254781005

254781005

hypothetical protein CLIBASIA_04530

GeneID in NCBI database:8210027Locus tag:CLIBASIA_04530
Protein GI in NCBI database:254781005Protein Accession:YP_003065418.1
Gene range:-(1003186, 1003443)Protein Length:85aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80-----
MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQERKKADQPIGGGKTGETLPKGGGRKISLDSNNLSTELRSQNFLRK
cccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEccccHHHHHHHHHHHcc
ccccEEEEEEHHccEEEEcccccccccHcHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEccccccHHHHHHHHHcc
MDIKGLIVASLISSTVIMsgcsetldpengIRELGARMKQERkkadqpigggktgetlpkgggrkisldsnnlstelrsqnflrk
MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQerkkadqpigggktgetlpkgggrkisldsnnlstelrsqnflrk
MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQERKKADQPIGGGKTGETLPKGGGRKISLDSNNLSTELRSQNFLRK
**IKGLIVASLISSTVIMSGCSETLDPENG*************************************LDSNNLSTELRSQNF***
MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGAR*************GGKTGETLPKGGGRKISLDSNNLSTEL********
*DIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQER********GGKTGETLPKGGGRKISLDSNNLSTELRSQNFL**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQERKKADQPIGGGKTGETLPKGGGRKISLDSNNLSTELRSQNFLRK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target85 hypothetical protein CLIBASIA_04530 [Candidatus Liberib
25478088641 hypothetical protein CLIBASIA_03915 [Candidatus Li 3e-07
>gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] Length = 41 Back     alignment
 Score = 44.7 bits (104), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 31/41 (75%)

Query: 1  MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQE 41
          M+ KGLIVAS+ISST IMS CS + + ++ IR++   +K++
Sbjct: 1  MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target85 hypothetical protein CLIBASIA_04530 [Candidatus Liberib
25478088641 hypothetical protein CLIBASIA_03915 [Candidatus Liberib 1 0.004
>gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] Length = 41 Back     alignment and organism information
 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 31/41 (75%)

Query: 1  MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQE 41
          M+ KGLIVAS+ISST IMS CS + + ++ IR++   +K++
Sbjct: 1  MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00