254781003

254781003

hypothetical protein CLIBASIA_04520

GeneID in NCBI database:8210025Locus tag:CLIBASIA_04520
Protein GI in NCBI database:254781003Protein Accession:YP_003065416.1
Gene range:-(998865, 999779)Protein Length:304aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MIRKYVLALVFFLVPCTASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAKVFPKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKNVRVLQQSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKDSRCNANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDYDF
cHHHHHHHHHHHHHcccHHHccEEEEEEEEHHHHHHHcccccccccccccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHccccccEEEEEccccccccccccccccccEEEEEccccccccccccccccccccccccccccEEEEEEccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHccHHHHHHccccccccccccccccccccccEEEEcccccccccccccEEEEccccccccHHHcccccccEEEEEcc
ccHHHHHHHHHHHcccccccccccEEccccHHHHccccccccccccccccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHcccccEEEEEcccccccccccccccccEEEEEEEccccEEEEcccHHcccccccccccccEEEEEEEEEcccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccHHHHHcccccccccccHHHccccccccccccccccEEEEEcHHHHHHHcHcccEEEEEcccHHHHHcHHHcccccEEEEccc
MIRKYVLALVFFLVPCTASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSynavakvfpkntwcifYSTERlinhskrdsnndIHTAIAVRKKNVRVLQQsypllgakdsfsragNRRAVELLVEINGKKIWVLDIHLKSfcfldslentyspscsllSQQAQWLKDWITqkkeslvpfviagdfnrkinylgnnddfwktidpndslirfpkekdsrcnanknlrnkipidyfvmDQNAYKFLIQESFSEilyneddiksrgkrlsdhcpisidydf
MIRKYVLALVFFLVPCTASVAQKVRLVSWNINtlseqegvslwknsvKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAKVFPKNTWCIFYSTERLinhskrdsnNDIHTAIAVRKKNVRVLQQSYPllgakdsfsragNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLirfpkekdsrcnanknlrnkipidYFVMDQNAYKFLIQESFSEILYNEDDiksrgkrlsdhcpisidydf
MIRKYVLALVFFLVPCTASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAKVFPKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKNVRVLQQSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKDSRCNANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDYDF
**RKYVLALVFFLVPCTASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAKVFPKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKNVRVLQQSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFC************CSLLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKDSRCNANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDYDF
MIRKYVLALVFFLVPCTASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAKVFPKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKNVRVLQQSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKDSRCNANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDYDF
MIRKYVLALVFFLVPCTASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAKVFPKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKNVRVLQQSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKDSRCNANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDYDF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MIRKYVLALVFFLVPCTASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAKVFPKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKNVRVLQQSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKDSRCNANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDYDF
MIRKYVLALVFFLVPCTASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAKVFPKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKNVRVLQQSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKDSRCNANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDYDF
MIRKYVLALVFFLVPCTASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAKVFPKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKNVRVLQQSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKDSRCNANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDYDF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target304 hypothetical protein CLIBASIA_04520 [Candidatus Liberib
254780797231 hypothetical protein CLIBASIA_03440 [Candidatus Li 5e-66
254780995125 Endonuclease/exonuclease/phosphatase [Candidatus L 1e-36
254780996109 hypothetical protein CLIBASIA_04485 [Candidatus Li 1e-17
>gi|254780797|ref|YP_003065210.1| hypothetical protein CLIBASIA_03440 [Candidatus Liberibacter asiaticus str. psy62] Length = 231 Back     alignment
 Score =  242 bits (618), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 118/235 (50%), Positives = 166/235 (70%), Gaps = 9/235 (3%)

Query: 20  VAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNA 79
           +AQ++R+ SWNIN LSE+ GV+L+KNSV R  +DY LL++YA+ LDADIV LQE+GSY A
Sbjct: 3   LAQRIRIASWNINNLSEKSGVALFKNSVIREDNDYALLQKYAEQLDADIVCLQEIGSYEA 62

Query: 80  VAKVFPKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKNVRVLQQSYPLLGAKDSFSR 139
           + +VFP + W I YS      H+       +HTAI +RK  + +LQ+SY  +  +   S+
Sbjct: 63  IKRVFPNDKWDILYSGSNTDKHA-------MHTAIVIRKGAIHLLQKSYLPMDTEGLDSK 115

Query: 140 AGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDWITQKK 199
           AG RRAVE+L E++G+KIW+LDIHLKSFCFLDS+E++Y  SC +L+ QA WLK W+ QK 
Sbjct: 116 AGKRRAVEILFEVDGRKIWLLDIHLKSFCFLDSIEDSYISSCYMLNLQATWLKQWVDQKN 175

Query: 200 ESLVPFVIAGDFNRKIN--YLGNNDDFWKTIDPNDSLIRFPKEKDSRCNANKNLR 252
              +PF+IAGDFNRKIN  + G  D+ W+ I+ +++L+R P +K+      K L+
Sbjct: 176 NLNMPFIIAGDFNRKINHSHSGIKDELWQKINQDNTLMRLPHKKNHNAIRTKILK 230

>gi|254780995|ref|YP_003065408.1| Endonuclease/exonuclease/phosphatase [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Back     alignment
 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 92/122 (75%), Gaps = 2/122 (1%)

Query: 183 LLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKD 242
           +LSQQ +WLK W  QK ++ +PFVIAGDFNRKIN +G+ DDFW+ +DP+  LIRFP+EK+
Sbjct: 1   MLSQQGEWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLLIRFPQEKE 60

Query: 243 SRCNANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDY 302
           S CN  K  RNK  +DYFV+D++   FLI  SFS + Y++ D+ +R  +LS HCP++I+Y
Sbjct: 61  STCNVIK--RNKSSLDYFVIDRDNKNFLIDNSFSIVSYDQSDLDTRRSKLSTHCPLTIEY 118

Query: 303 DF 304
           DF
Sbjct: 119 DF 120

>gi|254780996|ref|YP_003065409.1| hypothetical protein CLIBASIA_04485 [Candidatus Liberibacter asiaticus str. psy62] Length = 109 Back     alignment
 Score = 82.4 bits (202), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (58%), Gaps = 18/109 (16%)

Query: 84  FPKNTWCIFYS----------TERLINHSKRDSNN--------DIHTAIAVRKKNVRVLQ 125
            P++ W IFYS           +  +N S  D N+        DI+TAIA+RK   RVLQ
Sbjct: 1   MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60

Query: 126 QSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLE 174
            SYPL   ++   R GNR+ VELL+EI+ +K+W+L++HLKS C +  ++
Sbjct: 61  VSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ 109

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target304 hypothetical protein CLIBASIA_04520 [Candidatus Liberib
315122019315 hypothetical protein CKC_01345 [Candidatus Liberibacter 1 2e-92
254780797231 hypothetical protein CLIBASIA_03440 [Candidatus Liberib 1 4e-62
254780995125 Endonuclease/exonuclease/phosphatase [Candidatus Liberi 1 9e-33
330993334283 endonuclease/exonuclease/phosphatase [Gluconacetobacter 1 2e-23
262195540 406 endonuclease/exonuclease/phosphatase [Haliangium ochrac 1 6e-23
114328405358 hypothetical protein GbCGDNIH1_1741 [Granulibacter beth 1 1e-22
162147973290 endonuclease/exonuclease/phosphatase family protein [Gl 1 2e-22
296115009293 Endonuclease/exonuclease/phosphatase [Gluconacetobacter 1 1e-21
295689871288 endonuclease/exonuclease/phosphatase [Caulobacter segni 1 3e-21
258541736321 hypothetical protein APA01_06400 [Acetobacter pasteuria 1 2e-20
>gi|315122019|ref|YP_004062508.1| hypothetical protein CKC_01345 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 315 Back     alignment and organism information
 Score =  343 bits (879), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 167/304 (54%), Positives = 218/304 (71%), Gaps = 8/304 (2%)

Query: 1   MIRKYVLALVFFLVPCTASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQY 60
           ++R   L L F  +P   + AQ++R+ SWNINTLSE+ G+ L KNSV R  +DY LLR+Y
Sbjct: 17  LLRSVALVLFFCFIP-NENFAQRIRIASWNINTLSEKSGMPLLKNSVVREDADYDLLRRY 75

Query: 61  AKNLDADIVFLQEMGSYNAVAKVFPKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKN 120
           A+ L+ADIV LQEMGSY A+ +VFP++TW I YS      H+       +HTAI  RK  
Sbjct: 76  AERLNADIVCLQEMGSYAAIKRVFPEDTWEILYSGNDSDEHT-------VHTAIVARKGT 128

Query: 121 VRVLQQSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPS 180
           V VL++SY  +      S+AG RR+VE+L E+NG KIW+LDIHLKSFCF+DSL++ Y+ S
Sbjct: 129 VHVLEKSYLSMDTNKLDSKAGKRRSVEILFEVNGIKIWLLDIHLKSFCFVDSLKDAYTLS 188

Query: 181 CSLLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKE 240
           C  L+ Q  WL  WI QKK S +PF+IAGDFNRKIN+ G+ND+ W  I  +  LIR P +
Sbjct: 189 CYTLNLQVNWLNKWIHQKKRSNIPFIIAGDFNRKINHFGDNDELWGKISKDTILIRVPNK 248

Query: 241 KDSRCNANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISI 300
           K S CNA+K++R + PID+FVMDQNAYK+LI+ S+SE+ Y E+DIK RG RLSDHCPI+ 
Sbjct: 249 KRSWCNAHKSIRKREPIDFFVMDQNAYKYLIENSYSEVSYIEEDIKKRGYRLSDHCPITT 308

Query: 301 DYDF 304
           DY+F
Sbjct: 309 DYNF 312


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254780797|ref|YP_003065210.1| hypothetical protein CLIBASIA_03440 [Candidatus Liberibacter asiaticus str. psy62] Length = 231 Back     alignment and organism information
>gi|254780995|ref|YP_003065408.1| Endonuclease/exonuclease/phosphatase [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Back     alignment and organism information
>gi|330993334|ref|ZP_08317269.1| endonuclease/exonuclease/phosphatase [Gluconacetobacter sp. SXCC-1] Length = 283 Back     alignment and organism information
>gi|262195540|ref|YP_003266749.1| endonuclease/exonuclease/phosphatase [Haliangium ochraceum DSM 14365] Length = 406 Back     alignment and organism information
>gi|114328405|ref|YP_745562.1| hypothetical protein GbCGDNIH1_1741 [Granulibacter bethesdensis CGDNIH1] Length = 358 Back     alignment and organism information
>gi|162147973|ref|YP_001602434.1| endonuclease/exonuclease/phosphatase family protein [Gluconacetobacter diazotrophicus PAl 5] Length = 290 Back     alignment and organism information
>gi|296115009|ref|ZP_06833653.1| Endonuclease/exonuclease/phosphatase [Gluconacetobacter hansenii ATCC 23769] Length = 293 Back     alignment and organism information
>gi|295689871|ref|YP_003593564.1| endonuclease/exonuclease/phosphatase [Caulobacter segnis ATCC 21756] Length = 288 Back     alignment and organism information
>gi|258541736|ref|YP_003187169.1| hypothetical protein APA01_06400 [Acetobacter pasteurianus IFO 3283-01] Length = 321 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target304 hypothetical protein CLIBASIA_04520 [Candidatus Liberib
pfam03372255 pfam03372, Exo_endo_phos, Endonuclease/Exonuclease/phos 2e-09
>gnl|CDD|146159 pfam03372, Exo_endo_phos, Endonuclease/Exonuclease/phosphatase family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 304 hypothetical protein CLIBASIA_04520 [Candidatus Liberib
TIGR00633279 xth exodeoxyribonuclease III (xth); InterPro: IPR004808 100.0
TIGR00195281 exoDNase_III exodeoxyribonuclease III; InterPro: IPR000 99.98
TIGR03395283 sphingomy sphingomyelin phosphodiesterase. Members of t 99.97
PRK11756268 exonuclease III; Provisional 99.97
COG0708261 XthA Exonuclease III [DNA replication, recombination, a 99.96
COG3568259 ElsH Metal-dependent hydrolase [General function predic 99.96
pfam03372255 Exo_endo_phos Endonuclease/Exonuclease/phosphatase fami 99.96
PRK13911250 hypothetical protein; Provisional 99.95
smart00476276 DNaseIc deoxyribonuclease I. Deoxyribonuclease I cataly 99.94
COG5239378 CCR4 mRNA deadenylase, exonuclease subunit and related 99.86
KOG3873 422 consensus 99.86
COG2374798 Predicted extracellular nuclease [General function pred 99.86
PRK05421254 hypothetical protein; Provisional 99.85
KOG0620361 consensus 99.77
KOG2756349 consensus 99.74
PTZ00297 1452 pantothenate kinase; Provisional 99.58
KOG2338 495 consensus 99.9
smart00128310 IPPc Inositol polyphosphate phosphatase, catalytic doma 99.71
KOG0566 1080 consensus 99.6
KOG1294335 consensus 98.16
COG3021309 Uncharacterized protein conserved in bacteria [Function 99.62
COG5411 460 Phosphatidylinositol 5-phosphate phosphatase [Signal tr 98.62
KOG1976391 consensus 97.44
PTZ00312 356 inositol-1,4,5-triphosphate 5-phosphatase; Provisional 96.68
KOG1857623 consensus 96.15
>TIGR00633 xth exodeoxyribonuclease III (xth); InterPro: IPR004808 All proteins in this family for which functions are known are 5' AP endonucleases that function in base excision repair and the repair of abasic sites in DNA Back     alignment and domain information
>TIGR00195 exoDNase_III exodeoxyribonuclease III; InterPro: IPR000097 DNA damaging agents such as the antitumor drugs bleomycin and neocarzinostatin or those that generate oxygen radicals produce a variety of lesions in DNA Back     alignment and domain information
>TIGR03395 sphingomy sphingomyelin phosphodiesterase Back     alignment and domain information
>PRK11756 exonuclease III; Provisional Back     alignment and domain information
>COG0708 XthA Exonuclease III [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3568 ElsH Metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>pfam03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family Back     alignment and domain information
>PRK13911 hypothetical protein; Provisional Back     alignment and domain information
>smart00476 DNaseIc deoxyribonuclease I Back     alignment and domain information
>COG5239 CCR4 mRNA deadenylase, exonuclease subunit and related nucleases [RNA processing and modification] Back     alignment and domain information
>KOG3873 consensus Back     alignment and domain information
>COG2374 Predicted extracellular nuclease [General function prediction only] Back     alignment and domain information
>PRK05421 hypothetical protein; Provisional Back     alignment and domain information
>KOG0620 consensus Back     alignment and domain information
>KOG2756 consensus Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>KOG2338 consensus Back     alignment and domain information
>smart00128 IPPc Inositol polyphosphate phosphatase, catalytic domain homologues Back     alignment and domain information
>KOG0566 consensus Back     alignment and domain information
>KOG1294 consensus Back     alignment and domain information
>COG3021 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5411 Phosphatidylinositol 5-phosphate phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1976 consensus Back     alignment and domain information
>PTZ00312 inositol-1,4,5-triphosphate 5-phosphatase; Provisional Back     alignment and domain information
>KOG1857 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target304 hypothetical protein CLIBASIA_04520 [Candidatus Liberib
2ddr_A306 Crystal Structure Of Sphingomyelinase From Bacillus 3e-23
2uyr_X306 Crystal Structure Of Bacillus Cereus Sphingomyelina 6e-23
3mpr_A298 Crystal Structure Of EndonucleaseEXONUCLEASEPHOSPHA 1e-20
2jc4_A256 3'-5' Exonuclease (Nexo) From Neisseria Meningitidi 3e-19
3k55_A306 Structure Of Beta Hairpin Deletion Mutant Of Beta T 5e-19
3i5v_A313 Crystal Structure Of Beta Toxin 275-280 From Staphy 6e-19
3i41_A317 Crystal Structure Of Beta Toxin From Staphylococcus 4e-18
1ako_A268 Exonuclease Iii From Escherichia Coli Length = 268 9e-18
1zwx_A301 Crystal Structure Of Smcl Length = 301 4e-17
1atn_D260 Atomic Structure Of The Actin:dnase I Complex Lengt 5e-16
1dnk_A260 The X-Ray Structure Of The Dnase I-D(Ggtatacc)2 Com 7e-16
3g6s_A267 Crystal Structure Of The EndonucleaseEXONUCLEASEPHO 3e-15
2o3h_A285 Crystal Structure Of The Human C65a Ape Length = 28 6e-14
2isi_A317 Crystal Structure Of Ape1 From Homo Sapiens In A Ne 2e-13
1bix_A287 The Crystal Structure Of The Human Dna Repair Endon 2e-13
1e9n_A318 A Second Divalent Metal Ion In The Active Site Of A 2e-13
2jc5_A259 Apurinic Apyrimidinic (Ap) Endonuclease (Nape) From 3e-13
1dew_A279 Crystal Structure Of Human Ape1 Bound To Abasic Dna 3e-13
1de8_B276 Human ApurinicAPYRIMIDINIC ENDONUCLEASE-1 (Ape1) Bo 4e-13
3l1w_A257 The Crystal Structure Of A Functionally Unknown Con 5e-13
2o3c_A282 Crystal Structure Of Zebrafish Ape Length = 282 3e-12
3fzi_A265 1.9 Angstrom Structure Of The Thermophilic Exonucle 3e-11
3g91_A265 1.2 Angstrom Structure Of The Exonuclease Iii Homol 4e-11
2voa_A257 Structure Of An Ap Endonuclease From Archaeoglobus 4e-11
3g00_A265 Mth0212 In Complex With A 9bp Blunt End Dsdna At 1. 1e-10
3ngn_A398 Crystal Structure Of The Human Cnot6l Nuclease Doma 4e-09
3ngq_A398 Crystal Structure Of The Human Cnot6l Nuclease Doma 4e-09
1i9y_A347 Crystal Structure Of Inositol Polyphosphate 5-Phosp 1e-06
2j63_A467 Crystal Structure Of Ap Endonuclease Lmap From Leis 2e-06
2v0s_A236 Crystal Structure Of A Hairpin Exchange Variant (Lr 4e-06
1vyb_A238 Endonuclease Domain Of Human Line1 Orf2p Length = 2 3e-05
2v0r_A240 Crystal Structure Of A Hairpin Exchange Variant (Lt 2e-04
2f1n_A262 Structure Of Cdtb, The Biologically Active Subunit 8e-04
2f2f_B283 Crystal Structure Of Cytolethal Distending Toxin (C 8e-04
3mtc_A313 Crystal Structure Of Inpp5b In Complex With Phospha 0.002
3n9v_A313 Crystal Structure Of Inpp5b Length = 313 0.003
>gi|99032047|pdb|2DDR|A Chain A, Crystal Structure Of Sphingomyelinase From Bacillus Cereus With Calcium Ion Length = 306 Back     alignment and structure
 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 48/314 (15%), Positives = 102/314 (32%), Gaps = 37/314 (11%)

Query: 16  CTASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMG 75
            + +    +++++ N+  LS      L+ N  +   +D      Y K  + D+V L E+ 
Sbjct: 2   VSTTQNDTLKVMTHNVYMLSTN----LYPNWGQTERADLIGAADYIK--NQDVVILNEVF 55

Query: 76  SYNAVAKVFPKNTWCIFYST---------ERLINHSKRDSNNDIHTAIAVRKKNVRVLQQ 126
             +A  ++           T         E         S+      +A+  K     + 
Sbjct: 56  DNSASDRLLGNLKKEYPNQTAVLGRSSGSEWDKTLGNYSSSTPEDGGVAIVSKWPIAEKI 115

Query: 127 SYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQ 186
            Y +           N+  V   ++ N + + V+  HL++    DS+    SP+ S+ + 
Sbjct: 116 QY-VFAKGCGPDNLSNKGFVYTKIKKNDRFVHVIGTHLQA---EDSMCGKTSPA-SVRTN 170

Query: 187 QAQWLKDWI-TQKKESLVPFVIAGDFNRKI-----NYLGNNDDFWKTIDPNDSLIRFPKE 240
           Q + ++D+I  +   +    +I GD N        N        +KT++ +         
Sbjct: 171 QLKEIQDFIKNKNIPNNEYVLIGGDMNVNKINAENNNDSEYASMFKTLNASVPSYTGHTA 230

Query: 241 KDSRC-----NANKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKR---- 291
                       N        +DY +  ++       E+      +     +   +    
Sbjct: 231 TWDATTNSIAKYNFPDSPAEYLDYIIASKDHANPSYIENKVLQPKSPQWTVTSWFQKYTY 290

Query: 292 --LSDHCPISIDYD 303
              SDH P+     
Sbjct: 291 NDYSDHYPVEATIS 304


>gi|189096065|pdb|2UYR|X Chain X, Crystal Structure Of Bacillus Cereus Sphingomyelinase Mutant :n57a Length = 306 Back     alignment and structure
>gi|296863686|pdb|3MPR|A Chain A, Crystal Structure Of EndonucleaseEXONUCLEASEPHOSPHATASE FA Protein From Bacteroides Thetaiotaomicron, Northeast Struct Genomics Consortium Target Btr318a Length = 298 Back     alignment and structure
gi|134104765|pdb|2JC4|A Chain A, 3'-5' Exonuclease (Nexo) From Neisseria Meningitidis Length = 256 Back     alignment and structure
>gi|320089760|pdb|3K55|A Chain A, Structure Of Beta Hairpin Deletion Mutant Of Beta Toxin From Staphylococcus Aureus Length = 306 Back     alignment and structure
>gi|302566051|pdb|3I5V|A Chain A, Crystal Structure Of Beta Toxin 275-280 From Staphylococcus Aureus Length = 313 Back     alignment and structure
>gi|300508421|pdb|3I41|A Chain A, Crystal Structure Of Beta Toxin From Staphylococcus Aureus F277a, P278a Mutant Length = 317 Back     alignment and structure
gi|157829928|pdb|1AKO|A Chain A, Exonuclease Iii From Escherichia Coli Length = 268 Back     alignment and structure
>gi|75765927|pdb|1ZWX|A Chain A, Crystal Structure Of Smcl Length = 301 Back     alignment and structure
>gi|229691|pdb|1ATN|D Chain D, Atomic Structure Of The Actin:dnase I Complex Length = 260 Back     alignment and structure
>gi|493974|pdb|1DNK|A Chain A, The X-Ray Structure Of The Dnase I-D(Ggtatacc)2 Complex At 2.3 Angstroms Resolution Length = 260 Back     alignment and structure
>gi|223674122|pdb|3G6S|A Chain A, Crystal Structure Of The EndonucleaseEXONUCLEASEPHOSPHATASE (BVU_0621) FROM Bacteroides Vulgatus. Northeast Structural Genomics Consortium Target Bvr56d Length = 267 Back     alignment and structure
>gi|162329924|pdb|2O3H|A Chain A, Crystal Structure Of The Human C65a Ape Length = 285 Back     alignment and structure
>gi|118138505|pdb|2ISI|A Chain A, Crystal Structure Of Ape1 From Homo Sapiens In A New Crystal Form Complexed With A Ligand Length = 317 Back     alignment and structure
>gi|157830335|pdb|1BIX|A Chain A, The Crystal Structure Of The Human Dna Repair Endonuclease Hap1 Suggests The Recognition Of Extra-Helical Deoxyribose At Dna Abasic Sites Length = 287 Back     alignment and structure
gi|13399540|pdb|1E9N|A Chain A, A Second Divalent Metal Ion In The Active Site Of A New Crystal Form Of Human ApurinicAPYRIMIDINIC ENDONUCLEASE, Ape1, And Its Implications For The Catalytic Mechanism Length = 318 Back     alignment and structure
gi|157883966|pdb|2JC5|A Chain A, Apurinic Apyrimidinic (Ap) Endonuclease (Nape) From Neisseria Meningitidis Length = 259 Back     alignment and structure
>gi|6980832|pdb|1DEW|A Chain A, Crystal Structure Of Human Ape1 Bound To Abasic Dna Length = 279 Back     alignment and structure
>gi|6980804|pdb|1DE8|B Chain B, Human ApurinicAPYRIMIDINIC ENDONUCLEASE-1 (Ape1) Bound To Abasic Dna Length = 276 Back     alignment and structure
>gi|283807250|pdb|3L1W|A Chain A, The Crystal Structure Of A Functionally Unknown Conserved Protein From Enterococcus Faecalis V583 Length = 257 Back     alignment and structure
>gi|162329921|pdb|2O3C|A Chain A, Crystal Structure Of Zebrafish Ape Length = 282 Back     alignment and structure
>gi|290789945|pdb|3FZI|A Chain A, 1.9 Angstrom Structure Of The Thermophilic Exonuclease Iii Homologue Mth0212 Length = 265 Back     alignment and structure
>gi|290789984|pdb|3G91|A Chain A, 1.2 Angstrom Structure Of The Exonuclease Iii Homologue Mth0212 Length = 265 Back     alignment and structure
>gi|217035255|pdb|2VOA|A Chain A, Structure Of An Ap Endonuclease From Archaeoglobus Fulgidus Length = 257 Back     alignment and structure
>gi|290789946|pdb|3G00|A Chain A, Mth0212 In Complex With A 9bp Blunt End Dsdna At 1.7 Angstrom Length = 265 Back     alignment and structure
>gi|301598721|pdb|3NGN|A Chain A, Crystal Structure Of The Human Cnot6l Nuclease Domain In Complex With Amp Length = 398 Back     alignment and structure
>gi|301598724|pdb|3NGQ|A Chain A, Crystal Structure Of The Human Cnot6l Nuclease Domain Length = 398 Back     alignment and structure
>gi|14277798|pdb|1I9Y|A Chain A, Crystal Structure Of Inositol Polyphosphate 5-Phosphatase Domain (Ipp5c) Of Spsynaptojanin Length = 347 Back     alignment and structure
>gi|158428909|pdb|2J63|A Chain A, Crystal Structure Of Ap Endonuclease Lmap From Leishmania Major Length = 467 Back     alignment and structure
>gi|152149539|pdb|2V0S|A Chain A, Crystal Structure Of A Hairpin Exchange Variant (Lr1) Of The Targeting Line-1 Retrotransposon Endonuclease Length = 236 Back     alignment and structure
>gi|49259594|pdb|1VYB|A Chain A, Endonuclease Domain Of Human Line1 Orf2p Length = 238 Back     alignment and structure
>gi|152149537|pdb|2V0R|A Chain A, Crystal Structure Of A Hairpin Exchange Variant (Ltx) Of The Targeting Line-1 Retrotransposon Endonuclease Length = 240 Back     alignment and structure
>gi|110591317|pdb|2F1N|A Chain A, Structure Of Cdtb, The Biologically Active Subunit Of Cytolethal Distending Toxin Length = 262 Back     alignment and structure
>gi|93279405|pdb|2F2F|B Chain B, Crystal Structure Of Cytolethal Distending Toxin (Cdt) From Actinobacillus Actinomycetemcomitans Length = 283 Back     alignment and structure
>gi|299856846|pdb|3MTC|A Chain A, Crystal Structure Of Inpp5b In Complex With Phosphatidylinositol 4- Phosphate Length = 313 Back     alignment and structure
>gi|301598678|pdb|3N9V|A Chain A, Crystal Structure Of Inpp5b Length = 313 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target304 hypothetical protein CLIBASIA_04520 [Candidatus Liberib
3i41_A317 Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1. 1e-15
2f1n_A262 CDT B, cytolethal distending toxin subunit B; E.coli, D 1e-11
3g6s_A267 Putative endonuclease/exonuclease/phosphatase family pr 2e-11
1zwx_A301 SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpi 7e-10
3mtc_A313 Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP 1e-09
1sr4_B261 CDT B, cytolethal distending toxin protein B; bacterial 6e-09
2ddr_A306 Sphingomyelin phosphodiesterase; DNAse I like folding, 1e-08
3mpr_A298 Putative endonuclease/exonuclease/phosphatase FAM prote 4e-08
1wdu_A245 TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA bind 8e-08
2a40_B260 Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse I, A 1e-07
2jc4_A256 Exodeoxyribonuclease III; hydrolase, repair phosphodies 3e-07
3l1w_A257 Uncharacterized protein; APC29019.2, conserved protein, 5e-06
2jc5_A259 Exodeoxyribonuclease; hydrolase, repair phosphodiestera 9e-06
2voa_A257 AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP endo 1e-05
3ngq_A398 CCR4-NOT transcription complex subunit 6-like; alpha/be 3e-05
2j63_A467 AP-endonuclease; base excision repair, lyase; 2.48A {Le 1e-04
2o3h_A285 DNA-(apurinic or apyrimidinic site) lyase; APE, endonuc 1e-04
3nr8_B316 Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; stru 2e-04
1ako_A268 Exonuclease III; AP-endonuclease, DNA repair; 1.70A {Es 3e-04
3g91_A265 MTH0212, exodeoxyribonuclease; double-strand specific 3 7e-04
2ei9_A240 Non-LTR retrotransposon R1BMKS ORF2 protein; four layer 0.002
1vyb_A238 ORF2 contains A reverse transcriptase domain; endonucle 0.004
>3i41_A Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1.75A {Staphylococcus aureus RN4220} PDB: 3i46_A 3i48_A Length = 317 Back     alignment and structure
 Score = 78.9 bits (193), Expect = 1e-15
 Identities = 58/313 (18%), Positives = 91/313 (29%), Gaps = 39/313 (12%)

Query: 13  LVPCTASVAQK-----VRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDAD 67
           LVP  + +  K     ++LVS N+  LS     +  +           L+ Q +   + D
Sbjct: 14  LVPRGSHMESKKDDTDLKLVSHNVYMLSTVLYPNWGQYKRAD------LIGQSSYIKNND 67

Query: 68  IVFLQEMGSYNAVAKVFPKNTWCIFYSTERLINHSKRDSN----------NDIHTAIAVR 117
           +V   E     A  K+         Y T  L                    D   AI  +
Sbjct: 68  VVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSK 127

Query: 118 KKNVRVLQQSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTY 177
                 +Q  +      D+ S   N+  V   +E NGK + V+  H +S        +  
Sbjct: 128 YPIKEKIQHVFKSGCGFDNDS---NKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDR 184

Query: 178 SPSCSLLSQQAQWLKDWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRF 237
                   Q  +       +         I GD N          D  K ++ ND L   
Sbjct: 185 KIRA---EQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPE-FKDMLKNLNVNDVLYAG 240

Query: 238 PKEKDSRCN---ANKNLRNKIP--IDYFVMDQNAYK------FLIQESFSEILYNEDDIK 286
                   +   A  N  N  P  +DY   D++  +       ++ E             
Sbjct: 241 HNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAAAYY 300

Query: 287 SRGKRLSDHCPIS 299
                 SDH PI 
Sbjct: 301 YVYNDFSDHYPIK 313


>2f1n_A CDT B, cytolethal distending toxin subunit B; E.coli, DNAse I, microbatch; 1.73A {Escherichia coli} SCOP: d.151.1.1 Length = 262 Back     alignment and structure
>3g6s_A Putative endonuclease/exonuclease/phosphatase family protein; alpha-beta protein, structural genomics, PSI-2; 2.50A {Bacteroides vulgatus atcc 8482} Length = 267 Back     alignment and structure
>1zwx_A SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpin, hydrolase; 1.90A {Listeria ivanovii} SCOP: d.151.1.3 Length = 301 Back     alignment and structure
>3mtc_A Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP5BA,phosphoinositide 5-phosphatase, inositol signalling, phosphatase, magnesium; HET: PIF; 2.40A {Homo sapiens} Length = 313 Back     alignment and structure
>1sr4_B CDT B, cytolethal distending toxin protein B; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: d.151.1.1 PDB: 2f2f_B Length = 261 Back     alignment and structure
>2ddr_A Sphingomyelin phosphodiesterase; DNAse I like folding, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.40A {Bacillus cereus} SCOP: d.151.1.3 PDB: 2dds_A 2ddt_A* 2uyr_X Length = 306 Back     alignment and structure
>3mpr_A Putative endonuclease/exonuclease/phosphatase FAM protein; structural genomics, PSI-2, protein structure initiative; HET: MSE PEG; 1.90A {Bacteroides thetaiotaomicron} Length = 298 Back     alignment and structure
>1wdu_A TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA binding protein; 2.40A {Bombyx mori} SCOP: d.151.1.1 Length = 245 Back     alignment and structure
>2a40_B Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse I, ARP2/3, structural protein; HET: HIC NAG ATP; 1.80A {Bos taurus} SCOP: d.151.1.1 PDB: 1dnk_A* 2a3z_B* 2a41_B* 2a42_B* 2d1k_B* 2dnj_A* 3cjc_D* 3dni_A* 1atn_D* Length = 260 Back     alignment and structure
>2jc4_A Exodeoxyribonuclease III; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: 1PE; 1.90A {Neisseria meningitidis} Length = 256 Back     alignment and structure
>3l1w_A Uncharacterized protein; APC29019.2, conserved protein, enterococcus faecalis V583, PSI-2, MCSG, structural genomics; 1.60A {Enterococcus faecalis} Length = 257 Back     alignment and structure
>2jc5_A Exodeoxyribonuclease; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: BCN DIO GOL; 1.50A {Neisseria meningitidis} Length = 259 Back     alignment and structure
>2voa_A AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP endonuclease, lyase; 1.7A {Archaeoglobus fulgidus} Length = 257 Back     alignment and structure
>3ngq_A CCR4-NOT transcription complex subunit 6-like; alpha/beta sandwich fold, hydrolase; HET: 1PS; 1.80A {Homo sapiens} PDB: 3ngo_A 3ngn_A Length = 398 Back     alignment and structure
>2j63_A AP-endonuclease; base excision repair, lyase; 2.48A {Leishmania major} Length = 467 Back     alignment and structure
>2o3h_A DNA-(apurinic or apyrimidinic site) lyase; APE, endonuclease; 1.90A {Homo sapiens} PDB: 1bix_A 1dew_A* 1de8_B* 1de9_A* 2o3c_A Length = 285 Back     alignment and structure
>3nr8_B Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; structural genomics consortium, SGC, trisphosphate 5-phosphatase 2, SHIP2, INPPL1, SHIP-2; 2.80A {Homo sapiens} Length = 316 Back     alignment and structure
>1ako_A Exonuclease III; AP-endonuclease, DNA repair; 1.70A {Escherichia coli} SCOP: d.151.1.1 Length = 268 Back     alignment and structure
>3g91_A MTH0212, exodeoxyribonuclease; double-strand specific 3'-5' exonuclease, AP endonuclease; HET: PG4; 1.23A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fzi_A 3g0a_A 3g1k_A 3g2c_A 3g3c_A* 3g3y_A* 3g4t_A* 3g00_A 3g0r_A* 3g2d_A* 3g38_A 3g8v_A* 3ga6_A Length = 265 Back     alignment and structure
>2ei9_A Non-LTR retrotransposon R1BMKS ORF2 protein; four layered alpha beta sandwich, gene regulation; 2.00A {Bombyx mori} Length = 240 Back     alignment and structure
>1vyb_A ORF2 contains A reverse transcriptase domain; endonuclease, APE-1 type, retrotransposition, retrotransposon, transferase; 1.8A {Homo sapiens} SCOP: d.151.1.1 PDB: 2v0s_A 2v0r_A Length = 238 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target304 hypothetical protein CLIBASIA_04520 [Candidatus Liberib
3i41_A317 Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1. 100.0
1zwx_A301 SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpi 100.0
2ddr_A306 Sphingomyelin phosphodiesterase; DNAse I like folding, 100.0
3ngq_A398 CCR4-NOT transcription complex subunit 6-like; alpha/be 100.0
3mpr_A298 Putative endonuclease/exonuclease/phosphatase FAM prote 100.0
3l1w_A257 Uncharacterized protein; APC29019.2, conserved protein, 99.97
2j63_A467 AP-endonuclease; base excision repair, lyase; 2.48A {Le 99.97
2a40_B260 Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse I, A 99.97
3g6s_A267 Putative endonuclease/exonuclease/phosphatase family pr 99.96
1wdu_A245 TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA bind 99.95
1vyb_A238 ORF2 contains A reverse transcriptase domain; endonucle 99.95
2jc4_A256 Exodeoxyribonuclease III; hydrolase, repair phosphodies 99.94
1ako_A268 Exonuclease III; AP-endonuclease, DNA repair; 1.70A {Es 99.94
2f1n_A262 CDT B, cytolethal distending toxin subunit B; E.coli, D 99.94
1sr4_B261 CDT B, cytolethal distending toxin protein B; bacterial 99.93
2o3h_A285 DNA-(apurinic or apyrimidinic site) lyase; APE, endonuc 99.92
2voa_A257 AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP endo 99.91
3g91_A265 MTH0212, exodeoxyribonuclease; double-strand specific 3 99.89
2imq_X282 Salivary nitrophorin; ferrous heme, beta-sandwich, tran 99.88
2ei9_A240 Non-LTR retrotransposon R1BMKS ORF2 protein; four layer 99.84
2xsw_A357 72 kDa inositol polyphosphate 5-phosphatase; inositol s 99.83
1hd7_A318 DNA-(apurinic or apyrimidinic site) lyase; DNA repair, 99.93
2jc5_A259 Exodeoxyribonuclease; hydrolase, repair phosphodiestera 99.84
3mtc_A313 Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP 99.89
1i9z_A347 Synaptojanin, phosphatidylinositol phosphate phosphatas 99.87
3nr8_B316 Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; stru 99.83
>3i41_A Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1.75A {Staphylococcus aureus RN4220} PDB: 3i46_A 3i48_A Back     alignment and structure
Probab=100.00  E-value=1.2e-34  Score=206.15  Aligned_cols=272  Identities=17%  Similarity=0.081  Sum_probs=144.2

Q ss_pred             CCCCCEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCC--CEEEEE--
Q ss_conf             6788269999830147886676667765310188999999999860898899995078579998603334--307862--
Q gi|254781003|r   19 SVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAKVFPKNT--WCIFYS--   94 (304)
Q Consensus        19 ~~~~~lrV~twNi~~~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~DIi~lQEv~~~~~~~~~~~~~~--~~~~~~--   94 (304)
                      .....||||||||+.++...      ........+.+.|++.|...+|||||||||.+......+.....  |.....  
T Consensus        25 ~~~~~lrv~syNi~~~~~~~------~~~~~~~~R~~~i~~~i~~~~~DII~LQEV~~~~~~~~l~~~l~~~~~~~~~~~   98 (317)
T 3i41_A           25 KDDTDLKLVSHNVYMLSTVL------YPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVL   98 (317)
T ss_dssp             ---CCCCEEEEEEEECCTTT------STTSCHHHHHHHHHHCSTTSSCSEEEEEEECSHHHHHHHHHHTTTTCCEECCCT
T ss_pred             CCCCCEEEEEEECCCCCCCC------CCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             88996899985288876666------787068899999999997669998999867673549999998886589467760


Q ss_pred             CCCCCCCC----CCCCCCCCEEEEEEECCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEECCEEEEEEEECCCCCCCC
Q ss_conf             14556754----32234463158998258526765301224676555555653369999982994999999406788877
Q gi|254781003|r   95 TERLINHS----KRDSNNDIHTAIAVRKKNVRVLQQSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFL  170 (304)
Q Consensus        95 ~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~v~n~Hl~~~~~~  170 (304)
                      ........    ..........|+++.++.+........... .........|.+..+.+..++..++++|+||.++...
T Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~g~~ilSr~pi~~~~~~~~~~-~~~~~~~~~r~~~~~~~~~~~~~~~v~ntHl~~~~~~  177 (317)
T 3i41_A           99 GRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKS-GCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSR  177 (317)
T ss_dssp             TSCSTTCSEEEESCCSSCSBCCCCEEEESSCEEEEEEEECSC-CCSSGGGBCCEEEEEEEEETTEEEEEEEEECCCCCSS
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCEEEEEEECCC-CCCCCCCCCCCEEEEEEECCCEEEEEEEECCCCCCCC
T ss_conf             466543333224445554247737999858830058897367-8884101474469999962997999997435556775


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCCCEEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCC-C---
Q ss_conf             52000025778999999999999986303-689809998026888776620468987522557531114456787-6---
Q gi|254781003|r  171 DSLENTYSPSCSLLSQQAQWLKDWITQKK-ESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKDSR-C---  245 (304)
Q Consensus       171 ~~~~~~~~~~~~~~~~q~~~l~~~~~~~~-~~~~~vIi~GDfN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~---  245 (304)
                      ...    ......+..|++.+..++.... ..+.++|+|||||..+.......... .................. .   
T Consensus       178 ~~~----~~~~~~R~~q~~~i~~~~~~~~~~~~~~vil~GDfN~~~~~~~~~~~~~-~~~~~d~~~~~~~~~~~~~~~~~  252 (317)
T 3i41_A          178 CGA----GHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLK-NLNVNDVLYAGHNSTWDPQSNSI  252 (317)
T ss_dssp             SCT----THHHHHHHHHHHHHHHHHHHHTCCTTSCEEEEEECCCCTTSHHHHHHHH-HHTBCCCEEEECSCSBCTTTCHH
T ss_pred             CHH----HHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHH-HCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             205----6789999999999998665540146675798444788988779999998-66986530014776545765765


Q ss_pred             -CCCCCCCCCCCEEEEEECCCHHHCCCCCCEEEEE------ECCCCCCCCCCCCCCCCCEEEEE
Q ss_conf             -5646688820147999862043100247217864------11345544455557634389998
Q gi|254781003|r  246 -NANKNLRNKIPIDYFVMDQNAYKFLIQESFSEIL------YNEDDIKSRGKRLSDHCPISIDY  302 (304)
Q Consensus       246 -~~~~~~~~~~~iD~I~~s~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~SDH~PV~~~l  302 (304)
                       ........+.||||||++++..............      ............+|||+||++-+
T Consensus       253 ~~~~~~~~~~~riDyI~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SDH~PV~A~~  316 (317)
T 3i41_A          253 AKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAAAYYYVYNDFSDHYPIKAYS  316 (317)
T ss_dssp             HHHHCTTCCCBCCEEEEEBTTSCCCSSEEEEECCCCCSCEEEEETTEEEEECCSSSBCCEEEEE
T ss_pred             CCCCCCCCCCCEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEE
T ss_conf             5656578987148899975740264311004886236631012444567789967610648993



>1zwx_A SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpin, hydrolase; 1.90A {Listeria ivanovii} SCOP: d.151.1.3 Back     alignment and structure
>2ddr_A Sphingomyelin phosphodiesterase; DNAse I like folding, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.40A {Bacillus cereus} SCOP: d.151.1.3 PDB: 2dds_A 2ddt_A* 2uyr_X Back     alignment and structure
>3ngq_A CCR4-NOT transcription complex subunit 6-like; alpha/beta sandwich fold, hydrolase; HET: 1PS; 1.80A {Homo sapiens} PDB: 3ngo_A 3ngn_A Back     alignment and structure
>3mpr_A Putative endonuclease/exonuclease/phosphatase FAM protein; structural genomics, PSI-2, protein structure initiative; HET: MSE PEG; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3l1w_A Uncharacterized protein; APC29019.2, conserved protein, enterococcus faecalis V583, PSI-2, MCSG, structural genomics; 1.60A {Enterococcus faecalis} Back     alignment and structure
>2j63_A AP-endonuclease; base excision repair, lyase; 2.48A {Leishmania major} Back     alignment and structure
>2a40_B Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse I, ARP2/3, structural protein; HET: HIC NAG ATP; 1.80A {Bos taurus} SCOP: d.151.1.1 PDB: 1dnk_A* 2a3z_B* 2a41_B* 2a42_B* 2d1k_B* 2dnj_A* 3cjc_D* 3dni_A* 1atn_D* Back     alignment and structure
>3g6s_A Putative endonuclease/exonuclease/phosphatase family protein; alpha-beta protein, structural genomics, PSI-2; 2.50A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1wdu_A TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA binding protein; 2.40A {Bombyx mori} SCOP: d.151.1.1 Back     alignment and structure
>1vyb_A ORF2 contains A reverse transcriptase domain; endonuclease, APE-1 type, retrotransposition, retrotransposon, transferase; 1.8A {Homo sapiens} SCOP: d.151.1.1 PDB: 2v0s_A 2v0r_A Back     alignment and structure
>2jc4_A Exodeoxyribonuclease III; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: 1PE; 1.90A {Neisseria meningitidis} Back     alignment and structure
>1ako_A Exonuclease III; AP-endonuclease, DNA repair; 1.70A {Escherichia coli K12} SCOP: d.151.1.1 Back     alignment and structure
>2f1n_A CDT B, cytolethal distending toxin subunit B; E.coli, DNAse I, microbatch; 1.73A {Escherichia coli} SCOP: d.151.1.1 Back     alignment and structure
>1sr4_B CDT B, cytolethal distending toxin protein B; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: d.151.1.1 PDB: 2f2f_B Back     alignment and structure
>2o3h_A DNA-(apurinic or apyrimidinic site) lyase; APE, endonuclease; 1.90A {Homo sapiens} PDB: 1bix_A 1dew_A* 1de8_B* 1de9_A* 2o3c_A Back     alignment and structure
>2voa_A AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP endonuclease, lyase; 1.7A {Archaeoglobus fulgidus} Back     alignment and structure
>3g91_A MTH0212, exodeoxyribonuclease; double-strand specific 3'-5' exonuclease, AP endonuclease; HET: PG4; 1.23A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fzi_A 3g0a_A 3g1k_A 3g2c_A 3g3c_A* 3g3y_A* 3g4t_A* 3g00_A 3g0r_A* 3g2d_A* 3g38_A 3g8v_A* 3ga6_A Back     alignment and structure
>2imq_X Salivary nitrophorin; ferrous heme, beta-sandwich, transport protein; HET: HEM; 1.30A {Cimex lectularius} SCOP: d.151.1.2 PDB: 1ntf_A* 1y21_A* 1yjh_A* 1si6_X* Back     alignment and structure
>2ei9_A Non-LTR retrotransposon R1BMKS ORF2 protein; four layered alpha beta sandwich, gene regulation; 2.00A {Bombyx mori} Back     alignment and structure
>2xsw_A 72 kDa inositol polyphosphate 5-phosphatase; inositol signalling, SGC stockholm, structural genomics CONS hydrolase; 1.90A {Homo sapiens} Back     alignment and structure
>1hd7_A DNA-(apurinic or apyrimidinic site) lyase; DNA repair, endonuclease, APE1, HAP1, REF-1; 1.95A {Homo sapiens} SCOP: d.151.1.1 PDB: 1e9n_A 2isi_A Back     alignment and structure
>2jc5_A Exodeoxyribonuclease; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: BCN DIO GOL; 1.50A {Neisseria meningitidis} Back     alignment and structure
>3mtc_A Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP5BA,phosphoinositide 5-phosphatase, inositol signalling, phosphatase, magnesium; HET: PIF; 2.40A {Homo sapiens} Back     alignment and structure
>1i9z_A Synaptojanin, phosphatidylinositol phosphate phosphatase; spsynaptojanin, IPP5C, IP3, IP2,, hydrolase; HET: 2IP; 1.80A {Schizosaccharomyces pombe} SCOP: d.151.1.2 PDB: 1i9y_A* Back     alignment and structure
>3nr8_B Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; structural genomics consortium, SGC, trisphosphate 5-phosphatase 2, SHIP2, INPPL1, SHIP-2; 2.80A {Homo sapiens} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 304 hypothetical protein CLIBASIA_04520 [Candidatus Liberib
d2f1na1250 d.151.1.1 (A:1-250) Cytolethal distending toxin subunit 4e-10
d2ddra1299 d.151.1.3 (A:7-305) Sphingomyelin phosphodiesterase C { 6e-10
d1zwxa1293 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C 3e-09
d1hd7a_275 d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Hom 7e-08
d2a40b1260 d.151.1.1 (B:1-260) Deoxyribonuclease I {Cow (Bos tauru 2e-07
d1sr4b_261 d.151.1.1 (B:) Cytolethal distending toxin subunit B {H 3e-07
d1wdua_228 d.151.1.1 (A:) Endonuclease domain of TRAS1 retrotransp 4e-06
d1akoa_268 d.151.1.1 (A:) DNA-repair enzyme exonuclease III {Esche 8e-05
d2imqx1280 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug (Cimex 2e-04
d1i9za_345 d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeas 0.004
>d2f1na1 d.151.1.1 (A:1-250) Cytolethal distending toxin subunit B {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: DNase I-like
superfamily: DNase I-like
family: DNase I-like
domain: Cytolethal distending toxin subunit B
species: Escherichia coli [TaxId: 562]
 Score = 59.3 bits (142), Expect = 4e-10
 Identities = 42/280 (15%), Positives = 82/280 (29%), Gaps = 37/280 (13%)

Query: 23  KVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAK 82
             R+ +WN+             ++   +  +  + +  +     DI+ +QE GS  + A 
Sbjct: 4   DFRVATWNLQ----------GASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAV 53

Query: 83  VFPKNTWCIFYSTERLINHSKRDSNNDIHTAI--AVRKKNVRVLQQSYPLLGAKDSFSRA 140
              +           LI +   +S          AV     RV         A + F  +
Sbjct: 54  DTGRVIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLS 113

Query: 141 GNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDWITQKKE 200
             R+    L+ I          H  +    D+           L ++             
Sbjct: 114 PVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPA---------LVEEVYNFFRDSRDPVH 164

Query: 201 SLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKDSRCNANKNLRNKIPIDYF 260
             + ++I GDFNR+   L  N           +         ++        ++  +DY 
Sbjct: 165 QALNWMILGDFNREPADLEMNLTVPVR----RASEIISPAAATQ-------TSQRTLDYA 213

Query: 261 VMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISI 300
           V   +     +    S +         R +  SDH P+ +
Sbjct: 214 VAGNS-----VAFRPSPLQAGIVYGARRTQISSDHFPVGV 248


>d2ddra1 d.151.1.3 (A:7-305) Sphingomyelin phosphodiesterase C {Bacillus cereus [TaxId: 1396]} Length = 299 Back     information, alignment and structure
>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]} Length = 293 Back     information, alignment and structure
>d1hd7a_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d2a40b1 d.151.1.1 (B:1-260) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} Length = 260 Back     information, alignment and structure
>d1sr4b_ d.151.1.1 (B:) Cytolethal distending toxin subunit B {Haemophilus ducreyi [TaxId: 730]} Length = 261 Back     information, alignment and structure
>d1wdua_ d.151.1.1 (A:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori) [TaxId: 7091]} Length = 228 Back     information, alignment and structure
>d1akoa_ d.151.1.1 (A:) DNA-repair enzyme exonuclease III {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d2imqx1 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]} Length = 280 Back     information, alignment and structure
>d1i9za_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 345 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target304 hypothetical protein CLIBASIA_04520 [Candidatus Liberib
d1zwxa1293 Sphingomyelin phosphodiesterase C {Listeria ivanovii [T 100.0
d2ddra1299 Sphingomyelin phosphodiesterase C {Bacillus cereus [Tax 100.0
d2a40b1260 Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} 99.97
d2f1na1250 Cytolethal distending toxin subunit B {Escherichia coli 99.95
d1vyba_236 Endonuclease domain of LINE-1 reverse transcriptase hom 99.95
d2imqx1280 Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId 99.93
d1wdua_228 Endonuclease domain of TRAS1 retrotransposon (ORF2) {Si 99.93
d1sr4b_261 Cytolethal distending toxin subunit B {Haemophilus ducr 99.93
d1hd7a_275 DNA repair endonuclease Hap1 {Human (Homo sapiens) [Tax 99.91
d1akoa_268 DNA-repair enzyme exonuclease III {Escherichia coli [Ta 99.87
d1i9za_345 Synaptojanin, IPP5C domain {Fission yeast (Schizosaccha 99.86
>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: DNase I-like
superfamily: DNase I-like
family: Sphingomyelin phosphodiesterase-like
domain: Sphingomyelin phosphodiesterase C
species: Listeria ivanovii [TaxId: 1638]
Probab=100.00  E-value=1.2e-34  Score=204.86  Aligned_cols=271  Identities=14%  Similarity=0.028  Sum_probs=148.0

Q ss_pred             CCCEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCC--CEEEEECCCC
Q ss_conf             88269999830147886676667765310188999999999860898899995078579998603334--3078621455
Q gi|254781003|r   21 AQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAKVFPKNT--WCIFYSTERL   98 (304)
Q Consensus        21 ~~~lrV~twNi~~~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~DIi~lQEv~~~~~~~~~~~~~~--~~~~~~~~~~   98 (304)
                      ++.||||||||++++....      +......+.+.|++.|...+|||||||||.+......+.....  |.........
T Consensus         2 ~~~lki~s~Nv~~~~~~~~------~~~~~~~r~~~i~~~i~~~~~DVi~LQEv~~~~~~~~l~~~~~~~~~~~~~~~~~   75 (293)
T d1zwxa1           2 PGNFKITSHNVYLFSRNIY------PNWGQMHRADLIAQADYMKNNDVVILNEAFDTSASHRLLNNLREMYPHQTPVIGR   75 (293)
T ss_dssp             CCSCEEEEEEEEECCTTTS------TTSCHHHHHHHHHTSGGGSSCSEEEEEEECSHHHHHHHHHHTTTTCCEECCCTTS
T ss_pred             CCCCEEEEEECCCCCCCCC------CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEHHCCC
T ss_conf             9977899884685765558------9827899999999999756998899984677425899998776541400000113


Q ss_pred             CCCCCC------CCCCCCEEEEEEECCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEECCEEEEEEEECCCCCCCCCC
Q ss_conf             675432------23446315899825852676530122467655555565336999998299499999940678887752
Q gi|254781003|r   99 INHSKR------DSNNDIHTAIAVRKKNVRVLQQSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDS  172 (304)
Q Consensus        99 ~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~v~n~Hl~~~~~~~~  172 (304)
                      ......      ........|+++.++.+........... .........+..+.+.+..++..++++++|++++.....
T Consensus        76 ~~~~~~~~~~~~~~~~~~~~g~~ilsr~pi~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~v~~~Hl~~~~~~~~  154 (293)
T d1zwxa1          76 SKHGWDKTEGNYSNFALEDGGVAVVSQWPIVEKSQHIFQR-GGGADRLSNKGFAYVKIMKNGKPYHIIGTHTQADDSLIS  154 (293)
T ss_dssp             CSTTCSEEEC-----CCBCCCCEEEESSCEEEEEEEECSC-CCGGGGGBCCEEEEEEEEETTEEEEEEEEECCCCCTTSC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCEEEEEEC-CCCCCCCCCCEEEEEEEECCCCEEEEEEEEEECCCCCCC
T ss_conf             4543221114544320126626999646754421565202-454200134148999996399347999844103677530


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCCCEEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCCCCCCC-----
Q ss_conf             000025778999999999999986303-68980999802688877662046898752255753111-44567876-----
Q gi|254781003|r  173 LENTYSPSCSLLSQQAQWLKDWITQKK-ESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRF-PKEKDSRC-----  245 (304)
Q Consensus       173 ~~~~~~~~~~~~~~q~~~l~~~~~~~~-~~~~~vIi~GDfN~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~-----  245 (304)
                      .    ......+..|++.+.+++.+.. ..+.++|||||||..+........... .......... ........     
T Consensus       155 ~----~~~~~~r~~~~~~~~~~~~~~~~~~~~~vil~GDfN~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~  229 (293)
T d1zwxa1         155 K----DTSRAIRAEQMQEIQTFIAKKNIPKDEIIFIGGDLNVNYGTDEYHDMLKL-LNVSSPANFNGQMATWDPTTNSML  229 (293)
T ss_dssp             H----HHHHHHHHHHHHHHHHHHHHHTCCTTSEEEEEEECCCCTTSHHHHHHHHH-HTBCCCTTCCTTSCSBCTTTCHHH
T ss_pred             H----HHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHHHHHHHH-CCCCCHHHCCCCCCCCCCCCCCCC
T ss_conf             3----57799999989886545554036889848998066989885578888753-365553230467764455324444


Q ss_pred             CCCCCCCCCCCEEEEEECCCHHHCCCCCCEEEEE------ECCCCCCCCCCCCCCCCCEEEEEE
Q ss_conf             5646688820147999862043100247217864------113455444555576343899984
Q gi|254781003|r  246 NANKNLRNKIPIDYFVMDQNAYKFLIQESFSEIL------YNEDDIKSRGKRLSDHCPISIDYD  303 (304)
Q Consensus       246 ~~~~~~~~~~~iD~I~~s~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~SDH~PV~~~l~  303 (304)
                      ........+.||||||++++..............      ............+|||+||+++++
T Consensus       230 ~~~~~~~~~~~iD~I~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SDH~PV~A~~~  293 (293)
T d1zwxa1         230 KESYPKAAPEYLDYIFVENGHARPHSWHNKVLHTKSPQWSVKSWFKTYTYQDFSDHYPVVGFTD  293 (293)
T ss_dssp             HHHCTTSCCBCCEEEEEBTTSCCCSCEEEEECCCCCCCEEEEETTEEEEECCSSSSCCEEEEEC
T ss_pred             CCCCCCCCCCEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEEC
T ss_conf             5455789886078999846303643222047752166301134335688899488178499959



>d2ddra1 d.151.1.3 (A:7-305) Sphingomyelin phosphodiesterase C {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2a40b1 d.151.1.1 (B:1-260) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2f1na1 d.151.1.1 (A:1-250) Cytolethal distending toxin subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vyba_ d.151.1.1 (A:) Endonuclease domain of LINE-1 reverse transcriptase homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2imqx1 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]} Back     information, alignment and structure
>d1wdua_ d.151.1.1 (A:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori) [TaxId: 7091]} Back     information, alignment and structure
>d1sr4b_ d.151.1.1 (B:) Cytolethal distending toxin subunit B {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1hd7a_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akoa_ d.151.1.1 (A:) DNA-repair enzyme exonuclease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i9za_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 304 hypothetical protein CLIBASIA_04520 [Candidatus Li
2ddr_A_306 (A:) Sphingomyelin phosphodiesterase; DNAse I like 3e-09
1zwx_A_301 (A:) SMCL, sphingomyelinase-C; dnase1-like fold, b 4e-09
3g6s_A_267 (A:) Putative endonuclease/exonuclease/phosphatase 2e-06
1i9z_A_18-321304 (A:18-321) Synaptojanin, phosphatidylinositol phos 1e-05
3l1w_A_257 (A:) Uncharacterized protein; APC29019.2, conserve 2e-05
2o3h_A_285 (A:) DNA-(apurinic or apyrimidinic site) lyase; AP 6e-05
1hd7_A_318 (A:) DNA-(apurinic or apyrimidinic site) lyase; DN 1e-04
1ako_A_268 (A:) Exonuclease III; AP-endonuclease, DNA repair; 0.002
2jc5_A_259 (A:) Exodeoxyribonuclease; hydrolase, repair phosp 0.003
>2ddr_A (A:) Sphingomyelin phosphodiesterase; DNAse I like folding, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.40A {Bacillus cereus}Length = 306 Back     alignment and structure
 Score = 57.0 bits (135), Expect = 3e-09
 Identities = 40/312 (12%), Positives = 93/312 (29%), Gaps = 33/312 (10%)

Query: 17  TASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGS 76
           + +    +++++ N+        +S         T    L+       + D+V L E+  
Sbjct: 3   STTQNDTLKVMTHNVY------MLSTNLYPNWGQTERADLIGAADYIKNQDVVILNEVFD 56

Query: 77  YNAVAKVFPKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKNVRVLQQS--------Y 128
            +A  ++           T  L   S  + +  +    +   ++  V   S         
Sbjct: 57  NSASDRLLGNLKKEYPNQTAVLGRSSGSEWDKTLGNYSSSTPEDGGVAIVSKWPIAEKIQ 116

Query: 129 PLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQA 188
            +           N+  V   ++ N + + V+  HL++    DS+    SP+    +Q  
Sbjct: 117 YVFAKGCGPDNLSNKGFVYTKIKKNDRFVHVIGTHLQAE---DSMCGKTSPASVRTNQLK 173

Query: 189 QWLKDWITQKKESLVPFVIAGDFN--------RKINYLGNNDDFWKTIDPNDSLIRFPKE 240
           +       +   +    +I GD N           +   +         P+ +      +
Sbjct: 174 EIQDFIKNKNIPNNEYVLIGGDMNVNKINAENNNDSEYASMFKTLNASVPSYTGHTATWD 233

Query: 241 KDSRCNANKNLRNKIP--IDYFVMDQNAYK------FLIQESFSEILYNEDDIKSRGKRL 292
             +   A  N  +     +DY +  ++          ++Q    +        K      
Sbjct: 234 ATTNSIAKYNFPDSPAEYLDYIIASKDHANPSYIENKVLQPKSPQWTVTSWFQKYTYNDY 293

Query: 293 SDHCPISIDYDF 304
           SDH P+      
Sbjct: 294 SDHYPVEATISM 305


>1zwx_A (A:) SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpin, hydrolase; 1.90A {Listeria ivanovii}Length = 301 Back     alignment and structure
>3g6s_A (A:) Putative endonuclease/exonuclease/phosphatase family protein; alpha-beta protein, structural genomics, PSI-2; 2.50A {Bacteroides vulgatus atcc 8482}Length = 267 Back     alignment and structure