254780999

254780999

NAD synthetase

GeneID in NCBI database:8210021Locus tag:CLIBASIA_04500
Protein GI in NCBI database:254780999Protein Accession:YP_003065412.1
Gene range:-(993455, 995143)Protein Length:562aa
Gene description:NAD synthetase
COG prediction:[R] Predicted amidohydrolase
KEGG prediction:nadE; NAD synthetase (EC:6.3.5.1); K01950 NAD+ synthase (glutamine-hydrolysing) [EC:6.3.5.1]
SEED prediction:NAD synthetase (EC 6.3.1.5) / Glutamine amidotransferase chain of NAD synthetase
Pathway involved in KEGG:Nitrogen metabolism [PATH:las00910]
Nicotinate and nicotinamide metabolism [PATH:las00760]
Subsystem involved in SEED:NAD and NADP cofactor biosynthesis global;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560--
MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE
ccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHcHHHccccHHHHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEEEEccEEEEEEccEEccccccccccEEEcccccccEEEEccEEEEEEEccccccccHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHcccEEEEEEcccccccEEEEccEEEEcccccEEEEccccccEEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHccEEEccccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHccccccccccccccHHHcccHHHHHHHHHHHHHccccHHHHHccccHHHHHHHHHHHHHHHHHHccccccEEEccccccccccccccHHHHHHHccc
ccHHHHEEHHccccccccHHHHHHHHHHHHHHHHHccccEEEEcHHHHccccHHHHHccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHccccEEEEEEccccccccccccEEEccccccccEEEEccEEEcEEEcccccccccHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHHHHHccccEEEEEEccccccEEEccccEEEcccccEEHHcHHHHHcEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHHHccccEEEEEccccccHHHcHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHcccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccEcHHHccccccccccccHHHHHccc
MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELfisgyppedlvFKKSFIQACSSAIDTlksdthdggagivvgfprqdqegvlnSVVILdagniiavrdkinlpnysefhekrtfisgysndpivfrDIRLGILICEDIWKNSNICKHLKKQGAEFLFslnaspyyhnklkkrheivtgqishvhlpiiyvnqvggqdelifdgasfcfdGQQQLAFQMKHfseqnfmteWHYDQqlsqwnymsddsastmyiplqeeeadYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKEnvqtimlpykytspqsLEDAAACAKALgckydvlpihDLVNHFFSLMSQflqeepsgivaENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYgtlygdmsggfnplkdlyKTQVFQLASWRnshgitsglgpltevippsilekspsaelrphqtdqeslppypildDIIKRIVENEesfinndqeyndETVRYVEHLLYGseykrrqapvgtkitaksfgrdrlypisnkfrDHISEE
MLKKLKIAiaqlnpvvgdiaGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRtfisgysndpIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRphqtdqeslppypILDDIIKRIVENEEsfinndqeyndeTVRYVEHLLygseykrrqapvgtkitaksfgrdrlypisnkfrdhisee
MLKKLKIAIAQLNPVVGDIAGNIakarrareeanrQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE
**KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNK*R******
MLKKLKIAIAQLNPVVGDIAGNIAK********NRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKS************ESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE
*LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE
MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE
MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target562 NAD synthetase [Candidatus Liberibacter asiaticus str.
315122406561 NAD synthetase [Candidatus Liberibacter solanacearum CL 1 0.0
86357986559 NAD synthetase [Rhizobium etli CFN 42] Length = 559 1 0.0
241204941559 NAD synthetase [Rhizobium leguminosarum bv. trifolii WS 1 0.0
222148504559 NAD synthetase [Agrobacterium vitis S4] Length = 559 1 0.0
227822241560 NAD synthetase [Sinorhizobium fredii NGR234] Length = 5 1 0.0
150396775560 NAD synthetase [Sinorhizobium medicae WSM419] Length = 1 0.0
190892049559 NAD(+) synthase (glutamine-hydrolysing) protein [Rhizob 1 0.0
218675144559 NAD(+) synthase (glutamine-hydrolysing) protein [Rhizob 1 0.0
15965599560 NAD synthetase [Sinorhizobium meliloti 1021] Length = 5 1 0.0
327190628559 NAD(+) synthase (glutamine-hydrolysing) protein [Rhizob 1 0.0
>gi|315122406|ref|YP_004062895.1| NAD synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 561 Back     alignment and organism information
 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/554 (77%), Positives = 492/554 (88%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           LKIAIAQLNP VGD++GNIAKAR+AREEANRQG DLI+FTELFISGYP EDL+ K+SFIQ
Sbjct: 5   LKIAIAQLNPTVGDVSGNIAKARQAREEANRQGADLIIFTELFISGYPAEDLILKESFIQ 64

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC   + TLK DT D GAGI++GFPRQDQEG+ NSV ILDAG I+++RDKI+LPNY+EFH
Sbjct: 65  ACYDGMLTLKDDTRDNGAGIIIGFPRQDQEGIFNSVAILDAGKIVSIRDKIHLPNYNEFH 124

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKRTFISG +ND +VFRD  +GILICEDIWKNSNIC+HLKKQGA+ L +LNASPY  NKL
Sbjct: 125 EKRTFISGNTNDIVVFRDNPIGILICEDIWKNSNICRHLKKQGAKILLTLNASPYCRNKL 184

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           K RHEI++ QISHV++PI+YVNQVGGQDELIFDGASFCF+G +QLAFQMKHF EQN +T+
Sbjct: 185 KTRHEIISTQISHVNIPIVYVNQVGGQDELIFDGASFCFNGDRQLAFQMKHFEEQNLITQ 244

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W+YD++ S  N +SD S S +YI   EEE DYNACV+ LRDYV+KNNFHKVIIGLSGGID
Sbjct: 245 WYYDKKSSSLNCISDYSQSKIYIFPTEEETDYNACVVGLRDYVKKNNFHKVIIGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SALCA IAVDALGKENVQTIMLPYKYTS +SLEDAAACAK+L C+YDVLPIHDLV+HFFS
Sbjct: 305 SALCATIAVDALGKENVQTIMLPYKYTSNESLEDAAACAKSLDCRYDVLPIHDLVDHFFS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           +MSQFLQEEPSGIVAENIQSRIRGNILM LSN S+AMLLTT+NKSEIS+GYGTLYGDMSG
Sbjct: 365 IMSQFLQEEPSGIVAENIQSRIRGNILMTLSNKSEAMLLTTNNKSEISIGYGTLYGDMSG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNPLKDLYKT+V++LA WRN+H I  GLGP  EVIPP ILEK+PSAELRP+Q D++SLP
Sbjct: 425 GFNPLKDLYKTKVYKLAYWRNAHCIPCGLGPFKEVIPPRILEKAPSAELRPNQIDEDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFG 544
           PY ILD+II+ IVEN+ES  N  ++Y+ ET+RY+E+LLY SEYKRRQ+P GTKIT+KSFG
Sbjct: 485 PYAILDNIIEDIVENKESLKNTKKKYSTETIRYIENLLYRSEYKRRQSPPGTKITSKSFG 544

Query: 545 RDRLYPISNKFRDH 558
           RDRLYPISNKFRD 
Sbjct: 545 RDRLYPISNKFRDQ 558


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357986|ref|YP_469878.1| NAD synthetase [Rhizobium etli CFN 42] Length = 559 Back     alignment and organism information
>gi|241204941|ref|YP_002976037.1| NAD synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 559 Back     alignment and organism information
>gi|222148504|ref|YP_002549461.1| NAD synthetase [Agrobacterium vitis S4] Length = 559 Back     alignment and organism information
>gi|227822241|ref|YP_002826212.1| NAD synthetase [Sinorhizobium fredii NGR234] Length = 560 Back     alignment and organism information
>gi|150396775|ref|YP_001327242.1| NAD synthetase [Sinorhizobium medicae WSM419] Length = 560 Back     alignment and organism information
>gi|190892049|ref|YP_001978591.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli CIAT 652] Length = 559 Back     alignment and organism information
>gi|218675144|ref|ZP_03524813.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli GR56] Length = 559 Back     alignment and organism information
>gi|15965599|ref|NP_385952.1| NAD synthetase [Sinorhizobium meliloti 1021] Length = 560 Back     alignment and organism information
>gi|327190628|gb|EGE57716.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli CNPAF512] Length = 559 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target562 NAD synthetase [Candidatus Liberibacter asiaticus str.
PRK13981540 PRK13981, PRK13981, NAD synthetase; Provisional 0.0
cd00553248 cd00553, NAD_synthase, NAD+ synthase is a homodimer, wh 8e-73
pfam02540243 pfam02540, NAD_synthase, NAD synthase 1e-70
COG0171268 COG0171, NadE, NAD synthase [Coenzyme metabolism] 7e-68
PRK13980265 PRK13980, PRK13980, NAD synthetase; Provisional 2e-57
TIGR00552250 TIGR00552, nadE, NAD+ synthetase 5e-55
COG0388274 COG0388, COG0388, Predicted amidohydrolase [General fun 2e-39
cd07197253 cd07197, nitrilase, Nitrilase superfamily, including ni 5e-29
cd07586269 cd07586, nitrilase_8, Uncharacterized subgroup of the n 8e-26
cd07576254 cd07576, R-amidase_like, Pseudomonas sp 3e-22
cd07584258 cd07584, nitrilase_6, Uncharacterized subgroup of the n 3e-13
cd07585261 cd07585, nitrilase_7, Uncharacterized subgroup of the n 4e-13
TIGR03381279 TIGR03381, agmatine_aguB, N-carbamoylputrescine amidase 8e-10
cd07570261 cd07570, GAT_Gln-NAD-synth, Glutamine aminotransferase 1e-81
PRK02628679 PRK02628, nadE, NAD synthetase; Reviewed 3e-36
KOG2303706 KOG2303, KOG2303, KOG2303, Predicted NAD synthase, cont 3e-17
PLN02339700 PLN02339, PLN02339, NAD+ synthase (glutamine-hydrolysin 9e-11
pfam00795172 pfam00795, CN_hydrolase, Carbon-nitrogen hydrolase 1e-22
cd07580268 cd07580, nitrilase_2, Uncharacterized subgroup of the n 2e-16
cd07583253 cd07583, nitrilase_5, Uncharacterized subgroup of the n 1e-14
cd07577259 cd07577, Ph0642_like, Pyrococcus horikoshii Ph0642 and 1e-11
cd07581255 cd07581, nitrilase_3, Uncharacterized subgroup of the n 1e-11
cd07564297 cd07564, nitrilases_CHs, Nitrilases, cyanide hydratase 1e-10
KOG0806298 KOG0806, KOG0806, KOG0806, Carbon-nitrogen hydrolase [A 8e-10
cd07572265 cd07572, nit, Nit1, Nit 2, and related proteins, and th 1e-09
cd07573284 cd07573, CPA, N-carbamoylputrescine amidohydrolase (CPA 2e-07
cd07566295 cd07566, ScNTA1_like, Saccharomyces cerevisiae N-termin 7e-07
cd07579279 cd07579, nitrilase_1_R2, Second nitrilase domain of an 7e-07
PLN02747296 PLN02747, PLN02747, N-carbamolyputrescine amidase 9e-06
cd07569302 cd07569, DCase, N-carbamyl-D-amino acid amidohydrolase 4e-05
cd07578258 cd07578, nitrilase_1_R1, First nitrilase domain of an u 4e-05
PLN02798286 PLN02798, PLN02798, nitrilase 0.003
PRK00876326 PRK00876, nadE, NAD synthetase; Reviewed 1e-21
PTZ00323294 PTZ00323, PTZ00323, NAD+ synthase; Provisional 3e-06
PRK00768268 PRK00768, nadE, NAD synthetase; Reviewed 8e-05
COG1606269 COG1606, COG1606, ATP-utilizing enzymes of the PP-loop 3e-09
TIGR00268252 TIGR00268, TIGR00268, conserved hypothetical protein TI 2e-07
cd01990202 cd01990, Alpha_ANH_like_I, This is a subfamily of Adeni 4e-06
TIGR00364201 TIGR00364, TIGR00364, exsB protein 2e-05
COG0603222 COG0603, COG0603, Predicted PP-loop superfamily ATPase 4e-05
PRK00143346 PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Rev 1e-04
cd01991269 cd01991, Asn_Synthase_B_C, The C-terminal domain of Asp 2e-04
cd01998349 cd01998, tRNA_Me_trans, tRNA methyl transferase 4e-04
pfam03054354 pfam03054, tRNA_Me_trans, tRNA methyl transferase 6e-04
pfam06508137 pfam06508, ExsB, ExsB 0.001
KOG0805337 KOG0805, KOG0805, KOG0805, Carbon-nitrogen hydrolase [A 3e-04
PLN02504346 PLN02504, PLN02504, nitrilase 0.004
PRK00919307 PRK00919, PRK00919, GMP synthase subunit B; Validated 0.001
cd01997295 cd01997, GMP_synthase_C, The C-terminal domain of GMP s 0.004
>gnl|CDD|184436 PRK13981, PRK13981, NAD synthetase; Provisional Back     alignment and domain information
>gnl|CDD|30166 cd00553, NAD_synthase, NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>gnl|CDD|145596 pfam02540, NAD_synthase, NAD synthase Back     alignment and domain information
>gnl|CDD|30520 COG0171, NadE, NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184435 PRK13980, PRK13980, NAD synthetase; Provisional Back     alignment and domain information
>gnl|CDD|161924 TIGR00552, nadE, NAD+ synthetase Back     alignment and domain information
>gnl|CDD|30737 COG0388, COG0388, Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|143587 cd07197, nitrilase, Nitrilase superfamily, including nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes Back     alignment and domain information
>gnl|CDD|143610 cd07586, nitrilase_8, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>gnl|CDD|143600 cd07576, R-amidase_like, Pseudomonas sp Back     alignment and domain information
>gnl|CDD|143608 cd07584, nitrilase_6, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>gnl|CDD|143609 cd07585, nitrilase_7, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>gnl|CDD|163242 TIGR03381, agmatine_aguB, N-carbamoylputrescine amidase Back     alignment and domain information
>gnl|CDD|143594 cd07570, GAT_Gln-NAD-synth, Glutamine aminotransferase (GAT, glutaminase) domain of glutamine-dependent NAD synthetases (class 7 and 8 nitrilases) Back     alignment and domain information
>gnl|CDD|179454 PRK02628, nadE, NAD synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|37514 KOG2303, KOG2303, KOG2303, Predicted NAD synthase, contains CN hydrolase domain [Coenzyme transport and metabolism, General function prediction only] Back     alignment and domain information
>gnl|CDD|177973 PLN02339, PLN02339, NAD+ synthase (glutamine-hydrolysing) Back     alignment and domain information
>gnl|CDD|144405 pfam00795, CN_hydrolase, Carbon-nitrogen hydrolase Back     alignment and domain information
>gnl|CDD|143604 cd07580, nitrilase_2, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>gnl|CDD|143607 cd07583, nitrilase_5, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>gnl|CDD|143601 cd07577, Ph0642_like, Pyrococcus horikoshii Ph0642 and related proteins, members of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>gnl|CDD|143605 cd07581, nitrilase_3, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>gnl|CDD|143588 cd07564, nitrilases_CHs, Nitrilases, cyanide hydratase (CH)s, and similar proteins (class 1 nitrilases) Back     alignment and domain information
>gnl|CDD|36024 KOG0806, KOG0806, KOG0806, Carbon-nitrogen hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143596 cd07572, nit, Nit1, Nit 2, and related proteins, and the Nit1-like domain of NitFhit (class 10 nitrilases) Back     alignment and domain information
>gnl|CDD|143597 cd07573, CPA, N-carbamoylputrescine amidohydrolase (CPA) (class 11 nitrilases) Back     alignment and domain information
>gnl|CDD|143590 cd07566, ScNTA1_like, Saccharomyces cerevisiae N-terminal amidase NTA1, and related proteins (class 3 nitrilases) Back     alignment and domain information
>gnl|CDD|143603 cd07579, nitrilase_1_R2, Second nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>gnl|CDD|178348 PLN02747, PLN02747, N-carbamolyputrescine amidase Back     alignment and domain information
>gnl|CDD|143593 cd07569, DCase, N-carbamyl-D-amino acid amidohydrolase (DCase, class 6 nitrilases) Back     alignment and domain information
>gnl|CDD|143602 cd07578, nitrilase_1_R1, First nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>gnl|CDD|178395 PLN02798, PLN02798, nitrilase Back     alignment and domain information
>gnl|CDD|179150 PRK00876, nadE, NAD synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|185554 PTZ00323, PTZ00323, NAD+ synthase; Provisional Back     alignment and domain information
>gnl|CDD|179116 PRK00768, nadE, NAD synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|31794 COG1606, COG1606, ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|129369 TIGR00268, TIGR00268, conserved hypothetical protein TIGR00268 Back     alignment and domain information
>gnl|CDD|30177 cd01990, Alpha_ANH_like_I, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>gnl|CDD|129461 TIGR00364, TIGR00364, exsB protein Back     alignment and domain information
>gnl|CDD|30948 COG0603, COG0603, Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178898 PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Reviewed Back     alignment and domain information
>gnl|CDD|30178 cd01991, Asn_Synthase_B_C, The C-terminal domain of Asparagine Synthase B Back     alignment and domain information
>gnl|CDD|30185 cd01998, tRNA_Me_trans, tRNA methyl transferase Back     alignment and domain information
>gnl|CDD|145938 pfam03054, tRNA_Me_trans, tRNA methyl transferase Back     alignment and domain information
>gnl|CDD|148238 pfam06508, ExsB, ExsB Back     alignment and domain information
>gnl|CDD|36023 KOG0805, KOG0805, KOG0805, Carbon-nitrogen hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178120 PLN02504, PLN02504, nitrilase Back     alignment and domain information
>gnl|CDD|179167 PRK00919, PRK00919, GMP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|30184 cd01997, GMP_synthase_C, The C-terminal domain of GMP synthetase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 562 NAD synthetase [Candidatus Liberibacter asiaticus str.
PRK13981543 NAD synthetase; Provisional 100.0
PRK02628678 nadE NAD synthetase; Reviewed 100.0
KOG2303706 consensus 100.0
PRK13980264 NAD synthetase; Provisional 100.0
cd00553248 NAD_synthase NAD+ synthase is a homodimer, which cataly 100.0
pfam02540243 NAD_synthase NAD synthase. NAD synthase (EC:6.3.5.1) is 100.0
PTZ00323294 NAD+ synthase; Provisional 100.0
COG0171268 NadE NAD synthase [Coenzyme metabolism] 100.0
PRK00768274 nadE NAD synthetase; Reviewed 100.0
PRK00876325 nadE NAD synthetase; Reviewed 100.0
TIGR00552286 nadE NAD+ synthetase; InterPro: IPR003694 NAD+ synthase 100.0
TIGR00268263 TIGR00268 conserved hypothetical protein TIGR00268; Int 99.22
cd07570261 GAT_Gln-NAD-synth Glutamine aminotransferase (GAT, glut 100.0
cd07586269 nitrilase_8 Uncharacterized subgroup of the nitrilase s 100.0
cd07576254 R-amidase_like Pseudomonas sp. MCI3434 R-amidase and re 100.0
cd07585261 nitrilase_7 Uncharacterized subgroup of the nitrilase s 100.0
cd07583253 nitrilase_5 Uncharacterized subgroup of the nitrilase s 100.0
cd07584258 nitrilase_6 Uncharacterized subgroup of the nitrilase s 100.0
TIGR03381279 agmatine_aguB N-carbamoylputrescine amidase. Members of 100.0
cd07573284 CPA N-carbamoylputrescine amidohydrolase (CPA) (class 1 100.0
cd07580268 nitrilase_2 Uncharacterized subgroup of the nitrilase s 100.0
cd07568287 ML_beta-AS_like mammalian-like beta-alanine synthase (b 100.0
cd07581255 nitrilase_3 Uncharacterized subgroup of the nitrilase s 100.0
cd07572265 nit Nit1, Nit 2, and related proteins, and the Nit1-lik 100.0
cd07197253 nitrilase Nitrilase superfamily, including nitrile- or 100.0
cd07577259 Ph0642_like Pyrococcus horikoshii Ph0642 and related pr 100.0
cd07569302 DCase N-carbamyl-D-amino acid amidohydrolase (DCase, cl 100.0
PRK10438256 hypothetical protein; Provisional 100.0
cd07578258 nitrilase_1_R1 First nitrilase domain of an uncharacter 100.0
cd07575252 Xc-1258_like Xanthomonas campestris XC1258 and related 100.0
cd07564297 nitrilases_CHs Nitrilases, cyanide hydratase (CH)s, and 100.0
COG0388274 Predicted amidohydrolase [General function prediction o 100.0
cd07565291 aliphatic_amidase aliphatic amidases (class 2 nitrilase 100.0
cd07574280 nitrilase_Rim1_like Uncharacterized subgroup of the nit 100.0
cd07579279 nitrilase_1_R2 Second nitrilase domain of an uncharacte 100.0
cd07582294 nitrilase_4 Uncharacterized subgroup of the nitrilase s 100.0
cd07587363 ML_beta-AS mammalian-like beta-alanine synthase (beta-A 100.0
cd07566295 ScNTA1_like Saccharomyces cerevisiae N-terminal amidase 100.0
KOG0807295 consensus 100.0
cd07571270 ALP_N-acyl_transferase Apolipoprotein N-acyl transferas 99.98
KOG0806298 consensus 99.98
PRK00302509 lnt apolipoprotein N-acyltransferase; Reviewed 99.95
PRK13286343 amiE acylamide amidohydrolase; Provisional 99.94
KOG0805337 consensus 99.93
TIGR00546441 lnt apolipoprotein N-acyltransferase; InterPro: IPR0045 99.9
COG0815518 Lnt Apolipoprotein N-acyltransferase [Cell envelope bio 99.9
cd07567299 biotinidase_like biotinidase and vanins (class 4 nitril 99.88
KOG0808387 consensus 99.85
pfam00795172 CN_hydrolase Carbon-nitrogen hydrolase. This family con 100.0
PRK13287333 amiF formamidase; Provisional 99.97
PRK12291420 apolipoprotein N-acyltransferase; Reviewed 99.87
pfam07186396 consensus 98.3
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nucleot 99.54
PRK00074513 guaA GMP synthase; Reviewed 99.27
PRK00919306 GMP synthase subunit B; Validated 99.25
TIGR00884319 guaA_Cterm GMP synthase, C-terminal domain; InterPro: I 99.14
cd01997295 GMP_synthase_C The C-terminal domain of GMP synthetase. 99.13
COG0519315 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide 98.84
KOG1622552 consensus 98.32
PRK01269483 thiamine biosynthesis protein ThiI; Provisional 97.88
PRK00509398 argininosuccinate synthase; Provisional 97.4
COG0301383 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzym 97.05
cd01998349 tRNA_Me_trans tRNA methyl transferase. This family repr 99.39
PRK00143355 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 99.39
COG1606269 ATP-utilizing enzymes of the PP-loop superfamily [Gener 99.38
pfam03054354 tRNA_Me_trans tRNA methyl transferase. This family repr 99.34
COG0482356 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate 99.17
TIGR00420394 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 99.13
TIGR00364227 TIGR00364 exsB protein; InterPro: IPR004479 This protei 98.98
KOG2805377 consensus 98.98
COG0603222 Predicted PP-loop superfamily ATPase [General function 98.62
PRK11106231 queuosine biosynthesis protein QueC; Provisional 98.49
cd01712177 ThiI ThiI is required for thiazole synthesis in the thi 98.4
pfam02568197 ThiI Thiamine biosynthesis protein (ThiI). ThiI is requ 98.39
COG0037298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle contr 98.33
KOG0571543 consensus 98.22
TIGR01536646 asn_synth_AEB asparagine synthase (glutamine-hydrolyzin 98.1
COG0367542 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino 98.09
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine nucleo 98.0
pfam01171182 ATP_bind_3 PP-loop family. This family of proteins belo 97.99
PRK01565399 thiamine biosynthesis protein ThiI; Provisional 97.87
cd01713173 PAPS_reductase This domain is found in phosphoadenosine 97.77
PRK13795 630 hypothetical protein; Provisional 97.77
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of the 97.69
PRK08349198 hypothetical protein; Validated 97.65
PRK10696311 C32 tRNA thiolase; Provisional 97.18
PRK04527 397 argininosuccinate synthase; Provisional 97.12
pfam01507174 PAPS_reduct Phosphoadenosine phosphosulfate reductase f 97.06
PRK13820 395 argininosuccinate synthase; Provisional 97.06
TIGR02432204 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro 96.51
COG1365255 Predicted ATPase (PP-loop superfamily) [General functio 96.49
TIGR00342391 TIGR00342 thiamine biosynthesis/tRNA modification prote 96.11
cd01999 385 Argininosuccinate_Synthase Argininosuccinate synthase. 95.78
COG0175261 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransfe 94.8
PRK08384310 thiamine biosynthesis protein ThiI; Provisional 93.26
PTZ00077610 asparagine synthetase; Provisional 98.62
pfam00733195 Asn_synthase Asparagine synthase. This family is always 98.37
TIGR03104589 trio_amidotrans asparagine synthase family amidotransfe 98.35
TIGR03108 628 eps_aminotran_1 exosortase 1 system-associated amidotra 98.3
cd01991269 Asn_Synthase_B_C The C-terminal domain of Asparagine Sy 98.24
PRK09431555 asnB asparagine synthetase B; Provisional 98.17
TIGR00032 420 argG argininosuccinate synthase; InterPro: IPR001518 Ar 95.94
PRK13825389 conjugal transfer protein TraB; Provisional 98.61
pfam06508137 ExsB ExsB. This family includes putative transcriptiona 98.25
TIGR03573343 WbuX N-acetyl sugar amidotransferase. This enzyme has b 98.09
cd01996154 Alpha_ANH_like_III This is a subfamily of Adenine nucle 97.84
cd01995169 ExsB ExsB is a transcription regulator related protein. 97.7
PRK13794473 hypothetical protein; Provisional 97.57
PRK08576439 hypothetical protein; Provisional 97.31
PRK08557420 hypothetical protein; Provisional 97.28
PRK10660 433 tilS tRNA(Ile)-lysidine synthetase; Provisional 96.98
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases supe 96.81
pfam00764 389 Arginosuc_synth Arginosuccinate synthase. This family c 95.47
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine nucleo 95.05
pfam01902219 ATP_bind_4 ATP-binding region. This family of proteins 93.43
PRK05370447 argininosuccinate synthase; Validated 96.76
KOG0573520 consensus 90.8
cd0198486 AANH_like Adenine nucleotide alpha hydrolases superfami 90.44
COG0137403 ArgG Argininosuccinate synthase [Amino acid transport a 94.59
PRK06850488 hypothetical protein; Provisional 90.04
>PRK13981 NAD synthetase; Provisional Back     alignment and domain information
>PRK02628 nadE NAD synthetase; Reviewed Back     alignment and domain information
>KOG2303 consensus Back     alignment and domain information
>PRK13980 NAD synthetase; Provisional Back     alignment and domain information
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>pfam02540 NAD_synthase NAD synthase Back     alignment and domain information
>PTZ00323 NAD+ synthase; Provisional Back     alignment and domain information
>COG0171 NadE NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK00768 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PRK00876 nadE NAD synthetase; Reviewed Back     alignment and domain information
>TIGR00552 nadE NAD+ synthetase; InterPro: IPR003694 NAD+ synthase (6 Back     alignment and domain information
>TIGR00268 TIGR00268 conserved hypothetical protein TIGR00268; InterPro: IPR005232 This family of conserved hypothetical proteins has no known function but is predicted to be part of the wider PP-loop superfamily Back     alignment and domain information
>cd07570 GAT_Gln-NAD-synth Glutamine aminotransferase (GAT, glutaminase) domain of glutamine-dependent NAD synthetases (class 7 and 8 nitrilases) Back     alignment and domain information
>cd07586 nitrilase_8 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07576 R-amidase_like Pseudomonas sp Back     alignment and domain information
>cd07585 nitrilase_7 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07583 nitrilase_5 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07584 nitrilase_6 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>TIGR03381 agmatine_aguB N-carbamoylputrescine amidase Back     alignment and domain information
>cd07573 CPA N-carbamoylputrescine amidohydrolase (CPA) (class 11 nitrilases) Back     alignment and domain information
>cd07580 nitrilase_2 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07568 ML_beta-AS_like mammalian-like beta-alanine synthase (beta-AS) and similar proteins (class 5 nitrilases) Back     alignment and domain information
>cd07581 nitrilase_3 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07572 nit Nit1, Nit 2, and related proteins, and the Nit1-like domain of NitFhit (class 10 nitrilases) Back     alignment and domain information
>cd07197 nitrilase Nitrilase superfamily, including nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes Back     alignment and domain information
>cd07577 Ph0642_like Pyrococcus horikoshii Ph0642 and related proteins, members of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07569 DCase N-carbamyl-D-amino acid amidohydrolase (DCase, class 6 nitrilases) Back     alignment and domain information
>PRK10438 hypothetical protein; Provisional Back     alignment and domain information
>cd07578 nitrilase_1_R1 First nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07575 Xc-1258_like Xanthomonas campestris XC1258 and related proteins, members of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07564 nitrilases_CHs Nitrilases, cyanide hydratase (CH)s, and similar proteins (class 1 nitrilases) Back     alignment and domain information
>COG0388 Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>cd07565 aliphatic_amidase aliphatic amidases (class 2 nitrilases) Back     alignment and domain information
>cd07574 nitrilase_Rim1_like Uncharacterized subgroup of the nitrilase superfamily; some members of this subgroup have an N-terminal RimI domain (class 12 nitrilases) Back     alignment and domain information
>cd07579 nitrilase_1_R2 Second nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07582 nitrilase_4 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07587 ML_beta-AS mammalian-like beta-alanine synthase (beta-AS) and similar proteins (class 5 nitrilases) Back     alignment and domain information
>cd07566 ScNTA1_like Saccharomyces cerevisiae N-terminal amidase NTA1, and related proteins (class 3 nitrilases) Back     alignment and domain information
>KOG0807 consensus Back     alignment and domain information
>cd07571 ALP_N-acyl_transferase Apolipoprotein N-acyl transferase (class 9 nitrilases) Back     alignment and domain information
>KOG0806 consensus Back     alignment and domain information
>PRK00302 lnt apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>PRK13286 amiE acylamide amidohydrolase; Provisional Back     alignment and domain information
>KOG0805 consensus Back     alignment and domain information
>TIGR00546 lnt apolipoprotein N-acyltransferase; InterPro: IPR004563 Apolipoprotein N-acyltransferase 2 Back     alignment and domain information
>COG0815 Lnt Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd07567 biotinidase_like biotinidase and vanins (class 4 nitrilases) Back     alignment and domain information
>KOG0808 consensus Back     alignment and domain information
>pfam00795 CN_hydrolase Carbon-nitrogen hydrolase Back     alignment and domain information
>PRK13287 amiF formamidase; Provisional Back     alignment and domain information
>PRK12291 apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>pfam07186 consensus Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase, C-terminal domain; InterPro: IPR001674 The amidotransferase family of enzymes utilises the ammonia derived from the hydrolysis of glutamine for a subsequent chemical reaction catalyzed by the same enzyme Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1622 consensus Back     alignment and domain information
>PRK01269 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PRK00509 argininosuccinate synthase; Provisional Back     alignment and domain information
>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism] Back     alignment and domain information
>cd01998 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>PRK00143 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; Reviewed Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>pfam03054 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; InterPro: IPR004506 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (2 Back     alignment and domain information
>TIGR00364 TIGR00364 exsB protein; InterPro: IPR004479 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome Back     alignment and domain information
>KOG2805 consensus Back     alignment and domain information
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>PRK11106 queuosine biosynthesis protein QueC; Provisional Back     alignment and domain information
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>pfam02568 ThiI Thiamine biosynthesis protein (ThiI) Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0571 consensus Back     alignment and domain information
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing); InterPro: IPR006426 These sequences represent glutamine-hydrolysing asparagine synthase Back     alignment and domain information
>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>pfam01171 ATP_bind_3 PP-loop family Back     alignment and domain information
>PRK01565 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK08349 hypothetical protein; Validated Back     alignment and domain information
>PRK10696 C32 tRNA thiolase; Provisional Back     alignment and domain information
>PRK04527 argininosuccinate synthase; Provisional Back     alignment and domain information
>pfam01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro: IPR012795 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00342 TIGR00342 thiamine biosynthesis/tRNA modification protein ThiI; InterPro: IPR003720 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell Back     alignment and domain information
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase Back     alignment and domain information
>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK08384 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PTZ00077 asparagine synthetase; Provisional Back     alignment and domain information
>pfam00733 Asn_synthase Asparagine synthase Back     alignment and domain information
>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase Back     alignment and domain information
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B Back     alignment and domain information
>PRK09431 asnB asparagine synthetase B; Provisional Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6 Back     alignment and domain information
>PRK13825 conjugal transfer protein TraB; Provisional Back     alignment and domain information
>pfam06508 ExsB ExsB Back     alignment and domain information
>TIGR03573 WbuX N-acetyl sugar amidotransferase Back     alignment and domain information
>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>PRK13794 hypothetical protein; Provisional Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>PRK08557 hypothetical protein; Provisional Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>pfam00764 Arginosuc_synth Arginosuccinate synthase Back     alignment and domain information
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>pfam01902 ATP_bind_4 ATP-binding region Back     alignment and domain information
>PRK05370 argininosuccinate synthase; Validated Back     alignment and domain information
>KOG0573 consensus Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06850 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target562 NAD synthetase [Candidatus Liberibacter asiaticus str.
3n05_A590 Crystal Structure Of Nh3-Dependent Nad+ Synthetase 1e-135
3dla_A680 X-Ray Crystal Structure Of Glutamine-Dependent Nad+ 8e-87
3ilv_A634 Crystal Structure Of A Glutamine-Dependent Nad(+) S 3e-73
2e18_A257 Crystal Structure Of Project Ph0182 From Pyrococcus 1e-41
1xng_A268 Crystal Structure Of Nh3-Dependent Nad+ Synthetase 1e-31
3fiu_A249 Structure Of Nmn Synthetase From Francisella Tulare 2e-30
3p52_A249 Nh3-Dependent Nad Synthetase From Campylobacter Jej 2e-29
2pz8_A284 Nad+ Synthetase From Bacillus Anthracis With Amp-Cp 4e-25
1nsy_A271 Crystal Structure Of Nh3-Dependent Nad+ Synthetase 3e-24
1wxe_A275 E.Coli Nad Synthetase, Amp Length = 275 8e-20
3hmq_A275 1.9 Angstrom Resolution Crystal Structure Of A Nad 5e-18
3q4g_A279 Structure Of Nad Synthetase From Vibrio Cholerae Le 1e-13
3ivz_A262 Crystal Structure Of Hyperthermophilic Nitrilase Le 1e-31
1j31_A262 Crystal Structure Of Hypothetical Protein Ph0642 Fr 2e-29
2w1v_A276 Crystal Structure Of Mouse Nitrilase-2 At 1.4a Reso 2e-28
1f89_A291 Crystal Structure Of Saccharomyces Cerevisiae Nit3, 2e-26
3hkx_A283 Crystal Structure Analysis Of An Amidase From Neste 7e-22
2ggl_A304 The Mutant A222c Of Agrobacterium Radiobacter N-Car 2e-19
1fo6_A304 Crystal Structure Analysis Of N-Carbamoyl-D-Amino-A 3e-19
2ggk_A304 The Mutant A302c Of Agrobacterium Radiobacter N-Car 3e-19
1erz_A303 Crystal Structure Of N-Carbamyl-D-Amino Acid Amidoh 6e-19
1uf4_A303 Crystal Structure Of C171aV236A MUTANT OF N-Carbamy 4e-18
2vhh_A405 Crystal Structure Of A Pyrimidine Degrading Enzyme 6e-17
1ems_A440 Crystal Structure Of The C. Elegans Nitfhit Protein 1e-16
2dyu_A334 Helicobacter Pylori Formamidase Amif Contains A Fin 4e-16
2e11_A266 The Crystal Structure Of Xc1258 From Xanthomonas Ca 4e-16
2e2k_A334 Helicobacter Pylori Formamidase Amif Contains A Fin 5e-16
2plq_A348 Crystal Structure Of The Amidase From Geobacillus P 7e-12
2uxy_A341 Aliphatic Amidase Length = 341 2e-11
3dpi_A285 Crystal Structure Of Nad+ Synthetase From Burkholde 5e-18
>gi|300193273|pdb|3N05|A Chain A, Crystal Structure Of Nh3-Dependent Nad+ Synthetase From Streptomyces Avermitilis Length = 590 Back     alignment and structure
 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 211/592 (35%), Positives = 310/592 (52%), Gaps = 44/592 (7%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  +L++A+ Q++  VGDIAGN     R    +  QG  L+ F E+ ++GYP EDL  + 
Sbjct: 1   MSLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRS 60

Query: 61  SFIQACSSAIDTLKSDTHDGG---AGIVVGFPRQDQ----------EGVLNSVVILDAGN 107
           SF++A  +A+  L +   + G     ++VG+  + +              N+  +L  G 
Sbjct: 61  SFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGR 120

Query: 108 IIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG 167
           +     K +LPNY  F E R F+ G +   +    + + + ICED+W++       +  G
Sbjct: 121 VALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAG 180

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
           A  L S+NASPY  +K   R E+V  +         Y+  +GGQDEL+FDG S   D   
Sbjct: 181 AGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDG 240

Query: 228 QLAFQMKHFSEQNFMTEWHY------------DQQLSQWNYMSDDSASTMYIP------- 268
           ++  +   FSE   + +               D  L     +  +     Y         
Sbjct: 241 EVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYA 300

Query: 269 --LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIML 326
             L  +E  Y+A V+ LR YV KN F  V+IGLSGGIDSAL AAIA DALG +NV  + +
Sbjct: 301 DRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSM 360

Query: 327 PYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRI 386
           P KY+S  S  DAA  A+  G  +  + I  + + + + +        +G+  EN+QSR+
Sbjct: 361 PSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLG------LTGLAEENLQSRL 414

Query: 387 RGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNS 446
           RG  LMA+SN    ++L   NKSE++VGY TLYGD  G + P+KD+YKT +F+LA WRN 
Sbjct: 415 RGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNR 474

Query: 447 HGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN 506
                G  P    IP + + K PSAELRP Q D +SLP YP+LD I++  V+ +      
Sbjct: 475 AAAERGQTP---PIPEASITKPPSAELRPGQVDTDSLPDYPVLDAILELYVDRDTGADAI 531

Query: 507 -DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
               Y+ E V     ++  +EYKRRQ P GTKI+AK FG+DR  PI+N++R+
Sbjct: 532 VAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWRE 583


>gi|224983478|pdb|3DLA|A Chain A, X-Ray Crystal Structure Of Glutamine-Dependent Nad+ Synthetase From Mycobacterium Tuberculosis Bound To Naad+ And Don Length = 680 Back     alignment and structure
>gi|256032930|pdb|3ILV|A Chain A, Crystal Structure Of A Glutamine-Dependent Nad(+) Synthetase From Cytophaga Hutchinsonii Length = 634 Back     alignment and structure
gi|146386765|pdb|2E18|A Chain A, Crystal Structure Of Project Ph0182 From Pyrococcus Horikoshii Ot3 Length = 257 Back     alignment and structure
>gi|62738501|pdb|1XNG|A Chain A, Crystal Structure Of Nh3-Dependent Nad+ Synthetase From Helicobacter Pylori Length = 268 Back     alignment and structure
gi|224510802|pdb|3FIU|A Chain A, Structure Of Nmn Synthetase From Francisella Tularensis Length = 249 Back     alignment and structure
>gi|310689987|pdb|3P52|A Chain A, Nh3-Dependent Nad Synthetase From Campylobacter Jejuni Subsp. Jejuni Nctc 11168 In Complex With The Nitrate Ion Length = 249 Back     alignment and structure
>gi|157835806|pdb|2PZ8|A Chain A, Nad+ Synthetase From Bacillus Anthracis With Amp-Cpp And Mg2+ Length = 284 Back     alignment and structure
>gi|2392477|pdb|1NSY|A Chain A, Crystal Structure Of Nh3-Dependent Nad+ Synthetase From Bacillus Subtilis Length = 271 Back     alignment and structure
gi|61680276|pdb|1WXE|A Chain A, E.Coli Nad Synthetase, Amp Length = 275 Back     alignment and structure
>gi|240104631|pdb|3HMQ|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Nad Synthetase (Nade) From Salmonella Typhimurium Lt2 In Complex With Nad(+) Length = 275 Back     alignment and structure
>gi|320089948|pdb|3Q4G|A Chain A, Structure Of Nad Synthetase From Vibrio Cholerae Length = 279 Back     alignment and structure
>gi|307568126|pdb|3IVZ|A Chain A, Crystal Structure Of Hyperthermophilic Nitrilase Length = 262 Back     alignment and structure
>gi|47168348|pdb|1J31|A Chain A, Crystal Structure Of Hypothetical Protein Ph0642 From Pyrococcus Horikoshii Length = 262 Back     alignment and structure