254781007

254781007

hypothetical protein CLIBASIA_04540

GeneID in NCBI database:8210029Locus tag:CLIBASIA_04540
Protein GI in NCBI database:254781007Protein Accession:YP_003065420.1
Gene range:+(1004165, 1005400)Protein Length:411aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNTGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVGTLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDSWRR
ccccccEEEEEEEHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHEEEcccccccEEEEEEEEEEEEEEEHHHHHHHHHHccccEEHHHHHHHHHHccccEEEEEEccccEEEEcccccccccccccHHccHHHHHHHHHcHHHHHHHHHHHcccccccccccHHHHHHHEEEEEEEEEEcccccHHHHHcccccccHHccHHHHHHHHHHHHcccccccEEEEccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccHHHHHHHHHcccHHEEEEcccccHHHHHHHHHHHHHHHHHHHEEEEEEEcccc
ccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHEEEEEEHHHHHHHHHHHHHHHHHcHEEEEcccccHHHHHHHcccHHHHHHHHHHHHccccccccccccHHHHHHcEEEEEccccccccEEEEEEEHHHHHHHHHHHHHHHccccccEEccHHHHHHHHHHHHHEEcccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccEEEEEccccccHHHcccccEcccccccHHHHHHcccccccccccccEEEcccccccccccHHHHHHHHHHHcHcccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHHHHHHcEEEEEccccc
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHVIyrtspknlydLREAGRDNFIRHQIEKALNTynsrdlsntgsieSIVKDAVILTknvnslplqfTVDIALSTTVQLRGSLLQMFsqskgkvdisRRKKVMYKQNIGLmimpfawdgywlasrgkvadskvhppkyleySHYYQQYLNRNTLVKNFLsqipyknfcmapyhySSILYWAVGTLTYsvdnktttreyykdpyyatwdhfpysfiknvfdmtsnqfgdgqvltntnhcfphgasQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHkrhrtgrdaitifsvgfspdqdtrytlrqcasdpskyyeinsdenvMPIAKSLARNVITNWFSQFTITVVDSWRR
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALntynsrdlsntgSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQmfsqskgkvdisrrKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVGTLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKrhrtgrdaiTIFSVgfspdqdtryTLRQCasdpskyyeinsdeNVMPIAKSLARNVITNWFSQFTITVVDSWRR
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFvaivdvvvdqvtvMQKTAWLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNTGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVGTLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDSWRR
***NKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNTGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQ****************VMYKQNIGLMIMPFAWDGYWLASRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVGTLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASQNKYMLMLAIGN************EKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDSWR*
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNTGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVGTLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDSWRR
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNTGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVGTLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDSW**
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNTGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVGTLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDSWRR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target411 hypothetical protein CLIBASIA_04540 [Candidatus Liberib
254780929408 hypothetical protein CLIBASIA_04140 [Candidatus Li 0.0
254780914408 hypothetical protein CLIBASIA_04065 [Candidatus Li 0.0
254780135408 hypothetical protein CLIBASIA_00070 [Candidatus Li 0.0
>gi|254780929|ref|YP_003065342.1| hypothetical protein CLIBASIA_04140 [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Back     alignment
 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/408 (99%), Positives = 407/408 (99%)

Query: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV 60
           MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV
Sbjct: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV 60

Query: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNTGSIESIVKDAVILTKNVNSL 120
           IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSN GSIESIVKDAVILTKNVNSL
Sbjct: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL 120

Query: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180
           PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA
Sbjct: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180

Query: 181 SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG 240
           SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG
Sbjct: 181 SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG 240

Query: 241 TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300
           TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA
Sbjct: 241 TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300

Query: 301 SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR 360
           SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR
Sbjct: 301 SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR 360

Query: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408
           YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
Sbjct: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408

>gi|254780914|ref|YP_003065327.1| hypothetical protein CLIBASIA_04065 [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Back     alignment
 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/408 (99%), Positives = 407/408 (99%)

Query: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV 60
           MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV
Sbjct: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV 60

Query: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNTGSIESIVKDAVILTKNVNSL 120
           IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSN GSIESIVKDAVILTKNVNSL
Sbjct: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL 120

Query: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180
           PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA
Sbjct: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180

Query: 181 SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG 240
           SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG
Sbjct: 181 SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG 240

Query: 241 TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300
           TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA
Sbjct: 241 TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300

Query: 301 SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR 360
           SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR
Sbjct: 301 SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR 360

Query: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408
           YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
Sbjct: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408

>gi|254780135|ref|YP_003064548.1| hypothetical protein CLIBASIA_00070 [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Back     alignment
 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/408 (91%), Positives = 380/408 (93%)

Query: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV 60
           MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTA LQEVLDHV
Sbjct: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTALLQEVLDHV 60

Query: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNTGSIESIVKDAVILTKNVNSL 120
           IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSN GSIESIVKDAVILTKNVNSL
Sbjct: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL 120

Query: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180
           PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA
Sbjct: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180

Query: 181 SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG 240
           SRGKVADS+VH PKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHY SI YWA  
Sbjct: 181 SRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFE 240

Query: 241 TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300
              Y  DN       ++D Y  TWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA
Sbjct: 241 NFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300

Query: 301 SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR 360
           S +KYMLM AIGNQLSRSSV KE I+++LQDC+YMHK HRTGR AITIFSVGFSPDQDTR
Sbjct: 301 SHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTR 360

Query: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408
           YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
Sbjct: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target411 hypothetical protein CLIBASIA_04540 [Candidatus Liberib
254780914408 hypothetical protein CLIBASIA_04065 [Candidatus Liberib 1 0.0
254780135408 hypothetical protein CLIBASIA_00070 [Candidatus Liberib 1 0.0
315122409411 hypothetical protein CKC_03305 [Candidatus Liberibacter 1 3e-57
>gi|254780914|ref|YP_003065327.1| hypothetical protein CLIBASIA_04065 [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Back     alignment and organism information
 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/408 (99%), Positives = 407/408 (99%)

Query: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV 60
           MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV
Sbjct: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV 60

Query: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNTGSIESIVKDAVILTKNVNSL 120
           IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSN GSIESIVKDAVILTKNVNSL
Sbjct: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL 120

Query: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180
           PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA
Sbjct: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180

Query: 181 SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG 240
           SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG
Sbjct: 181 SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG 240

Query: 241 TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300
           TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA
Sbjct: 241 TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300

Query: 301 SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR 360
           SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR
Sbjct: 301 SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR 360

Query: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408
           YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
Sbjct: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254780135|ref|YP_003064548.1| hypothetical protein CLIBASIA_00070 [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Back     alignment and organism information
>gi|315122409|ref|YP_004062898.1| hypothetical protein CKC_03305 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 411 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target411 hypothetical protein CLIBASIA_04540 [Candidatus Liberib
2ww8_A_221-279_318-447_506-585269 RRGA, cell WALL surface anchor family protein; IGG 95.83
>2ww8_A (A:221-279,A:318-447,A:506-585) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
Probab=95.83  E-value=0.018  Score=37.26  Aligned_cols=59  Identities=19%  Similarity=0.300  Sum_probs=41.7

Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCC-------HHHHHHHHCCCCHHEEEECCCCCHHHHHHHHHHHH
Q ss_conf             999998599887511476416899740488742-------02678763059032044258765344789877777
Q gi|254781007|r  326 EKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQD-------TRYTLRQCASDPSKYYEINSDENVMPIAKSLARNV  393 (411)
Q Consensus       326 ekvlqdchymhkrhrtgrdaitifsvgfspdqd-------trytlrqcasdpskyyeinsdenvmpiakslarnv  393 (411)
                      ...+..|-.+..      ..|+||+|||..+-+       .++-|+.|||+|+.||+...   .-.+-+++|+..
T Consensus       202 ~~~~~~c~~~k~------~~i~i~ti~~~~~~~~~~~~~~~~~~l~~cas~~~~y~~~~~---~~~~f~~ia~~~  267 (269)
T 2ww8_A          202 PTRWYYNGNIAP------DGYDVFTVGIGINGDPGTDEATATSFMQSISSKPENYTNVTD---TTKILEQLNRYF  267 (269)
T ss_dssp             HHHHHHHHHTGG------GCCEEEEEEESCCCTTTSCHHHHHHHHHHTSSSGGGEEEESS---GGGHHHHHHHHH
T ss_pred             CEEEEEEEECCC------CCCEEEEEEEECCCCCCCCCCCCCEEEEEEECCCCCEEEECC---CCCEECCCCCCC
T ss_conf             305788752046------763035776771564210023430577566116653264056---651111335541