254781004

254781004

threonyl-tRNA synthetase

GeneID in NCBI database:8210026Locus tag:CLIBASIA_04525
Protein GI in NCBI database:254781004Protein Accession:YP_003065417.1
Gene range:-(1000849, 1002807)Protein Length:652aa
Gene description:threonyl-tRNA synthetase
COG prediction:[J] Threonyl-tRNA synthetase
KEGG prediction:thrS; threonyl-tRNA synthetase (EC:6.1.1.3); K01868 threonyl-tRNA synthetase [EC:6.1.1.3]
SEED prediction:Threonyl-tRNA synthetase (EC 6.1.1.3)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Thr
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650--
MPSDIKLTFPDGSIKNFPVHATGSDVAESISRSLAKKAVAVAINGKVCDLSDPVREGSIEIITPEDPRSLAVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWFDLCRGPHVRSTGQVKKFFKLMKVAGAYWRGDSNRPMLSRIYGTAWNTQQELTQYLYFLEESEKRDHRKLAREMDLFHIAEDGSGVIFWHRKGWKIFQTLISYMRRKIKDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLSTRPEKRVGSDALWDDAENIMKGVLDTIKNSSQDRINTGVLLGEGAFYGPKFEYILKDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENFKGNLPLWLSPIQAIVTTITSSAVEYAQEIANLLKSHHLSIETDFRNETINYKIREHSIKKIPIIIICGDKEASERSIGIRRFGSTTTQKVSLLDAIPILTKESLPPDCQK
ccccEEEEcccccEEEEcccccHHHHHHHHcHHHHccEEEEEEccEEEEcccEEccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHcccccEEEEEEEcccccEEEEEEEccEEEEccccccccHHccccEEEEEcccEEEccccccccccccHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHcccEEEHHccccEEEEcccHHHHHHHHHHHHHHHHHcccEEEcccEEEcHHHHHHcccccccccccEEEEcccccccccccEEEEcccHHHHHHHHHHHcccHHHccEEEEEEEEEEEccccccccccEEEEEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEcccccccEEEcccccccHHHHHcccEEEccccccccEEEEEcccccHHHHHHHHHHHHHccccccccccEEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccccEEEEEcHHHHcccEEEEEEcccccEEEEcHHHHHHHHHHccccHHccc
cccccEEEcccccEEEccccccHHHHHHHccHHHHHHHHHcccccEEEccHcHcHcccEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccEccccEEcccccccccHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHcccccEEEEHHccccccccccEccccHEEccccccccccHHHHHHHHHHHHHccEEccccccHHHHEEEcccHccHHHHHHHHHHHHHHHHccHHHHHHHcccEEcccccccccEEcHHHHHHHHHHHHHHHHHHHHcccEcccccEHcHHHHHHcccHHHHHHHcccEEccccEEEccEEEEEccccHHHHHHHHcccccEHHHccEEEEEEEEEEccccHHHcEcccEccEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHHHHHHccccEEEEccccEcccccEccEcEEEEEEEcccccEEEEEEEEEEccHHHHccccEEcccccEEccEEEEEEEEEEHHHHHHHHHHHHccccccccccccEEEEEccHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEEEEcHHHHHHcEEEEEEccccccccccHHHHHHHHHHHHccccccc
mpsdikltfpdgsiknfpvhatgsDVAESISRSLAKKAVAVAINgkvcdlsdpvregsieiitpedprsLAVIRHSCAHIMAEAVQSIWPEVQVAigpiiedgfyydfdkeqpfssdELAQIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILesipakenvtlyrqgewfdlcrgphvrstgQVKKFFKLMKVAGAywrgdsnrpmlsRIYGTAWNTQQELTQYLYFLEESEKRDHRKLAREMDLFHiaedgsgvifwHRKGWKIFQTLISYMRRKIKddyeeintpqvldqhlwqqsghwdsyranmfavkCADDTIKDLRTFalkpmncpghvavfnhglksyreLPVRLAEfgsvyrnepsgslhglmrvrgftqddahvfCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLstrpekrvgsdalWDDAENIMKGVLDTIknssqdrintgvllgegafygpkFEYILKDAigrdwqcgtiqvdfnlpsrfnafyvnshsekchpVMIHRAVFGSIERFIGIMIENfkgnlplwlsPIQAIVTTITSSAVEYAQEIANLLKSHHLSIETDFRNETINYKIREHSIKKIPIIIicgdkeasersigirrfgstttqkvslldaipiltkeslppdcqk
mpsdikltfpdgsiknfpvhATGSDVAESISRSLAKKAVAVAIngkvcdlsdpvregsieiitpedprsLAVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEIlesipakenvTLYRQGEWFDLCRGPHVRSTGQVKKFFKLMKVAGaywrgdsnrpMLSRIYGTAWNTQQELTQYLYFLEESEKRDHRKLAREMDLFHIAedgsgvifwhrKGWKIFQTLISYMRRKIKDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKlstrpekrvgsdalwddAENIMKGVLDtiknssqdrINTGVLLGEGAFYGPKFEYILKDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENFKGNLPLWLSPIQAIVTTITSSAVEYAQEIANLLKSHHLSIETDFRNETINYKirehsikkipiIIICGDKEASERSIGIrrfgstttqkvslldaipiltkeslppdcqk
MPSDIKLTFPDGSIKNFPVHATGSDVAESISRSLAKKAVAVAINGKVCDLSDPVREGSIEIITPEDPRSLAVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWFDLCRGPHVRSTGQVKKFFKLMKVAGAYWRGDSNRPMLSRIYGTAWNTQQELTQYLYFLEESEKRDHRKLAREMDLFHIAEDGSGVIFWHRKGWKIFQTLISYMRRKIKDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLSTRPEKRVGSDALWDDAENIMKGVLDTIKNSSQDRINTGVLLGEGAFYGPKFEYILKDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENFKGNLPLWLSPIQAIVTTITSSAVEYAQEIANLLKSHHLSIETDFRNETINYKIREHSikkipiiiiCGDKEASERSIGIRRFGSTTTQKVSLLDAIPILTKESLPPDCQK
***DIKLTFPDGSIKNFPVHATGSDVAESISRSLAKKAVAVAINGKVCDLSDPVREGSIEIITPEDPRSLAVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWFDLCRGPHVRSTGQVKKFFKLMKVAGAYWRGDSNRPMLSRIYGTAWNTQQELTQYLYFLEESEKRDHRKLAREMDLFHIAEDGSGVIFWHRKGWKIFQTLISYMRRKIKDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLSTRPEKRVGSDALWDDAENIMKGVLDTIKNSSQDRINTGVLLGEGAFYGPKFEYILKDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENFKGNLPLWLSPIQAIVTTITSSAVEYAQEIANLLKSHHLSIETDFRNETINYKIREHSIKKIPIIIICGDKEASERSIGI*********KVSLLDAIPILTKESLPP****
MPSDIKLTFPDGSIKNFPVHATGSDVAESISRSLAKKAVAVAINGKVCDLSDPVREGSIEIITPEDPRSLAVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWFDLCRGPHVRSTGQVKKFFKLMKVAGAYWRGDSNRPMLSRIYGTAWNTQQELTQYLYFLEESEKRDHRKLAREMDLFHIAEDGSGVIFWHRKGWKIFQTLISYMRRKIKDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLSTRPEKRVGSDALWDDAENIMKGVLDTIKNSSQDRINTGVLLGEGAFYGPKFEYILKDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENFKGNLPLWLSPIQAIVTTITSSAVEYAQEIANLLKSHHLSIETDFRNETINYKIREHSIKKIPIIIICGDKEASERSIGIRRFGSTTTQKVSLLDAIPILTKESLPPDCQK
***DIKLTFPDGSIKNFPVHATGSDVAESISRSLAKKAVAVAINGKVCDLSDPVREGSIEIITPEDPRSLAVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWFDLCRGPHVRSTGQVKKFFKLMKVAGAYWRGDSNRPMLSRIYGTAWNTQQELTQYLYFLEESEKRDHRKLAREMDLFHIAEDGSGVIFWHRKGWKIFQTLISYMRRKIKDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLSTRPEKRVGSDALWDDAENIMKGVLDTIKNSSQDRINTGVLLGEGAFYGPKFEYILKDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENFKGNLPLWLSPIQAIVTTITSSAVEYAQEIANLLKSHHLSIETDFRNETINYKIREHSIKKIPIIIICGDKEASERSIGIRRFGSTTTQKVSLLDAIPILTKESL******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSDIKLTFPDGSIKNFPVHATGSDVAESISRSLAKKAVAVAINGKVCDLSDPVREGSIEIITPEDPRSLAVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWFDLCRGPHVRSTGQVKKFFKLMKVAGAYWRGDSNRPMLSRIYGTAWNTQQELTQYLYFLEESEKRDHRKLAREMDLFHIAEDGSGVIFWHRKGWKIFQTLISYMRRKIKDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLSTRPEKRVGSDALWDDAENIMKGVLDTIKNSSQDRINTGVLLGEGAFYGPKFEYILKDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENFKGNLPLWLSPIQAIVTTITSSAVEYAQEIANLLKSHHLSIETDFRNETINYKIREHSIKKIPIIIICGDKEASERSIGIRRFGSTTTQKVSLLDAIPILTKESLPPDCQK
MPSDIKLTFPDGSIKNFPVHATGSDVAESISRSLAKKAVAVAINGKVCDLSDPVREGSIEIITPEDPRSLAVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWFDLCRGPHVRSTGQVKKFFKLMKVAGAYWRGDSNRPMLSRIYGTAWNTQQELTQYLYFLEESEKRDHRKLAREMDLFHIAEDGSGVIFWHRKGWKIFQTLISYMRRKIKDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLSTRPEKRVGSDALWDDAENIMKGVLDTIKNSSQDRINTGVLLGEGAFYGPKFEYILKDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENFKGNLPLWLSPIQAIVTTITSSAVEYAQEIANLLKSHHLSIETDFRNETINYKIREHSIKKIPIIIICGDKEASERSIGIRRFGSTTTQKVSLLDAIPILTKESLPPDCQK
MPSDIKLTFPDGSIKNFPVHATGSDVAESISRSLAKKAVAVAINGKVCDLSDPVREGSIEIITPEDPRSLAVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWFDLCRGPHVRSTGQVKKFFKLMKVAGAYWRGDSNRPMLSRIYGTAWNTQQELTQYLYFLEESEKRDHRKLAREMDLFHIAEDGSGVIFWHRKGWKIFQTLISYMRRKIKDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLSTRPEKRVGSDALWDDAENIMKGVLDTIKNSSQDRINTGVLLGEGAFYGPKFEYILKDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENFKGNLPLWLSPIQAIVTTITSSAVEYAQEIANLLKSHHLSIETDFRNETINYKIREHSIKKIPIIIICGDKEASERSIGIRRFGSTTTQKVSLLDAIPILTKESLPPDCQK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target652 threonyl-tRNA synthetase [Candidatus Liberibacter asiat
254780870449 prolyl-tRNA synthetase [Candidatus Liberibacter as 2e-07
254780191898 alanyl-tRNA synthetase [Candidatus Liberibacter as 4e-07
>gi|254780870|ref|YP_003065283.1| prolyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 449 Back     alignment
 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 76/183 (41%), Gaps = 11/183 (6%)

Query: 258 IAEDGSGVIFWHRKGWKIFQTLISYMRR-KIKDDYEEINTPQVLDQHLWQQSGHWDSYRA 316
           I +   G+  W   G K    + + +R  + +    E++ P +    LW +SG +DSY  
Sbjct: 32  IHQHSKGIYSWLPLGQKALDNVNAIIREEQNRTGAIEMSVPTLQSADLWVESGRYDSYGK 91

Query: 317 NMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGS 376
            M  +   +D     +     P +      +F   +KSYR LP    +    +R+E    
Sbjct: 92  EMLRLADRND-----KAMIYGPTHEEVMTDIFRSHIKSYRNLPFTFYQIQLKFRDELRPR 146

Query: 377 LHGLMRVRGFTQDDAHVF-CTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLSTRPEKRV 435
             G+MR R F   DA+ F  T E   +   K+    + I+   G + I ++  + P   +
Sbjct: 147 F-GVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVSYLRIFHRLGLKSIPMRAESGP---I 202

Query: 436 GSD 438
           G D
Sbjct: 203 GGD 205

>gi|254780191|ref|YP_003064604.1| alanyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 898 Back     alignment
 Score = 48.1 bits (113), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 75/183 (40%), Gaps = 10/183 (5%)

Query: 22  TGSDVAESISRSLA---KKAVAVAINGKVCDLSDPVREGSIEIITPEDPRSLAVIRHSCA 78
           TG  + + I   +    KKA  + ++  + +      E S+ +      R    I HS  
Sbjct: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590

Query: 79  HIMAEAVQSIW-PEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARDSPFL 137
           H++  A+ +I    V      I  DG  +D    +P +S EL  IE  + +IIA++ P +
Sbjct: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650

Query: 138 KQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWFD--LCRGPHVRSTGQVK 195
            + ++ E A     +     K      + + E    Y  G      LC G HV STG++ 
Sbjct: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVE----YEDGGVHSSALCGGTHVSSTGEIM 706

Query: 196 KFF 198
             +
Sbjct: 707 LLY 709

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target652 threonyl-tRNA synthetase [Candidatus Liberibacter asiat
315122407653 threonyl-tRNA synthetase [Candidatus Liberibacter solan 1 0.0
227821825661 threonyl-tRNA synthetase [Sinorhizobium fredii NGR234] 1 0.0
86357812668 threonyl-tRNA synthetase [Rhizobium etli CFN 42] Length 1 0.0
15965178661 threonyl-tRNA synthetase [Sinorhizobium meliloti 1021] 1 0.0
150396275660 threonyl-tRNA synthetase [Sinorhizobium medicae WSM419] 1 0.0
307321522660 threonyl-tRNA synthetase [Sinorhizobium meliloti AK83] 1 0.0
190891876668 threonyl-tRNA synthetase [Rhizobium etli CIAT 652] Leng 1 0.0
327188321668 threonyl-tRNA synthetase protein [Rhizobium etli CNPAF5 1 0.0
222086050662 threonyl-tRNA synthetase [Agrobacterium radiobacter K84 1 0.0
307309192660 threonyl-tRNA synthetase [Sinorhizobium meliloti BL225C 1 0.0
>gi|315122407|ref|YP_004062896.1| threonyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 653 Back     alignment and organism information
 Score = 1163 bits (3008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/652 (82%), Positives = 599/652 (91%)

Query: 1   MPSDIKLTFPDGSIKNFPVHATGSDVAESISRSLAKKAVAVAINGKVCDLSDPVREGSIE 60
           MPS+I LTFPDG IKNFP H TG DVAESIS+S+AKKA+AVAING +CDLSD ++ GSIE
Sbjct: 1   MPSNITLTFPDGLIKNFPAHTTGYDVAESISKSIAKKAIAVAINGTICDLSDTIQTGSIE 60

Query: 61  IITPEDPRSLAVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELA 120
           IITPEDPRSL VIRHSCAHIMAEAVQSIWP+ QVAIGP+IE+GFYYDF++E+PFSSD+ A
Sbjct: 61  IITPEDPRSLVVIRHSCAHIMAEAVQSIWPKTQVAIGPVIENGFYYDFNREEPFSSDDFA 120

Query: 121 QIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWF 180
           +IEKKM EI+ RDSPF K+ LS E+AR+LFESK E YK+EILE IPA+++VT+Y QGEW 
Sbjct: 121 KIEKKMHEIVTRDSPFCKKRLSREQARKLFESKNETYKLEILEKIPAEQDVTIYNQGEWL 180

Query: 181 DLCRGPHVRSTGQVKKFFKLMKVAGAYWRGDSNRPMLSRIYGTAWNTQQELTQYLYFLEE 240
           DLCRGPHV+STGQ+KKFFKLMKVAGAYWRGD+ RPMLSRIYGTAWN+QQELTQYL F+ E
Sbjct: 181 DLCRGPHVQSTGQIKKFFKLMKVAGAYWRGDNTRPMLSRIYGTAWNSQQELTQYLDFIVE 240

Query: 241 SEKRDHRKLAREMDLFHIAEDGSGVIFWHRKGWKIFQTLISYMRRKIKDDYEEINTPQVL 300
           SEKRDHRK+AREMDLFH AEDGSGVIFWH+KGWK FQTLISYMRRKIKDDYEEINTPQVL
Sbjct: 241 SEKRDHRKIAREMDLFHTAEDGSGVIFWHQKGWKTFQTLISYMRRKIKDDYEEINTPQVL 300

Query: 301 DQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPV 360
           DQ+LW+QSGHWD YRANMFAV+CAD+TIKDLR+FALKPMNCPGHV +F HGLKSYRELPV
Sbjct: 301 DQNLWKQSGHWDWYRANMFAVQCADETIKDLRSFALKPMNCPGHVEIFKHGLKSYRELPV 360

Query: 361 RLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGF 420
           RLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMF ECLKIHNLI+SIYKDFGF
Sbjct: 361 RLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFEECLKIHNLIVSIYKDFGF 420

Query: 421 EKIMVKLSTRPEKRVGSDALWDDAENIMKGVLDTIKNSSQDRINTGVLLGEGAFYGPKFE 480
           E I VKLSTRPEKRVGSDALWDDAE+IM+ VL+TIK SSQ +INTG+L GEGAFYGPKFE
Sbjct: 421 ENITVKLSTRPEKRVGSDALWDDAESIMQTVLNTIKTSSQSKINTGILPGEGAFYGPKFE 480

Query: 481 YILKDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIE 540
           YILKDAIGR+WQCGT Q+DFNLP RFNAFY+NS SEKCHPVMIHRAVFGSIERFIGIMIE
Sbjct: 481 YILKDAIGREWQCGTTQIDFNLPHRFNAFYINSQSEKCHPVMIHRAVFGSIERFIGIMIE 540

Query: 541 NFKGNLPLWLSPIQAIVTTITSSAVEYAQEIANLLKSHHLSIETDFRNETINYKIREHSI 600
           NFKG+LPLWLSP+QA+VTTITSS++EYAQE+  LLKS+ LSIETDFRNE INYKIREHS 
Sbjct: 541 NFKGHLPLWLSPVQAVVTTITSSSIEYAQEVTALLKSNDLSIETDFRNEKINYKIREHSS 600

Query: 601 KKIPIIIICGDKEASERSIGIRRFGSTTTQKVSLLDAIPILTKESLPPDCQK 652
           KKIP+IIICGDKE  ERSI IRR GS T+Q +++LDA+ ++T+ESLPPD  K
Sbjct: 601 KKIPLIIICGDKETQERSIVIRRLGSKTSQSLNILDAVQMITQESLPPDMIK 652


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821825|ref|YP_002825795.1| threonyl-tRNA synthetase [Sinorhizobium fredii NGR234] Length = 661 Back     alignment and organism information
>gi|86357812|ref|YP_469704.1| threonyl-tRNA synthetase [Rhizobium etli CFN 42] Length = 668 Back     alignment and organism information
>gi|15965178|ref|NP_385531.1| threonyl-tRNA synthetase [Sinorhizobium meliloti 1021] Length = 661 Back     alignment and organism information
>gi|150396275|ref|YP_001326742.1| threonyl-tRNA synthetase [Sinorhizobium medicae WSM419] Length = 660 Back     alignment and organism information
>gi|307321522|ref|ZP_07600917.1| threonyl-tRNA synthetase [Sinorhizobium meliloti AK83] Length = 660 Back     alignment and organism information
>gi|190891876|ref|YP_001978418.1| threonyl-tRNA synthetase [Rhizobium etli CIAT 652] Length = 668 Back     alignment and organism information
>gi|327188321|gb|EGE55539.1| threonyl-tRNA synthetase protein [Rhizobium etli CNPAF512] Length = 668 Back     alignment and organism information
>gi|222086050|ref|YP_002544582.1| threonyl-tRNA synthetase [Agrobacterium radiobacter K84] Length = 662 Back     alignment and organism information
>gi|307309192|ref|ZP_07588863.1| threonyl-tRNA synthetase [Sinorhizobium meliloti BL225C] Length = 660 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target652 threonyl-tRNA synthetase [Candidatus Liberibacter asiat
PRK00413638 PRK00413, thrS, threonyl-tRNA synthetase; Reviewed 0.0
PRK12444639 PRK12444, PRK12444, threonyl-tRNA synthetase; Reviewed 0.0
PLN02908686 PLN02908, PLN02908, threonyl-tRNA synthetase 1e-145
PRK12305575 PRK12305, thrS, threonyl-tRNA synthetase; Reviewed 0.0
TIGR00418563 TIGR00418, thrS, threonyl-tRNA synthetase 0.0
PLN02837614 PLN02837, PLN02837, threonine-tRNA ligase 1e-164
COG0441589 COG0441, ThrS, Threonyl-tRNA synthetase [Translation, r 0.0
cd00771298 cd00771, ThrRS_core, Threonyl-tRNA synthetase (ThrRS) c 1e-116
cd00670235 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_ 2e-32
cd00778261 cd00778, ProRS_core_arch_euk, Prolyl-tRNA synthetase (P 6e-08
KOG1637560 KOG1637, KOG1637, KOG1637, Threonyl-tRNA synthetase [Tr 1e-105
PRK14799545 PRK14799, thrS, threonyl-tRNA synthetase; Provisional 2e-99
pfam00587170 pfam00587, tRNA-synt_2b, tRNA synthetase class II core 3e-37
TIGR00409 568 TIGR00409, proS_fam_II, prolyl-tRNA synthetase, family 2e-11
cd00772264 cd00772, ProRS_core, Prolyl-tRNA synthetase (ProRS) cla 9e-08
cd00773261 cd00773, HisRS-like_core, Class II Histidinyl-tRNA synt 4e-04
PRK12325439 PRK12325, PRK12325, prolyl-tRNA synthetase; Provisional 0.002
PRK03991613 PRK03991, PRK03991, threonyl-tRNA synthetase; Validated 5e-35
PRK08661477 PRK08661, PRK08661, prolyl-tRNA synthetase; Provisional 1e-07
KOG4163551 KOG4163, KOG4163, KOG4163, Prolyl-tRNA synthetase [Tran 0.003
cd0086091 cd00860, ThrRS_anticodon, ThrRS Threonyl-anticodon bind 9e-20
pfam0312993 pfam03129, HGTP_anticodon, Anticodon binding domain 8e-12
cd0073894 cd00738, HGTP_anticodon, HGTP anticodon binding domain, 3e-07
PRK14938387 PRK14938, PRK14938, Ser-tRNA(Thr) hydrolase; Provisiona 3e-06
TIGR00442397 TIGR00442, hisS, histidyl-tRNA synthetase 1e-05
PRK00037412 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed 0.004
COG0442 500 COG0442, ProS, Prolyl-tRNA synthetase [Translation, rib 3e-17
TIGR00408472 TIGR00408, proS_fam_I, prolyl-tRNA synthetase, family I 6e-12
COG0124429 COG0124, HisS, Histidyl-tRNA synthetase [Translation, r 3e-07
cd0166761 cd01667, TGS_ThrRS_N, TGS _ThrRS_N: ThrRS (threonyl-tRN 1e-15
pfam0282460 pfam02824, TGS, TGS domain 3e-08
cd0166860 cd01668, TGS_RelA_SpoT, TGS_RelA_SpoT: The RelA (SpoT) 3e-04
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA amino-a 1e-14
KOG1637560 KOG1637, KOG1637, KOG1637, Threonyl-tRNA synthetase [Tr 5e-14
cd00779255 cd00779, ProRS_core_prok, Prolyl-tRNA synthetase (ProRS 4e-12
cd00770297 cd00770, SerRS_core, Seryl-tRNA synthetase (SerRS) clas 1e-05
COG0172429 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribo 3e-05
smart0086344 smart00863, tRNA_SAD, Threonyl and Alanyl tRNA syntheta 2e-10
pfam0797344 pfam07973, tRNA_SAD, Threonyl and Alanyl tRNA synthetas 9e-10
KOG2324457 KOG2324, KOG2324, KOG2324, Prolyl-tRNA synthetase [Tran 4e-09
PRK01584594 PRK01584, PRK01584, alanyl-tRNA synthetase; Provisional 5e-07
COG2872241 COG2872, COG2872, Predicted metal-dependent hydrolases 1e-05
COG0013879 COG0013, AlaS, Alanyl-tRNA synthetase [Translation, rib 2e-05
KOG0188895 KOG0188, KOG0188, KOG0188, Alanyl-tRNA synthetase [Tran 3e-05
PRK09194 565 PRK09194, PRK09194, prolyl-tRNA synthetase; Provisional 4e-06
PRK00252865 PRK00252, alaS, alanyl-tRNA synthetase; Reviewed 0.001
>gnl|CDD|179011 PRK00413, thrS, threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183530 PRK12444, PRK12444, threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178496 PLN02908, PLN02908, threonyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|183422 PRK12305, thrS, threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161870 TIGR00418, thrS, threonyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|178431 PLN02837, PLN02837, threonine-tRNA ligase Back     alignment and domain information
>gnl|CDD|30790 COG0441, ThrS, Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29816 cd00771, ThrRS_core, Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|29810 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|29823 cd00778, ProRS_core_arch_euk, Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|36850 KOG1637, KOG1637, KOG1637, Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|184826 PRK14799, thrS, threonyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|144252 pfam00587, tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>gnl|CDD|161864 TIGR00409, proS_fam_II, prolyl-tRNA synthetase, family II Back     alignment and domain information
>gnl|CDD|58340 cd00772, ProRS_core, Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|73226 cd00773, HisRS-like_core, Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>gnl|CDD|183440 PRK12325, PRK12325, prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179698 PRK03991, PRK03991, threonyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|181528 PRK08661, PRK08661, prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|39365 KOG4163, KOG4163, KOG4163, Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29800 cd00860, ThrRS_anticodon, ThrRS Threonyl-anticodon binding domain Back     alignment and domain information
>gnl|CDD|145985 pfam03129, HGTP_anticodon, Anticodon binding domain Back     alignment and domain information
>gnl|CDD|29797 cd00738, HGTP_anticodon, HGTP anticodon binding domain, as found at the C-terminus of histidyl, glycyl, threonyl and prolyl tRNA synthetases, which are classified as a group of class II aminoacyl-tRNA synthetases (aaRS) Back     alignment and domain information
>gnl|CDD|184902 PRK14938, PRK14938, Ser-tRNA(Thr) hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|161881 TIGR00442, hisS, histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|178812 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|30791 COG0442, ProS, Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161863 TIGR00408, proS_fam_I, prolyl-tRNA synthetase, family I Back     alignment and domain information
>gnl|CDD|30473 COG0124, HisS, Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133437 cd01667, TGS_ThrRS_N, TGS _ThrRS_N: ThrRS (threonyl-tRNA Synthetase) is a class II tRNA synthetase that couples threonine to its cognate tRNA Back     alignment and domain information
>gnl|CDD|145794 pfam02824, TGS, TGS domain Back     alignment and domain information
>gnl|CDD|133438 cd01668, TGS_RelA_SpoT, TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response Back     alignment and domain information
>gnl|CDD|29813 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>gnl|CDD|36850 KOG1637, KOG1637, KOG1637, Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|73229 cd00779, ProRS_core_prok, Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|29815 cd00770, SerRS_core, Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|30521 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129096 smart00863, tRNA_SAD, Threonyl and Alanyl tRNA synthetase second additional domain Back     alignment and domain information
>gnl|CDD|149189 pfam07973, tRNA_SAD, Threonyl and Alanyl tRNA synthetase second additional domain Back     alignment and domain information
>gnl|CDD|37535 KOG2324, KOG2324, KOG2324, Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179306 PRK01584, PRK01584, alanyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|32699 COG2872, COG2872, Predicted metal-dependent hydrolases related to alanyl-tRNA synthetase HxxxH domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|30363 COG0013, AlaS, Alanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35409 KOG0188, KOG0188, KOG0188, Alanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181689 PRK09194, PRK09194, prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178947 PRK00252, alaS, alanyl-tRNA synthetase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 652 threonyl-tRNA synthetase [Candidatus Liberibacter asiat
PRK12444639 threonyl-tRNA synthetase; Reviewed 100.0
PRK04483634 threonyl-tRNA synthetase; Validated 100.0
PRK03772642 threonyl-tRNA synthetase; Validated 100.0
PRK00413639 thrS threonyl-tRNA synthetase; Reviewed 100.0
KOG1637560 consensus 100.0
PRK12304604 thrS threonyl-tRNA synthetase; Reviewed 100.0
COG0441589 ThrS Threonyl-tRNA synthetase [Translation, ribosomal s 100.0
PRK03991613 threonyl-tRNA synthetase; Validated 100.0
PRK12305576 thrS threonyl-tRNA synthetase; Reviewed 100.0
TIGR00418595 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The 100.0
cd00771298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II co 100.0
cd00778261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) clas 100.0
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II 100.0
cd00772264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core 100.0
cd00770297 SerRS_core Seryl-tRNA synthetase (SerRS) class II core 100.0
PRK05431422 seryl-tRNA synthetase; Provisional 99.89
PRK00960516 seryl-tRNA synthetase; Provisional 99.28
TIGR00414460 serS seryl-tRNA synthetase; InterPro: IPR002317 The ami 99.2
PRK07080318 hypothetical protein; Validated 98.1
PRK12325438 prolyl-tRNA synthetase; Provisional 100.0
PRK09194570 prolyl-tRNA synthetase; Provisional 100.0
TIGR00409620 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 100.0
PRK08661478 prolyl-tRNA synthetase; Provisional 100.0
COG0442500 ProS Prolyl-tRNA synthetase [Translation, ribosomal str 100.0
TIGR00408 533 proS_fam_I prolyl-tRNA synthetase; InterPro: IPR004499 100.0
KOG2324457 consensus 100.0
PRK04173460 glycyl-tRNA synthetase; Provisional 100.0
PRK00037417 hisS histidyl-tRNA synthetase; Reviewed 100.0
TIGR00389606 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR00231 100.0
COG0423558 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ri 100.0
KOG2298599 consensus 100.0
CHL00201424 syh histidine-tRNA synthetase; Provisional 99.95
COG0124429 HisS Histidyl-tRNA synthetase [Translation, ribosomal s 99.94
PRK12420421 histidyl-tRNA synthetase; Provisional 99.91
TIGR00442446 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The 99.48
KOG4163551 consensus 100.0
KOG1936518 consensus 99.6
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA s 100.0
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl synthe 100.0
pfam00587170 tRNA-synt_2b tRNA synthetase class II core domain (G, H 100.0
cd00774254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like cla 99.79
PRK12421391 ATP phosphoribosyltransferase regulatory subunit; Provi 99.03
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetase (Hi 98.96
PRK12293281 hisZ ATP phosphoribosyltransferase regulatory subunit; 98.91
PRK12295373 hisZ ATP phosphoribosyltransferase regulatory subunit; 98.85
TIGR00459 653 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 98.43
COG0173585 AspS Aspartyl-tRNA synthetase [Translation, ribosomal s 98.41
TIGR00415520 serS_MJ seryl-tRNA synthetase; InterPro: IPR004503 The 98.3
COG3705390 HisZ ATP phosphoribosyltransferase involved in histidin 97.89
PRK04172501 pheS phenylalanyl-tRNA synthetase subunit alpha; Provis 96.74
PTZ00326505 phenylalanyl-tRNA synthetase; Provisional 96.6
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) a 95.51
cd00858121 GlyRS_anticodon GlyRS Glycyl-anticodon binding domain. 99.95
cd00862202 ProRS_anticodon_zinc ProRS Prolyl-anticodon binding dom 99.9
cd0086194 ProRS_anticodon_short ProRS Prolyl-anticodon binding do 99.9
cd0086091 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain 99.9
cd0073894 HGTP_anticodon HGTP anticodon binding domain, as found 99.89
cd02426128 Pol_gamma_b_Cterm C-terminal domain of mitochondrial DN 99.8
pfam0312993 HGTP_anticodon Anticodon binding domain. This domain is 99.8
cd0085991 HisRS_anticodon HisRS Histidyl-anticodon binding domain 99.66
COG0172429 SerS Seryl-tRNA synthetase [Translation, ribosomal stru 99.85
KOG2509455 consensus 99.54
PRK12292388 hisZ ATP phosphoribosyltransferase regulatory subunit; 99.63
COG0442 500 ProS Prolyl-tRNA synthetase [Translation, ribosomal str 99.6
PRK00252864 alaS alanyl-tRNA synthetase; Reviewed 99.59
PRK13902898 alaS lanyl-tRNA synthetase; Provisional 99.56
PRK01584593 alanyl-tRNA synthetase; Provisional 99.53
COG2872241 Predicted metal-dependent hydrolases related to alanyl- 98.99
TIGR00344914 alaS alanyl-tRNA synthetase; InterPro: IPR002318 The am 97.94
KOG2105415 consensus 96.15
COG0013879 AlaS Alanyl-tRNA synthetase [Translation, ribosomal str 99.56
KOG0188895 consensus 99.0
cd0166761 TGS_ThrRS_N TGS _ThrRS_N: ThrRS (threonyl-tRNA Syntheta 99.53
pfam0282460 TGS TGS domain. The TGS domain is named after ThrRS, GT 98.96
cd0161660 TGS The TGS domain, named after the ThrRS, GTPase, and 98.87
cd0166860 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, a 98.22
TIGR00691741 spoT_relA RelA/SpoT family protein; InterPro: IPR004811 97.57
PRK0744070 hypothetical protein; Provisional 97.19
COG210468 ThiS Sulfur transfer protein involved in thiamine biosy 95.89
PRK0565966 sulfur carrier protein ThiS; Validated 95.37
cd0166976 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS domain of 95.34
PRK0769667 sulfur carrier protein ThiS; Provisional 95.18
PRK0608369 sulfur carrier protein ThiS; Provisional 94.94
PRK07569236 bidirectional hydrogenase complex protein HoxU; Validat 94.68
PRK11840327 bifunctional sulfur carrier protein/thiazole synthase p 94.29
PRK0586365 sulfur carrier protein ThiS; Provisional 94.19
PRK0694465 sulfur carrier protein ThiS; Provisional 94.02
PRK0805366 sulfur carrier protein ThiS; Provisional 93.09
pfam0259770 ThiS ThiS family. ThiS (thiaminS) is a 66 aa protein in 93.01
cd0056565 ThiS ThiS (ThiaminS) is a sulfur carrier protein involv 92.87
PRK0648865 sulfur carrier protein ThiS; Validated 92.82
TIGR0168365 thiS thiamine biosynthesis protein ThiS; InterPro: IPR0 91.64
smart0086344 tRNA_SAD Threonyl and Alanyl tRNA synthetase second add 98.49
pfam0797344 tRNA_SAD Threonyl and Alanyl tRNA synthetase second add 98.46
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl 98.46
PRK09537420 pylS pyrolysyl-tRNA synthetase; Reviewed 98.41
PRK00484491 lysS lysyl-tRNA synthetase; Reviewed 98.41
PRK09350325 lysyl-tRNA synthetase; Provisional 98.4
PRK05159434 aspC aspartyl-tRNA synthetase; Provisional 98.2
cd00775329 LysRS_core Lys_tRNA synthetase (LysRS) class II core do 98.16
PRK03932462 asnC asparaginyl-tRNA synthetase; Validated 98.16
KOG2411628 consensus 98.12
pfam00152341 tRNA-synt_2 tRNA synthetases class II (D, K and N). 98.12
PRK029831099 lysS lysyl-tRNA synthetase; Provisional 98.08
PRK00476587 aspS aspartyl-tRNA synthetase; Validated 98.05
PRK12445505 lysyl-tRNA synthetase; Reviewed 98.03
cd00776322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II c 97.93
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class I 97.91
cd00777280 AspRS_core Asp tRNA synthetase (aspRS) class II core do 97.88
COG2269322 Truncated, possibly inactive, lysyl-tRNA synthetase (cl 97.69
TIGR02367453 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 Py 97.58
COG1190502 LysU Lysyl-tRNA synthetase (class II) [Translation, rib 96.84
COG0017435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation 96.73
KOG1885560 consensus 96.24
TIGR00462330 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR0 94.98
TIGR00471605 pheT_arch phenylalanyl-tRNA synthetase, beta subunit; I 93.84
pfam01409243 tRNA-synt_2d tRNA synthetases class II core domain (F). 91.07
PRK10872743 relA GDP/GTP pyrophosphokinase; Provisional 98.18
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bi 98.13
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases/synt 98.04
PRK06462332 asparagine synthetase A; Reviewed 97.79
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [Transl 95.98
PRK06253527 O-phosphoseryl-tRNA synthetase; Reviewed 95.64
TIGR00457495 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 T 95.52
cd00769198 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) be 92.29
PRK09616546 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewe 91.45
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK04483 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK03772 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG1637 consensus Back     alignment and domain information
>PRK12304 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00960 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00414 serS seryl-tRNA synthetase; InterPro: IPR002317 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK07080 hypothetical protein; Validated Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase; InterPro: IPR004499 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2324 consensus Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR002315 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2298 consensus Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG4163 consensus Back     alignment and domain information
>KOG1936 consensus Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>pfam00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00415 serS_MJ seryl-tRNA synthetase; InterPro: IPR004503 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>cd00858 GlyRS_anticodon GlyRS Glycyl-anticodon binding domain Back     alignment and domain information
>cd00862 ProRS_anticodon_zinc ProRS Prolyl-anticodon binding domain, long version found predominantly in eukaryotes and archaea Back     alignment and domain information
>cd00861 ProRS_anticodon_short ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria Back     alignment and domain information
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain Back     alignment and domain information
>cd00738 HGTP_anticodon HGTP anticodon binding domain, as found at the C-terminus of histidyl, glycyl, threonyl and prolyl tRNA synthetases, which are classified as a group of class II aminoacyl-tRNA synthetases (aaRS) Back     alignment and domain information
>cd02426 Pol_gamma_b_Cterm C-terminal domain of mitochondrial DNA polymerase gamma B subunit, which is required for processivity Back     alignment and domain information
>pfam03129 HGTP_anticodon Anticodon binding domain Back     alignment and domain information
>cd00859 HisRS_anticodon HisRS Histidyl-anticodon binding domain Back     alignment and domain information
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2509 consensus Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00252 alaS alanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK13902 alaS lanyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK01584 alanyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG2872 Predicted metal-dependent hydrolases related to alanyl-tRNA synthetase HxxxH domain [General function prediction only] Back     alignment and domain information
>TIGR00344 alaS alanyl-tRNA synthetase; InterPro: IPR002318 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2105 consensus Back     alignment and domain information
>COG0013 AlaS Alanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0188 consensus Back     alignment and domain information
>cd01667 TGS_ThrRS_N TGS _ThrRS_N: ThrRS (threonyl-tRNA Synthetase) is a class II tRNA synthetase that couples threonine to its cognate tRNA Back     alignment and domain information
>pfam02824 TGS TGS domain Back     alignment and domain information
>cd01616 TGS The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin Back     alignment and domain information
>cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response Back     alignment and domain information
>TIGR00691 spoT_relA RelA/SpoT family protein; InterPro: IPR004811 The functions of Escherichia coli RelA and SpoT differ somewhat Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>cd01669 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS domain of Ygr210 GTP-binding protein which is a member of Obg-like family of GTPases, and present in archaea Back     alignment and domain information
>PRK07696 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK06083 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK06944 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK08053 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>pfam02597 ThiS ThiS family Back     alignment and domain information
>cd00565 ThiS ThiS (ThiaminS) is a sulfur carrier protein involved in thiamin biosynthesis in bacteria Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>TIGR01683 thiS thiamine biosynthesis protein ThiS; InterPro: IPR010035 This entry identifies the ThiS family, which are thiamine-biosynthesis proteins related to MoaD (IPR010034 from INTERPRO) Back     alignment and domain information
>smart00863 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain Back     alignment and domain information
>pfam07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK09350 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>KOG2411 consensus Back     alignment and domain information
>pfam00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 PylS is the archaeal enzyme responsible for charging the pyrrolysine tRNA, PylT, by ligating a free molecule of pyrrolysine Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1885 consensus Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR004525 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00471 pheT_arch phenylalanyl-tRNA synthetase, beta subunit; InterPro: IPR004531 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam01409 tRNA-synt_2d tRNA synthetases class II core domain (F) Back     alignment and domain information
>PRK10872 relA GDP/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06253 O-phosphoseryl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00769 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain Back     alignment and domain information
>PRK09616 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target652 threonyl-tRNA synthetase [Candidatus Liberibacter asiat
1qf6_A642 Structure Of E. Coli Threonyl-Trna Synthetase Compl 0.0
1nyq_A645 Structure Of Staphylococcus Aureus Threonyl-Trna Sy 1e-174
1evk_A401 Crystal Structure Of A Truncated Form Of Threonyl-T 1e-105
1nj1_A501 Crystal Structure Of Prolyl-Trna Synthetase From Me 1e-48
2i4l_A458 Rhodopseudomonas Palustris Prolyl-Trna Synthetase L 3e-48
1nj8_A459 Crystal Structure Of Prolyl-Trna Synthetase From Me 3e-46
3a32_A471 Crystal Structure Of Putative Threonyl-Trna Synthet 9e-45
1h4q_A</