etli CIAT 89 1 5e-25
>gi|315122405|ref|YP_004062894.1| hypothetical protein CKC_03285 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 146 Back     alignment and organism information
 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 110/140 (78%)

Query: 1   MIPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWEN 60
           MIPIN+II+D+E+IED+ +RYHYLIELGKKLP FPKE+M ++NIV GC + +WM I+ +N
Sbjct: 1   MIPINEIIQDIEIIEDVQNRYHYLIELGKKLPSFPKEHMIEENIVRGCANTIWMTIDLKN 60

Query: 61  KGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKR 120
           K D+DP +     SDS IV GLLYI+KSIY  KK+SE + +D L I Q LGL E+LSQKR
Sbjct: 61  KEDKDPSIFLNTASDSHIVSGLLYILKSIYDGKKVSETITIDYLEIFQRLGLIEHLSQKR 120

Query: 121 MNGLYTIVNKIQDLTQEYLN 140
            +GL+ IV KI+DLT+EY N
Sbjct: 121 TDGLHVIVQKIKDLTKEYSN 140


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15888257|ref|NP_353938.1| hypothetical protein Atu0919 [Agrobacterium tumefaciens str. C58] Length = 138 Back     alignment and organism information
>gi|116251148|ref|YP_766986.1| hypothetical protein RL1380 [Rhizobium leguminosarum bv. viciae 3841] Length = 145 Back     alignment and organism information
>gi|209548485|ref|YP_002280402.1| Fe-S metabolism associated SufE [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 140 Back     alignment and organism information
>gi|49475257|ref|YP_033298.1| hypothetical protein BH04600 [Bartonella henselae str. Houston-1] Length = 136 Back     alignment and organism information
>gi|241203746|ref|YP_002974842.1| Fe-S metabolism associated SufE [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 140 Back     alignment and organism information
>gi|227821335|ref|YP_002825305.1| putative cysteine desulfuration protein SufE [Sinorhizobium fredii NGR234] Length = 172 Back     alignment and organism information
>gi|327193892|gb|EGE60767.1| putative Fe-S metabolism associated protein [Rhizobium etli CNPAF512] Length = 160 Back     alignment and organism information
>gi|190890963|ref|YP_001977505.1| Fe-S metabolism associated protein [Rhizobium etli CIAT 652] Length = 160 Back     alignment and organism information
>gi|218680219|ref|ZP_03528116.1| Fe-S metabolism associated SufE [Rhizobium etli CIAT 894] Length = 140 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target146 hypothetical protein CLIBASIA_04495 [Candidatus Liberib
pfam02657125 pfam02657, SufE, Fe-S metabolism associated domain 4e-18
PRK09296138 PRK09296, PRK09296, cysteine desufuration protein SufE; 8e-17
TIGR03391138 TIGR03391, FeS_syn_CsdE, cysteine desulfurase, sulfur a 5e-16
PRK15019147 PRK15019, PRK15019, CsdA-binding activator; Provisional 5e-14
PLN02673 724 PLN02673, PLN02673, quinolinate synthetase A 2e-06
COG2166144 COG2166, COG2166, SufE protein probably involved in Fe- 2e-27
>gnl|CDD|111544 pfam02657, SufE, Fe-S metabolism associated domain Back     alignment and domain information
>gnl|CDD|181767 PRK09296, PRK09296, cysteine desufuration protein SufE; Provisional Back     alignment and domain information
>gnl|CDD|132432 TIGR03391, FeS_syn_CsdE, cysteine desulfurase, sulfur acceptor subunit CsdE Back     alignment and domain information
>gnl|CDD|184980 PRK15019, PRK15019, CsdA-binding activator; Provisional Back     alignment and domain information
>gnl|CDD|178278 PLN02673, PLN02673, quinolinate synthetase A Back     alignment and domain information
>gnl|CDD|32349 COG2166, COG2166, SufE protein probably involved in Fe-S center assembly [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 146 hypothetical protein CLIBASIA_04495 [Candidatus Liberib
PRK09296138 cysteine desufuration protein SufE; Provisional 100.0
TIGR03391138 FeS_syn_CsdE cysteine desulfurase, sulfur acceptor subu 100.0
pfam02657125 SufE Fe-S metabolism associated domain. This family con 100.0
COG2166144 sufE Cysteine desulfurase SufE subunit [Posttranslation 100.0
TIGR03419121 NifU_clost FeS cluster assembly scaffold protein NifU, 95.85
pfam01592126 NifU_N NifU-like N terminal domain. This domain is foun 95.67
PRK11325127 scaffold protein; Provisional 94.45
>PRK09296 cysteine desufuration protein SufE; Provisional Back     alignment and domain information
>TIGR03391 FeS_syn_CsdE cysteine desulfurase, sulfur acceptor subunit CsdE Back     alignment and domain information
>pfam02657 SufE Fe-S metabolism associated domain Back     alignment and domain information
>COG2166 sufE Cysteine desulfurase SufE subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03419 NifU_clost FeS cluster assembly scaffold protein NifU, Clostridium type Back     alignment and domain information
>pfam01592 NifU_N NifU-like N terminal domain Back     alignment and domain information
>PRK11325 scaffold protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target146 hypothetical protein CLIBASIA_04495 [Candidatus Liberib
3g0m_A141 Crystal Structure Of Cysteine Desulfuration Protein 7e-32
1ni7_A155 Northeast Structural Genomic Consortium Target Er75 8e-31
1mzg_A146 X-Ray Structure Of Sufe From E.Coli Northeast Struc 8e-29
1wlo_A136 Solution Structure Of The Hypothetical Protein From 2e-16
>gi|223674097|pdb|3G0M|A Chain A, Crystal Structure Of Cysteine Desulfuration Protein Sufe From Salmonella Typhimurium Lt2 Length = 141 Back     alignment and structure
 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 31/132 (23%), Positives = 62/132 (46%), Gaps = 4/132 (3%)

Query: 5   NDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQ 64
             ++ +     +  ++Y Y+IELG++L     +    QN + GC S++W+V+        
Sbjct: 11  EKLLRNFTRCANWEEKYLYIIELGQRLAELNPQDRNPQNTIHGCQSQVWIVMRRN----A 66

Query: 65  DPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGL 124
           + I+     SD+ IV GL+ +V  +Y      +I+  D     + + L ++L+  R  GL
Sbjct: 67  NGIIELQGDSDAAIVKGLMAVVFILYHQMTAQDIVHFDVRPWFEKMALAQHLTPSRSQGL 126

Query: 125 YTIVNKIQDLTQ 136
             ++  I+    
Sbjct: 127 EAMIRAIRAKAA 138


>gi|31615687|pdb|1NI7|A Chain A, Northeast Structural Genomic Consortium Target Er75 Length = 155 Back     alignment and structure
>gi|28373819|pdb|1MZG|A Chain A, X-Ray Structure Of Sufe From E.Coli Northeast Structural Genomics (Nesg) Consortium Target Er30 Length = 146 Back     alignment and structure
gi|73535426|pdb|1WLO|A Chain A, Solution Structure Of The Hypothetical Protein From Thermus Thermophilus Hb8 Length = 136 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target146 hypothetical protein CLIBASIA_04495 [Candidatus Liberib
1ni7_A155 ER75, hypothetical protein YGDK; RD-structural genomics 6e-34
3g0m_A141 Cysteine desulfuration protein SUFE; YNHA, csgid, natio 1e-33
1wlo_A136 SUFE protein; structural genomics, riken structural gen 2e-25
>1ni7_A ER75, hypothetical protein YGDK; RD-structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Escherichia coli} SCOP: d.224.1.1 Length = 155 Back     alignment and structure
 Score =  138 bits (348), Expect = 6e-34
 Identities = 37/138 (26%), Positives = 61/138 (44%), Gaps = 4/138 (2%)

Query: 2   IPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENK 61
           +    +      +    D+Y  LI LGK+LP  P E       +AGC +++W+       
Sbjct: 15  VTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTV--- 71

Query: 62  GDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRM 121
             ++  M F+  S+ +IV GLL ++ +    K  +E+     L +   LGL   LS  R 
Sbjct: 72  -AENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRS 130

Query: 122 NGLYTIVNKIQDLTQEYL 139
            GL  +   I   T++ L
Sbjct: 131 QGLNALSEAIIAATKQVL 148


>3g0m_A Cysteine desulfuration protein SUFE; YNHA, csgid, national institute of allergy and infectious diseases, niaid, hydrolase; 1.76A {Salmonella typhimurium LT2} PDB: 1mzg_A Length = 141 Back     alignment and structure
>1wlo_A SUFE protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus HB8} Length = 136 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target146 hypothetical protein CLIBASIA_04495 [Candidatus Liberib
1ni7_A155 ER75, hypothetical protein YGDK; RD-structural genomics 100.0
3g0m_A141 Cysteine desulfuration protein SUFE; YNHA, csgid, natio 100.0
1wlo_A136 SUFE protein; structural genomics, riken structural gen 100.0
2z7e_A157 ISCU protein, NIFU-like protein; iron-sulfur cluster, i 91.99
>1ni7_A ER75, hypothetical protein YGDK; RD-structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Escherichia coli} SCOP: d.224.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=312.57  Aligned_cols=137  Identities=28%  Similarity=0.510  Sum_probs=131.1

Q ss_pred             CCHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHCCHHHHHCCCCEEEEEEEEECCCCCCCCEEEEEECCHHHHHHH
Q ss_conf             88899999875099989999999999850899995686815502265601678873046545488799994162699999
Q gi|254780998|r    2 IPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCG   81 (146)
Q Consensus         2 ~~l~~i~e~f~~~~d~~~ry~~Li~lgk~l~~l~e~~k~~~~~V~GCqS~vWl~~~~~~~~~~~~~~~f~~dSda~IvkG   81 (146)
                      |++++|+++|+.|+||++||+|||++||++|++|+++|+++|+|+||||+|||+++.+    ++|+++|+|||||.||||
T Consensus        15 ~~~~~i~e~f~~~~dwedry~~Li~lgk~l~~l~e~~k~d~n~V~GCqS~vWl~~~~~----~~g~~~f~~dSDa~IvkG   90 (155)
T 1ni7_A           15 VTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVA----ENGKMHFFGDSEGRIVRG   90 (155)
T ss_dssp             SCHHHHHHHHTTCCSHHHHHHHHHHHHHHSCCCCHHHHHHSEEECSSSSCEEEECCCC----SSSCCCCEEEESSHHHHH
T ss_pred             CCHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCHHHHCHHHCCCCCCEEEEEEEEEC----CCCEEEEEECCCHHHHHH
T ss_conf             6899999999818999999999999884299999689554525067613688888862----697799984253399999


Q ss_pred             HHHHHHHHHCCCCHHHHHHCCHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999975998899980798999987090431694289999999999999999999633
Q gi|254780998|r   82 LLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQEYLNVH  142 (146)
Q Consensus        82 l~~ll~~~~~g~t~~eI~~~d~~~f~~~lgL~~~Lt~~R~nGl~~m~~~ik~~a~~~l~~~  142 (146)
                      |++||+.+|||+||+||++++|.+|++++||.++|||+|+|||++|+++||++|++++.-+
T Consensus        91 l~aiL~~~~~g~t~~eI~~~~~~~~~~~lGL~~~LS~sR~NGl~~mi~~Ik~~a~~~l~~~  151 (155)
T 1ni7_A           91 LLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQVLEHH  151 (155)
T ss_dssp             HHHHHHHHTTTCCHHHHHHSCTHHHHHHHTSSSSSCHHHHHHHHHHHHHHHHHHHHHHC--
T ss_pred             HHHHHHHHHCCCCHHHHHHCCHHHHHHHCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999987999999985698999987687400682189999999999999999998742



>3g0m_A Cysteine desulfuration protein SUFE; YNHA, csgid, national institute of allergy and infectious diseases, niaid, hydrolase; 1.76A {Salmonella typhimurium LT2} PDB: 1mzg_A Back     alignment and structure
>1wlo_A SUFE protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus HB8} Back     alignment and structure
>2z7e_A ISCU protein, NIFU-like protein; iron-sulfur cluster, iron, biosynthesis, [2Fe-2S], asymmetric trimer, three conserved Cys; 2.30A {Aquifex aeolicus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 146 hypothetical protein CLIBASIA_04495 [Candidatus Liberib
d1ni7a_149 d.224.1.1 (A:) Hypothetical protein YgdK {Escherichia c 6e-33
d1mzga_144 d.224.1.1 (A:) SufE (YhnA) {Escherichia coli [TaxId: 56 8e-31
>d1ni7a_ d.224.1.1 (A:) Hypothetical protein YgdK {Escherichia coli [TaxId: 562]} Length = 149 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: SufE/NifU
superfamily: SufE/NifU
family: SufE-like
domain: Hypothetical protein YgdK
species: Escherichia coli [TaxId: 562]
 Score =  133 bits (336), Expect = 6e-33
 Identities = 37/138 (26%), Positives = 61/138 (44%), Gaps = 4/138 (2%)

Query: 2   IPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENK 61
           +    +      +    D+Y  LI LGK+LP  P E       +AGC +++W+       
Sbjct: 15  VTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTV--- 71

Query: 62  GDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRM 121
             ++  M F+  S+ +IV GLL ++ +    K  +E+     L +   LGL   LS  R 
Sbjct: 72  -AENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRS 130

Query: 122 NGLYTIVNKIQDLTQEYL 139
            GL  +   I   T++ L
Sbjct: 131 QGLNALSEAIIAATKQVL 148


>d1mzga_ d.224.1.1 (A:) SufE (YhnA) {Escherichia coli [TaxId: 562]} Length = 144 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target146 hypothetical protein CLIBASIA_04495 [Candidatus Liberib
d1ni7a_149 Hypothetical protein YgdK {Escherichia coli [TaxId: 562 100.0
d1mzga_144 SufE (YhnA) {Escherichia coli [TaxId: 562]} 100.0
d1wfza_130 Iron-sulfur cluster protein U (IscU) {Mouse (Mus muscul 91.62
>d1ni7a_ d.224.1.1 (A:) Hypothetical protein YgdK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: SufE/NifU
superfamily: SufE/NifU
family: SufE-like
domain: Hypothetical protein YgdK
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=312.75  Aligned_cols=134  Identities=28%  Similarity=0.509  Sum_probs=129.4

Q ss_pred             CCHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHCCHHHHHCCCCEEEEEEEEECCCCCCCCEEEEEECCHHHHHHH
Q ss_conf             88899999875099989999999999850899995686815502265601678873046545488799994162699999
Q gi|254780998|r    2 IPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCG   81 (146)
Q Consensus         2 ~~l~~i~e~f~~~~d~~~ry~~Li~lgk~l~~l~e~~k~~~~~V~GCqS~vWl~~~~~~~~~~~~~~~f~~dSda~IvkG   81 (146)
                      |++++|+++|+.|+||++||+|||++||++|++|+++|+++|+|+||||+|||+++.+    ++|+++|+|||||.||||
T Consensus        15 ~~~~~i~e~f~~~~dweery~~Li~lgk~l~~l~e~~k~d~~~V~GCqS~vWl~~~~~----~~g~~~f~adSDa~IvkG   90 (149)
T d1ni7a_          15 VTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVA----ENGKMHFFGDSEGRIVRG   90 (149)
T ss_dssp             SCHHHHHHHHTTCCSHHHHHHHHHHHHHHSCCCCHHHHHHSEEECSSSSCEEEECCCC----SSSCCCCEEEESSHHHHH
T ss_pred             CCHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCHHHHCHHHEECCCEEEEEEEEEEC----CCCEEEEEECCCHHHHHH
T ss_conf             5799999999818999999999999985199999689455544235346789988871----698799995153799999


Q ss_pred             HHHHHHHHHCCCCHHHHHHCCHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999975998899980798999987090431694289999999999999999999
Q gi|254780998|r   82 LLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQEYL  139 (146)
Q Consensus        82 l~~ll~~~~~g~t~~eI~~~d~~~f~~~lgL~~~Lt~~R~nGl~~m~~~ik~~a~~~l  139 (146)
                      |++||+.+|||+||+||++++|.+|++++||++||||+|+|||++|+++||.+|++++
T Consensus        91 l~~iL~~~~sg~t~~eI~~~~~~~~~~~lGL~~~Ls~sR~NGl~~mi~~Ik~~a~~~l  148 (149)
T d1ni7a_          91 LLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQVL  148 (149)
T ss_dssp             HHHHHHHHTTTCCHHHHHHSCTHHHHHHHTSSSSSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCHHHHHHCCHHHHHHHCCCHHHCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999987999899985698999987797401770289999999999999999973



>d1mzga_ d.224.1.1 (A:) SufE (YhnA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wfza_ d.224.1.2 (A:) Iron-sulfur cluster protein U (IscU) {Mouse (Mus musculus), mitochondrial [TaxId: 10090]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 146 hypothetical protein CLIBASIA_04495 [Candidatus Li
3g0m_A_141 (A:) Cysteine desulfuration protein SUFE; YNHA, cs 4e-34
1wlo_A_136 (A:) SUFE protein; structural genomics, riken stru 1e-29
1ni7_A_1-45_86-155115 (A:1-45,A:86-155) ER75, hypothetical protein YGDK; 2e-15
1ni7_A_46-8540 (A:46-85) ER75, hypothetical protein YGDK; RD-stru 1e-05
>3g0m_A (A:) Cysteine desulfuration protein SUFE; YNHA, csgid, national institute of allergy and infectious diseases, niaid, hydrolase; 1.76A {Salmonella typhimurium LT2} PDB: 1mzg_ALength = 141 Back     alignment and structure
 Score =  137 bits (348), Expect = 4e-34
 Identities = 31/137 (22%), Positives = 63/137 (45%), Gaps = 4/137 (2%)

Query: 2   IPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENK 61
                ++ +     +  ++Y Y+IELG++L     +    QN + GC S++W+V+     
Sbjct: 8   PDKEKLLRNFTRCANWEEKYLYIIELGQRLAELNPQDRNPQNTIHGCQSQVWIVMRR--- 64

Query: 62  GDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRM 121
            + + I+     SD+ IV GL+ +V  +Y      +I+  D     + + L ++L+  R 
Sbjct: 65  -NANGIIELQGDSDAAIVKGLMAVVFILYHQMTAQDIVHFDVRPWFEKMALAQHLTPSRS 123

Query: 122 NGLYTIVNKIQDLTQEY 138
            GL  ++  I+      
Sbjct: 124 QGLEAMIRAIRAKAATL 140


>1wlo_A (A:) SUFE protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus HB8}Length = 136 Back     alignment and structure
>1ni7_A (A:1-45,A:86-155) ER75, hypothetical protein YGDK; RD-structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Escherichia coli}Length = 115 Back     alignment and structure
>1ni7_A (A:46-85) ER75, hypothetical protein YGDK; RD-structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Escherichia coli}Length = 40 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target146 hypothetical protein CLIBASIA_04495 [Candidatus Liberib
3g0m_A_141 Cysteine desulfuration protein SUFE; YNHA, csgid, 100.0
1wlo_A_136 SUFE protein; structural genomics, riken structura 100.0
1ni7_A_1-45_86-155115 ER75, hypothetical protein YGDK; RD-structural gen 99.94
1ni7_A_46-8540 ER75, hypothetical protein YGDK; RD-structural gen 99.05
>3g0m_A (A:) Cysteine desulfuration protein SUFE; YNHA, csgid, national institute of allergy and infectious diseases, niaid, hydrolase; 1.76A {Salmonella typhimurium LT2} PDB: 1mzg_A Back     alignment and structure
Probab=100.00  E-value=0  Score=306.99  Aligned_cols=132  Identities=23%  Similarity=0.487  Sum_probs=128.0

Q ss_pred             CHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHCCHHHHHCCCCEEEEEEEEECCCCCCCCEEEEEECCHHHHHHHH
Q ss_conf             88999998750999899999999998508999956868155022656016788730465454887999941626999999
Q gi|254780998|r    3 PINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCGL   82 (146)
Q Consensus         3 ~l~~i~e~f~~~~d~~~ry~~Li~lgk~l~~l~e~~k~~~~~V~GCqS~vWl~~~~~~~~~~~~~~~f~~dSda~IvkGl   82 (146)
                      ++++|+++|+.|+||++||+|||++||++||+|+++|+++|+|+||||+|||+++++    .||+++|+|||||+||||+
T Consensus         9 ~~~~i~~~f~~~~d~e~ry~~li~lgk~Lp~lp~~~k~~~~~V~GC~S~vWl~~e~~----~dg~~~f~~dSda~ivkGl   84 (141)
T 3g0m_A            9 DKEKLLRNFTRCANWEEKYLYIIELGQRLAELNPQDRNPQNTIHGCQSQVWIVMRRN----ANGIIELQGDSDAAIVKGL   84 (141)
T ss_dssp             CHHHHHHHHHTCCSHHHHHHHHHHHHHTSCCCCGGGCSGGGBCCSSSSCEEEEEEEC----TTSBEEEEEEESSHHHHHH
T ss_pred             CHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHCCCCCCCCCCCCCEEEEEEEC----CCCEEEEEECCCCHHHHHH
T ss_conf             899999998848999999999999883388999477582151888734746789986----8987999755714999999


Q ss_pred             HHHHHHHHCCCCHHHHHHCCHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999997599889998079899998709043169428999999999999999999
Q gi|254780998|r   83 LYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQEY  138 (146)
Q Consensus        83 ~~ll~~~~~g~t~~eI~~~d~~~f~~~lgL~~~Lt~~R~nGl~~m~~~ik~~a~~~  138 (146)
                      ++||+.+|||+||+||+++||.+||+++||.+||||+|.||+.+|+++||++|+++
T Consensus        85 ~ail~~~~~g~tp~eI~~~d~~~~~~~lGL~~~LspsR~NGl~~il~~ik~~a~~~  140 (141)
T 3g0m_A           85 MAVVFILYHQMTAQDIVHFDVRPWFEKMALAQHLTPSRSQGLEAMIRAIRAKAATL  140 (141)
T ss_dssp             HHHHHHHHTTCBHHHHHHCCCHHHHHHHTCGGGSCHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHCCCCHHHHHHCCHHHHHHHCCCHHHCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99999998699999998679899998848441058508789999999999999973



>1wlo_A (A:) SUFE protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus HB8} Back     alignment and structure
>1ni7_A (A:1-45,A:86-155) ER75, hypothetical protein YGDK; RD-structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Escherichia coli} Back     alignment and structure
>1ni7_A (A:46-85) ER75, hypothetical protein YGDK; RD-structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Escherichia coli} Back     alignment and structure