254781012

254781012

dihydroorotase

GeneID in NCBI database:8210035Locus tag:CLIBASIA_04570
Protein GI in NCBI database:254781012Protein Accession:YP_003065425.1
Gene range:-(1011839, 1012888)Protein Length:349aa
Gene description:dihydroorotase
COG prediction:none
KEGG prediction:pyrC; dihydroorotase (EC:3.5.2.3); K01465 dihydroorotase [EC:3.5.2.3]
SEED prediction:Dihydroorotase (EC 3.5.2.3)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:De Novo Pyrimidine Synthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MKKISLRVPDDWHLHLRDGEILKTVLRDTAKNFRRALVMPNIDPPIITVDDACAYRQRILNALPPEYDFSPLMTIYLTETTDPDDVEKGFTSQLVQAIKLYFAGSTTNSHHGIRNIDRVMPVLERMETIGMPLCIHGEILNQDIDIFDRELMFIDKILDPLRNKLPNLKIILEHITTSNGIDYVNNATNIAGSITVHHLIINRNAIFHDGLNPHYYCLPIPKREKHRLSLRKAALSGNPRFFLGTDSAPHWDSSKESSCGCAGIYTARNALNCLAQIFEEENKLENLESFVSINGATWYGIPVNTRKISLKRREQPIIFDEKITTSTGSITIFNPIFPLYWEVMLHDNL
ccEEEEccccEEEEEcccHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHccccccEEEEEEEEccccccHHHHHHHHHcccccEEEEEccccccccccccccHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHcccccccEEccccEEEcHHHHHccccccccEEccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHcccccccEEEEEEcccccccccccccccccEEEEcccEEEEEEEEEEccc
ccEEEEEcccEEEEccccHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHcccccccEEEEEEEccccccHHHHHHHHHcccEEEEEEccccccccccccccccHHHHHHHHHHHHHcccEEEccccccccccHHHHHHHHHHHcHHHHHHHcccccEEEcccccHHHHHHHHccccEEEEEcHHHHHccHHHHHcccEcHHHccccccccHHHHHHHHHHHHHccccEEEcccEccccHHHHccccEcccccccccHHHHHHHHHHHcccHHHHHHHHHcHHHHHHcccccccEEEEEcccEEccccEEccccEccEEEEccccEEEEEEEEcccc
mkkislrvpddwhlhlrdgEILKTVLRDTAKNFRRalvmpnidppiitvDDACAYRQRILnalppeydfsplmtiyltettdpddvekGFTSQLVQAIKLYFagsttnshhgirnidrvmpvlermetigmplcihgeilnqdidifDRELMFIDKILDPLRNKLPNLKIILEHittsngidyvnnatniaGSITVHHLIINrnaifhdglnphyyclpipkreKHRLSLRKAalsgnprfflgtdsaphwdsskesscgcagiYTARNALNCLAQIFEEENKLENLESFVSIngatwygipvntrkislkrreqpiifdekittstgsitifnpiFPLYWEVMLHDNL
mkkislrvpddwhlhlrdgeilkTVLRDTAKNFRralvmpnidppiITVDDACAYRQRILNalppeydfsPLMTIYLTETTDPDDVEKGFTSQLVQAIKLYFagsttnshhgirnIDRVMPVLERMETIGMPLCIHGEILNQDIDIFDRELMFIDKILDPLRNKLPNLKIILEHIttsngidyVNNATNIAGSITVHHLIINRNAIFHDGLNPHYYCLPIPKREKHRLSLRKAALSGNPRFFLGTDSAPHWDSSKESSCGCAGIYTARNALNCLAQIFEEENKLENLESFVsingatwygipvntrkislkrreqpiifdekittstgsitiFNPIFPLYWEVMLHDNL
MKKISLRVPDDWHLHLRDGEILKTVLRDTAKNFRRALVMPNIDPPIITVDDACAYRQRILNALPPEYDFSPLMTIYLTETTDPDDVEKGFTSQLVQAIKLYFAGSTTNSHHGIRNIDRVMPVLERMETIGMPLCIHGEILNQDIDIFDRELMFIDKILDPLRNKLPNLKIILEHITTSNGIDYVNNATNIAGSITVHHLIINRNAIFHDGLNPHYYCLPIPKREKHRLSLRKAALSGNPRFFLGTDSAPHWDSSKESSCGCAGIYTARNALNCLAQIFEEENKLENLESFVSINGATWYGIPVNTRKISLKRREQPIIFDEKITTSTGSITIFNPIFPLYWEVMLHDNL
*KKISLRVPDDWHLHLRDGEILKTVLRDTAKNFRRALVMPNIDPPIITVDDACAYRQRILNALPPEYDFSPLMTIYLTETTDPDDVEKGFTSQLVQAIKLYFAGSTTNSHHGIRNIDRVMPVLERMETIGMPLCIHGEILNQDIDIFDRELMFIDKILDPLRNKLPNLKIILEHITTSNGIDYVNNATNIAGSITVHHLIINRNAIFHDGLNPHYYCLPIPKREKHRLSLRKAALSGNPRFFLGTDSAPHWDSSKESSCGCAGIYTARNALNCLAQIFEEENKLENLESFVSINGATWYGIPVNTRKISLKRREQPIIFDEKITTSTGSITIFNPIFPLYWEVMLHDN*
MKKISLRVPDDWHLHLRDGEILKTVLRDTAKNFRRALVMPNIDPPIITVDDACAYRQRILNALPPEYDFSPLMTIYLTETTDPDDVEKGFTSQLVQAIKLYFAGSTTNSHHGIRNIDRVMPVLERMETIGMPLCIHGEILNQDIDIFDRELMFIDKILDPLRNKLPNLKIILEHITTSNGIDYVNNATNIAGSITVHHLIINRNAIFHDGLNPHYYCLPIPKREKHRLSLRKAALSGNPRFFLGTDSA**********CGCAGIYTARNALNCLAQIFEEENKLENLESFVSINGATWYGIPVNTRKISLKRREQPIIFDEKITTSTGSITIFNPIFPLYWEVMLHDNL
MKKISLRVPDDWHLHLRDGEILKTVLRDTAKNFRRALVMPNIDPPIITVDDACAYRQRILNALPPEYDFSPLMTIYLTETTDPDDVEKGFTSQLVQAIKLYFAGSTTNSHHGIRNIDRVMPVLERMETIGMPLCIHGEILNQDIDIFDRELMFIDKILDPLRNKLPNLKIILEHITTSNGIDYVNNATNIAGSITVHHLIINRNAIFHDGLNPHYYCLPIPKREKHRLSLRKAALSGNPRFFLGTDSAPHWDSSKESSCGCAGIYTARNALNCLAQIFEEENKLENLESFVSINGATWYGIPVNTRKISLKRREQPIIFDEKITTSTGSITIFNPIFPLYWEVML****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKISLRVPDDWHLHLRDGEILKTVLRDTAKNFRRALVMPNIDPPIITVDDACAYRQRILNALPPEYDFSPLMTIYLTETTDPDDVEKGFTSQLVQAIKLYFAGSTTNSHHGIRNIDRVMPVLERMETIGMPLCIHGEILNQDIDIFDRELMFIDKILDPLRNKLPNLKIILEHITTSNGIDYVNNATNIAGSITVHHLIINRNAIFHDGLNPHYYCLPIPKREKHRLSLRKAALSGNPRFFLGTDSAPHWDSSKESSCGCAGIYTARNALNCLAQIFEEENKLENLESFVSINGATWYGIPVNTRKISLKRREQPIIFDEKITTSTGSITIFNPIFPLYWEVMLHDNL
MKKISLRVPDDWHLHLRDGEILKTVLRDTAKNFRRALVMPNIDPPIITVDDACAYRQRILNALPPEYDFSPLMTIYLTETTDPDDVEKGFTSQLVQAIKLYFAGSTTNSHHGIRNIDRVMPVLERMETIGMPLCIHGEILNQDIDIFDRELMFIDKILDPLRNKLPNLKIILEHITTSNGIDYVNNATNIAGSITVHHLIINRNAIFHDGLNPHYYCLPIPKREKHRLSLRKAALSGNPRFFLGTDSAPHWDSSKESSCGCAGIYTARNALNCLAQIFEEENKLENLESFVSINGATWYGIPVNTRKISLKRREQPIIFDEKITTSTGSITIFNPIFPLYWEVMLHDNL
MKKISLRVPDDWHLHLRDGEILKTVLRDTAKNFRRALVMPNIDPPIITVDDACAYRQRILNALPPEYDFSPLMTIYLTETTDPDDVEKGFTSQLVQAIKLYFAGSTTNSHHGIRNIDRVMPVLERMETIGMPLCIHGEILNQDIDIFDRELMFIDKILDPLRNKLPNLKIILEHITTSNGIDYVNNATNIAGSITVHHLIINRNAIFHDGLNPHYYCLPIPKREKHRLSLRKAALSGNPRFFLGTDSAPHWDSSKESSCGCAGIYTARNALNCLAQIFEEENKLENLESFVSINGATWYGIPVNTRKISLKRREQPIIFDEKITTSTGSITIFNPIFPLYWEVMLHDNL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target349 dihydroorotase [Candidatus Liberibacter asiaticus str.
315122516345 dihydroorotase [Candidatus Liberibacter solanacearum CL 1 1e-157
327190384348 dihydroorotase protein [Rhizobium etli CNPAF512] Length 1 1e-132
218675080348 dihydroorotase [Rhizobium etli GR56] Length = 348 1 1e-132
116250264348 dihydroorotase [Rhizobium leguminosarum bv. viciae 3841 1 1e-132
190890169348 dihydroorotase [Rhizobium etli CIAT 652] Length = 348 1 1e-132
86356125348 dihydroorotase [Rhizobium etli CFN 42] Length = 348 1 1e-131
209547740346 dihydroorotase [Rhizobium leguminosarum bv. trifolii WS 1 1e-131
150395334347 dihydroorotase [Sinorhizobium medicae WSM419] Length = 1 1e-131
227820700345 dihydroorotase [Sinorhizobium fredii NGR234] Length = 3 1 1e-130
241202884348 dihydroorotase [Rhizobium leguminosarum bv. trifolii WS 1 1e-130
>gi|315122516|ref|YP_004063005.1| dihydroorotase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 345 Back     alignment and organism information
 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 270/344 (78%), Positives = 309/344 (89%)

Query: 1   MKKISLRVPDDWHLHLRDGEILKTVLRDTAKNFRRALVMPNIDPPIITVDDACAYRQRIL 60
           M+ ISL  PDDWHLHLRDGEILK +++DT +NF+RAL+MPN +PPIIT  D  AYRQRIL
Sbjct: 1   MQHISLSFPDDWHLHLRDGEILKIIIKDTVRNFKRALIMPNTNPPIITTSDVRAYRQRIL 60

Query: 61  NALPPEYDFSPLMTIYLTETTDPDDVEKGFTSQLVQAIKLYFAGSTTNSHHGIRNIDRVM 120
           ++LP + +FSPLMTIYLTETTDPDDVE+GF S  +QA+KLYFAGSTTNSHHGI NIDRVM
Sbjct: 61  DSLPSQCNFSPLMTIYLTETTDPDDVEQGFHSGFIQAVKLYFAGSTTNSHHGIHNIDRVM 120

Query: 121 PVLERMETIGMPLCIHGEILNQDIDIFDRELMFIDKILDPLRNKLPNLKIILEHITTSNG 180
           PVLERME IG+PLCIHGEI + +IDIFDREL FID+IL+PLR KLPNLKIILEHITT NG
Sbjct: 121 PVLERMEKIGIPLCIHGEIPDSNIDIFDRELAFIDRILEPLRTKLPNLKIILEHITTLNG 180

Query: 181 IDYVNNATNIAGSITVHHLIINRNAIFHDGLNPHYYCLPIPKREKHRLSLRKAALSGNPR 240
           + YV N++NIAGSITVHHLIINRNAIFH+GLNPHYYCLP+PKRE+HRL+LRKAA+SGNPR
Sbjct: 181 VQYVENSSNIAGSITVHHLIINRNAIFHNGLNPHYYCLPVPKREEHRLALRKAAVSGNPR 240

Query: 241 FFLGTDSAPHWDSSKESSCGCAGIYTARNALNCLAQIFEEENKLENLESFVSINGATWYG 300
           FFLGTDSAPH DS KESS GCAGIYTA+NA+NCLA +FEEENKLENLESFVSINGA WYG
Sbjct: 241 FFLGTDSAPHLDSFKESSSGCAGIYTAKNAINCLAHVFEEENKLENLESFVSINGAKWYG 300

Query: 301 IPVNTRKISLKRREQPIIFDEKITTSTGSITIFNPIFPLYWEVM 344
           + +NT KISL RRE+P++FD KITTS GSITIF+P FPL+WEV+
Sbjct: 301 VSINTEKISLVRREKPLVFDRKITTSMGSITIFDPTFPLHWEVV 344


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327190384|gb|EGE57481.1| dihydroorotase protein [Rhizobium etli CNPAF512] Length = 348 Back     alignment and organism information
>gi|218675080|ref|ZP_03524749.1| dihydroorotase [Rhizobium etli GR56] Length = 348 Back     alignment and organism information
>gi|116250264|ref|YP_766102.1| dihydroorotase [Rhizobium leguminosarum bv. viciae 3841] Length = 348 Back     alignment and organism information
>gi|190890169|ref|YP_001976711.1| dihydroorotase [Rhizobium etli CIAT 652] Length = 348 Back     alignment and organism information
>gi|86356125|ref|YP_468017.1| dihydroorotase [Rhizobium etli CFN 42] Length = 348 Back     alignment and organism information
>gi|209547740|ref|YP_002279657.1| dihydroorotase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 346 Back     alignment and organism information
>gi|150395334|ref|YP_001325801.1| dihydroorotase [Sinorhizobium medicae WSM419] Length = 347 Back     alignment and organism information
>gi|227820700|ref|YP_002824670.1| dihydroorotase [Sinorhizobium fredii NGR234] Length = 345 Back     alignment and organism information
>gi|241202884|ref|YP_002973980.1| dihydroorotase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 348 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target349 dihydroorotase [Candidatus Liberibacter asiaticus str.
PRK05451345 PRK05451, PRK05451, dihydroorotase; Provisional 1e-167
cd01294335 cd01294, DHOase, Dihydroorotase (DHOase) catalyzes the 1e-121
TIGR00856341 TIGR00856, pyrC_dimer, dihydroorotase, homodimeric type 1e-116
KOG2902344 KOG2902, KOG2902, KOG2902, Dihydroorotase [Nucleotide t 6e-81
TIGR00857411 TIGR00857, pyrC_multi, dihydroorotase, multifunctional 1e-08
COG0418344 COG0418, PyrC, Dihydroorotase [Nucleotide transport and 1e-134
PLN02599364 PLN02599, PLN02599, dihydroorotase 1e-122
cd01317374 cd01317, DHOase_IIa, Dihydroorotase (DHOase), subgroup 1e-07
COG0044430 COG0044, PyrC, Dihydroorotase and related cyclic amidoh 4e-07
pfam01979307 pfam01979, Amidohydro_1, Amidohydrolase family 6e-07
cd01318361 cd01318, DHOase_IIb, Dihydroorotase (DHOase), subgroup 2e-04
>gnl|CDD|180092 PRK05451, PRK05451, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|73253 cd01294, DHOase, Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis Back     alignment and domain information
>gnl|CDD|129935 TIGR00856, pyrC_dimer, dihydroorotase, homodimeric type Back     alignment and domain information
>gnl|CDD|38113 KOG2902, KOG2902, KOG2902, Dihydroorotase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|162070 TIGR00857, pyrC_multi, dihydroorotase, multifunctional complex type Back     alignment and domain information
>gnl|CDD|30767 COG0418, PyrC, Dihydroorotase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178209 PLN02599, PLN02599, dihydroorotase Back     alignment and domain information
>gnl|CDD|30060 cd01317, DHOase_IIa, Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>gnl|CDD|30393 COG0044, PyrC, Dihydroorotase and related cyclic amidohydrolases [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|145256 pfam01979, Amidohydro_1, Amidohydrolase family Back     alignment and domain information
>gnl|CDD|30061 cd01318, DHOase_IIb, Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 349 dihydroorotase [Candidatus Liberibacter asiaticus str.
cd01294335 DHOase Dihydroorotase (DHOase) catalyzes the reversible 100.0
PRK05451345 dihydroorotase; Provisional 100.0
TIGR00857459 pyrC_multi dihydroorotase, multifunctional complex type 100.0
PRK07369419 dihydroorotase; Provisional 100.0
COG0044430 PyrC Dihydroorotase and related cyclic amidohydrolases 100.0
PRK09060444 dihydroorotase; Validated 100.0
cd01302337 Cyclic_amidohydrolases Cyclic amidohydrolases, includin 100.0
cd01318361 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOas 100.0
PRK09059429 dihydroorotase; Validated 100.0
PRK08417387 dihydroorotase; Provisional 100.0
PRK08044449 allantoinase; Provisional 100.0
PRK07575439 dihydroorotase; Provisional 100.0
COG0418344 PyrC Dihydroorotase [Nucleotide transport and metabolis 100.0
PRK04250408 dihydroorotase; Provisional 100.0
cd01316344 CAD_DHOase The eukaryotic CAD protein is a trifunctiona 100.0
PRK07627425 dihydroorotase; Provisional 100.0
PRK02382440 dihydroorotase; Provisional 100.0
PRK13404476 dihydropyrimidinase; Provisional 100.0
TIGR00856364 pyrC_dimer dihydroorotase, homodimeric type; InterPro: 100.0
PRK09236444 dihydroorotase; Reviewed 100.0
PRK00369393 pyrC dihydroorotase; Provisional 100.0
cd01317374 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOas 100.0
PRK01211413 dihydroorotase; Provisional 100.0
PRK08323463 dihydropyrimidinase; Validated 100.0
PRK09357425 pyrC dihydroorotase; Validated 100.0
PRK06189433 allantoinase; Provisional 100.0
TIGR03178442 allantoinase allantoinase. This enzyme carries out the 100.0
TIGR02033466 D-hydantoinase dihydropyrimidinase; InterPro: IPR011778 100.0
KOG2902344 consensus 100.0
cd01315447 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (AL 100.0
cd01314447 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimi 100.0
KOG2584522 consensus 100.0
cd01308387 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydroly 99.93
PRK10657384 isoaspartyl dipeptidase; Provisional 99.91
cd01307338 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgr 99.87
PRK12394387 putative metallo-dependent hydrolase; Provisional 99.8
PRK09237384 dihydroorotase; Provisional 99.79
cd01293398 Bact_CD Bacterial cytosine deaminase and related metal- 99.51
cd01295 422 AdeC Adenine deaminase (AdeC) directly deaminates adeni 99.26
PRK07572425 cytosine deaminase; Validated 99.04
PRK09230426 cytosine deaminase; Provisional 99.04
TIGR01975391 isoAsp_dipep beta-aspartyl peptidase; InterPro: IPR0102 99.01
PRK05985398 cytosine deaminase; Provisional 98.87
COG1001 584 AdeC Adenine deaminase [Nucleotide transport and metabo 98.73
COG1574535 Predicted metal-dependent hydrolase with the TIM-barrel 98.53
PRK10027 588 cryptic adenine deaminase; Provisional 98.2
PRK06846410 deaminase; Validated 98.18
PRK09061496 D-glutamate deacylase; Validated 99.97
pfam01979307 Amidohydro_1 Amidohydrolase family. This family of enzy 99.66
cd01292275 metallo-dependent_hydrolases Superfamily of metallo-dep 99.35
PRK07583437 cytosine deaminase; Validated 99.06
PRK06886328 hypothetical protein; Validated 98.77
COG3964386 Predicted amidohydrolase [General function prediction o 98.34
PRK13309572 ureC urease subunit alpha; Reviewed 98.22
cd01310251 TatD_DNAse TatD like proteins; E.coli TatD is a cytopla 98.21
PRK10425258 DNase TatD; Provisional 98.19
PRK10812265 putative metallodependent hydrolase; Provisional 98.12
cd00375567 Urease_alpha Urease alpha-subunit; Urease is a nickel-d 98.09
PRK13206573 ureC urease subunit alpha; Reviewed 98.09
pfam01026255 TatD_DNase TatD related DNase. This family of proteins 98.07
PRK13207568 ureC urease subunit alpha; Reviewed 97.98
PRK13985568 UreB urease subunit beta; Provisional 97.84
PRK13308569 ureC urease subunit alpha; Reviewed 97.82
TIGR01792 605 urease_alph urease, alpha subunit; InterPro: IPR005848 97.76
PRK11449258 putative deoxyribonuclease YjjV; Provisional 97.51
TIGR00010269 TIGR00010 hydrolase, TatD family; InterPro: IPR015991 E 97.29
PRK09875292 putative hydrolase; Provisional 97.11
COG1099254 Predicted metal-dependent hydrolases with the TIM-barre 96.8
COG0804568 UreC Urea amidohydrolase (urease) alpha subunit [Amino 96.7
COG0084256 TatD Mg-dependent DNase [DNA replication, recombination 96.68
TIGR02318391 phosphono_phnM phosphonate metabolism protein PhnM; Int 96.67
pfam02126308 PTE Phosphotriesterase family. 96.25
cd00530293 PTE Phosphotriesterase (PTE) catalyzes the hydrolysis o 95.06
TIGR03583365 EF_0837 probable amidohydrolase EF_0837/AHA_3915. Membe 99.78
cd01298411 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the a 99.62
PRK07228445 N-ethylammeline chlorohydrolase; Provisional 99.35
COG1228406 HutI Imidazolonepropionase and related amidohydrolases 98.9
PRK09228429 guanine deaminase; Provisional 98.85
TIGR03179427 gua_deam guanine deaminase. This enzyme converts guanin 98.8
cd01306325 PhnM PhnM is believed to be a subunit of the membrane a 98.39
COG3454377 Metal-dependent hydrolase involved in phosphonate metab 95.01
cd01297415 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid ami 99.69
PRK08393419 N-ethylammeline chlorohydrolase; Provisional 99.25
PRK06380418 metal-dependent hydrolase; Provisional 99.25
PRK08204451 hypothetical protein; Provisional 99.15
PRK06151480 N-ethylammeline chlorohydrolase; Provisional 99.07
cd01304541 FMDH_A Formylmethanofuran dehydrogenase (FMDH) subunit 99.03
TIGR03121556 one_C_dehyd_A formylmethanofuran dehydrogenase subunit 99.0
PRK08203456 hydroxydechloroatrazine ethylaminohydrolase; Reviewed 98.85
cd00854374 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, 99.56
COG3653 579 N-acyl-D-aspartate/D-glutamate deacylase [Secondary met 98.04
cd01309359 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgr 99.28
KOG3968439 consensus 97.67
cd01296371 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-pro 99.27
cd01299342 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgr 99.25
PRK09356401 imidazolonepropionase; Validated 99.24
cd01300479 YtcJ_like YtcJ_like metal dependent amidohydrolases. Yt 99.18
PRK07213378 chlorohydrolase; Provisional 98.99
PRK12393459 amidohydrolase; Provisional 98.99
cd01303429 GDEase Guanine deaminase (GDEase). Guanine deaminase is 98.94
cd01312381 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgr 98.92
PRK09045444 N-ethylammeline chlorohydrolase; Provisional 98.9
PRK09229457 N-formimino-L-glutamate deiminase; Validated 98.88
pfam07969392 Amidohydro_3 Amidohydrolase family. 98.82
PRK08418407 chlorohydrolase; Provisional 98.78
PRK06687422 chlorohydrolase; Validated 98.69
PRK07203442 putative chlorohydrolase/aminohydrolase; Validated 98.67
TIGR03314441 Se_ssnA putative selenium metabolism protein SsnA. Memb 98.65
COG0402421 SsnA Cytosine deaminase and related metal-dependent hyd 98.34
cd01305263 archeal_chlorohydrolases Predicted chlorohydrolases. Th 96.28
cd00443305 ADA_AMPD Adenosine/AMP deaminase. Adenosine deaminases 92.69
cd01313418 Met_dep_hydrolase_E Metallo-dependent hydrolases, subgr 98.86
PRK06038432 N-ethylammeline chlorohydrolase; Provisional 98.82
TIGR02967426 guan_deamin guanine deaminase; InterPro: IPR014311 This 98.2
PRK11170381 nagA N-acetylglucosamine-6-phosphate deacetylase; Provi 97.19
pfam04909270 Amidohydro_2 Amidohydrolase. These proteins are amidohy 98.48
COG2159293 Predicted metal-dependent hydrolase of the TIM-barrel f 98.04
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enz 91.62
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A membe 91.11
PRK03170292 dihydrodipicolinate synthase; Provisional 90.52
COG4464254 CapC Capsular polysaccharide biosynthesis protein [Carb 91.21
>cd01294 DHOase Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis Back     alignment and domain information
>PRK05451 dihydroorotase; Provisional Back     alignment and domain information
>TIGR00857 pyrC_multi dihydroorotase, multifunctional complex type; InterPro: IPR004722 Dihydroorotase belongs to MEROPS peptidase family M38 (clan MJ), where it is classified as a non-peptidase homologue Back     alignment and domain information
>PRK07369 dihydroorotase; Provisional Back     alignment and domain information
>COG0044 PyrC Dihydroorotase and related cyclic amidohydrolases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09060 dihydroorotase; Validated Back     alignment and domain information
>cd01302 Cyclic_amidohydrolases Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids Back     alignment and domain information
>cd01318 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>PRK09059 dihydroorotase; Validated Back     alignment and domain information
>PRK08417 dihydroorotase; Provisional Back     alignment and domain information
>PRK08044 allantoinase; Provisional Back     alignment and domain information
>PRK07575 dihydroorotase; Provisional Back     alignment and domain information
>COG0418 PyrC Dihydroorotase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04250 dihydroorotase; Provisional Back     alignment and domain information
>cd01316 CAD_DHOase The eukaryotic CAD protein is a trifunctional enzyme of carbamoylphosphate synthetase-aspartate transcarbamoylase-dihydroorotase, which catalyzes the first three steps of de novo pyrimidine nucleotide biosynthesis Back     alignment and domain information
>PRK07627 dihydroorotase; Provisional Back     alignment and domain information
>PRK02382 dihydroorotase; Provisional Back     alignment and domain information
>PRK13404 dihydropyrimidinase; Provisional Back     alignment and domain information
>TIGR00856 pyrC_dimer dihydroorotase, homodimeric type; InterPro: IPR004721 Dihydroorotase belongs to MEROPS peptidase family M38 (clan MJ), where it is classified as a non-peptidase homologue Back     alignment and domain information
>PRK09236 dihydroorotase; Reviewed Back     alignment and domain information
>PRK00369 pyrC dihydroorotase; Provisional Back     alignment and domain information
>cd01317 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>PRK01211 dihydroorotase; Provisional Back     alignment and domain information
>PRK08323 dihydropyrimidinase; Validated Back     alignment and domain information
>PRK09357 pyrC dihydroorotase; Validated Back     alignment and domain information
>PRK06189 allantoinase; Provisional Back     alignment and domain information
>TIGR03178 allantoinase allantoinase Back     alignment and domain information
>TIGR02033 D-hydantoinase dihydropyrimidinase; InterPro: IPR011778 This entry represents the D-hydantoinase (dihydropyrimidinase) which primarily converts 5,6-dihydrouracil to 3-ureidopropanoate but also acts on dihydrothymine and hydantoin Back     alignment and domain information
>KOG2902 consensus Back     alignment and domain information
>cd01315 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>cd01314 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin Back     alignment and domain information
>KOG2584 consensus Back     alignment and domain information
>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid Back     alignment and domain information
>PRK10657 isoaspartyl dipeptidase; Provisional Back     alignment and domain information
>cd01307 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgroup B is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK12394 putative metallo-dependent hydrolase; Provisional Back     alignment and domain information
>PRK09237 dihydroorotase; Provisional Back     alignment and domain information
>cd01293 Bact_CD Bacterial cytosine deaminase and related metal-dependent hydrolases Back     alignment and domain information
>cd01295 AdeC Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine Back     alignment and domain information
>PRK07572 cytosine deaminase; Validated Back     alignment and domain information
>PRK09230 cytosine deaminase; Provisional Back     alignment and domain information
>TIGR01975 isoAsp_dipep beta-aspartyl peptidase; InterPro: IPR010229 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>PRK05985 cytosine deaminase; Provisional Back     alignment and domain information
>COG1001 AdeC Adenine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK10027 cryptic adenine deaminase; Provisional Back     alignment and domain information
>PRK06846 deaminase; Validated Back     alignment and domain information
>PRK09061 D-glutamate deacylase; Validated Back     alignment and domain information
>pfam01979 Amidohydro_1 Amidohydrolase family Back     alignment and domain information
>cd01292 metallo-dependent_hydrolases Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK07583 cytosine deaminase; Validated Back     alignment and domain information
>PRK06886 hypothetical protein; Validated Back     alignment and domain information
>COG3964 Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>PRK13309 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd01310 TatD_DNAse TatD like proteins; E Back     alignment and domain information
>PRK10425 DNase TatD; Provisional Back     alignment and domain information
>PRK10812 putative metallodependent hydrolase; Provisional Back     alignment and domain information
>cd00375 Urease_alpha Urease alpha-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide Back     alignment and domain information
>PRK13206 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>pfam01026 TatD_DNase TatD related DNase Back     alignment and domain information
>PRK13207 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK13985 UreB urease subunit beta; Provisional Back     alignment and domain information
>PRK13308 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>TIGR01792 urease_alph urease, alpha subunit; InterPro: IPR005848 Urease (urea amidohydrolase, 3 Back     alignment and domain information
>PRK11449 putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>TIGR00010 TIGR00010 hydrolase, TatD family; InterPro: IPR015991 Escherichia coli TatD (synonym MttC) has been shown experimentally to be a DNase Back     alignment and domain information
>PRK09875 putative hydrolase; Provisional Back     alignment and domain information
>COG1099 Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>COG0804 UreC Urea amidohydrolase (urease) alpha subunit [Amino acid transport and metabolism] Back     alignment and domain information
>COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02318 phosphono_phnM phosphonate metabolism protein PhnM; InterPro: IPR012696 This family consists of proteins from in the PhnM family Back     alignment and domain information
>pfam02126 PTE Phosphotriesterase family Back     alignment and domain information
>cd00530 PTE Phosphotriesterase (PTE) catalyzes the hydrolysis of organophosphate nerve agents, including the chemical warfare agents VX, soman, and sarin as well as the insecticide paraoxon Back     alignment and domain information
>TIGR03583 EF_0837 probable amidohydrolase EF_0837/AHA_3915 Back     alignment and domain information
>cd01298 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases Back     alignment and domain information
>PRK07228 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>COG1228 HutI Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09228 guanine deaminase; Provisional Back     alignment and domain information
>TIGR03179 gua_deam guanine deaminase Back     alignment and domain information
>cd01306 PhnM PhnM is believed to be a subunit of the membrane associated C-P lyase complex Back     alignment and domain information
>COG3454 Metal-dependent hydrolase involved in phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01297 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics Back     alignment and domain information
>PRK08393 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK06380 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PRK08204 hypothetical protein; Provisional Back     alignment and domain information
>PRK06151 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>cd01304 FMDH_A Formylmethanofuran dehydrogenase (FMDH) subunit A; Methanogenic bacteria and archea derive the energy for autotrophic growth from methanogenesis, the reduction of CO2 with molecular hydrogen as the electron donor Back     alignment and domain information
>TIGR03121 one_C_dehyd_A formylmethanofuran dehydrogenase subunit A Back     alignment and domain information
>PRK08203 hydroxydechloroatrazine ethylaminohydrolase; Reviewed Back     alignment and domain information
>cd00854 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information
>COG3653 N-acyl-D-aspartate/D-glutamate deacylase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd01309 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>KOG3968 consensus Back     alignment and domain information
>cd01296 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK09356 imidazolonepropionase; Validated Back     alignment and domain information
>cd01300 YtcJ_like YtcJ_like metal dependent amidohydrolases Back     alignment and domain information
>PRK07213 chlorohydrolase; Provisional Back     alignment and domain information
>PRK12393 amidohydrolase; Provisional Back     alignment and domain information
>cd01303 GDEase Guanine deaminase (GDEase) Back     alignment and domain information
>cd01312 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK09045 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK09229 N-formimino-L-glutamate deiminase; Validated Back     alignment and domain information
>pfam07969 Amidohydro_3 Amidohydrolase family Back     alignment and domain information
>PRK08418 chlorohydrolase; Provisional Back     alignment and domain information
>PRK06687 chlorohydrolase; Validated Back     alignment and domain information
>PRK07203 putative chlorohydrolase/aminohydrolase; Validated Back     alignment and domain information
>TIGR03314 Se_ssnA putative selenium metabolism protein SsnA Back     alignment and domain information
>COG0402 SsnA Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only] Back     alignment and domain information
>cd01305 archeal_chlorohydrolases Predicted chlorohydrolases Back     alignment and domain information
>cd00443 ADA_AMPD Adenosine/AMP deaminase Back     alignment and domain information
>cd01313 Met_dep_hydrolase_E Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK06038 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>TIGR02967 guan_deamin guanine deaminase; InterPro: IPR014311 This entry describes guanine deaminase, which hydrolyzes guanine to xanthine and ammonia Back     alignment and domain information
>PRK11170 nagA N-acetylglucosamine-6-phosphate deacetylase; Provisional Back     alignment and domain information
>pfam04909 Amidohydro_2 Amidohydrolase Back     alignment and domain information
>COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>COG4464 CapC Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target349 dihydroorotase [Candidatus Liberibacter asiaticus str.
2z24_A347 Thr110ser Dihydroorotase From E. Coli Length = 347 2e-92
2z25_A347 Thr110val Dihydroorotase From E. Coli Length = 347 3e-92
1xge_A347 Dihydroorotase From Escherichia Coli: Loop Movement 3e-92
2z26_A347 Thr110ala Dihydroorotase From E. Coli Length = 347 3e-92
3mjm_A347 His257ala Mutant Of Dihydroorotase From E. Coli Len 4e-92
2e25_A347 The Crystal Structure Of The T109s Mutant Of E. Col 6e-92
2z28_A347 Thr109val Dihydroorotase From E. Coli Length = 347 7e-92
1j79_A347 Molecular Structure Of Dihydroorotase: A Paradigm F 1e-91
2z2a_A347 Thr109gly Dihydroorotase From E. Coli Length = 347 1e-91
2z29_A347 Thr109ala Dihydroorotase From E. Coli Length = 347 2e-91
3ihn_B372 1.8 Angstrom Resolution Crystal Structure Of Dihydr 2e-91
3jze_A372 1.8 Angstrom Resolution Crystal Structure Of Dihydr 5e-91
2z2b_A337 Deletion 107-116 Mutant Of Dihydroorotase From E. C 3e-88
1xrf_A467 The Crystal Structure Of A Novel, Latent Dihydrooro 6e-62
3d6n_A422 Crystal Structure Of Aquifex Dihydroorotase Activat 9e-62
3mpg_A428 Dihydroorotase From Bacillus Anthracis Length = 428 5e-61
3pnu_A359 2.4 Angstrom Crystal Structure Of Dihydroorotase (P 6e-58
3gri_A424 The Crystal Structure Of A Dihydroorotase From Stap 3e-55
3hm7_A448 Crystal Structure Of Allantoinase From Bacillus Hal 7e-40
2z00_A426 Crystal Structure Of Dihydroorotase From Thermus Th 2e-39
1gkr_A458 L-Hydantoinase (Dihydropyrimidinase) From Arthrobac 6e-34
2gwn_A452 The Structure Of Putative Dihydroorotase From Porph 5e-32
1yny_A461 Molecular Structure Of D-Hydantoinase From A Bacill 9e-27
3e74_A473 Crystal Structure Of E. Coli Allantoinase With Iron 2e-25
1k1d_A460 Crystal Structure Of D-Hydantoinase Length = 460 4e-22
3dc8_A490 Crystal Structure Of Dihydropyrimidinase From Sinor 9e-21
2fty_A559 Crystal Structure Of Dihydropyrimidinase From Sacch 2e-18
1gkp_A458 D-Hydantoinase (Dihydropyrimidinase) From Thermus S 4e-18
1nfg_A457 Structure Of D-Hydantoinase Length = 457 1e-15
2vr2_A541 Human Dihydropyrimidinase Length = 541 2e-14
2gse_A501 Crystal Structure Of Human Dihydropyrimidinease-Lik 4e-14
1kcx_A518 X-Ray Structure Of Nysgrc Target T-45 Length = 518 2e-12
2ftw_A521 Crystal Structure Of Dihydropyrimidinase From Dicty 7e-12
>gi|158431307|pdb|2Z24|A Chain A, Thr110ser Dihydroorotase From E. Coli Length = 347 Back     alignment and structure
 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 172/342 (50%), Positives = 233/342 (68%), Gaps = 3/342 (0%)

Query: 4   ISLRVPDDWHLHLRDGEILKTVLRDTAKNFRRALVMPNIDPPIITVDDACAYRQRILNAL 63
           + +R PDDWHLHLRDG++LKTV+  T++ + RA+VMPN+ PP+ TV+ A AYRQRIL+A+
Sbjct: 7   LKIRRPDDWHLHLRDGDMLKTVVPYTSEIYGRAIVMPNLAPPVTTVEAAVAYRQRILDAV 66

Query: 64  PPEYDFSPLMTIYLTETTDPDDVEKGFTSQLVQAIKLYFAGSTTNSHHGIRNIDRVMPVL 123
           P  +DF+PLMT YLT++ DP+++E+GF   +  A  LY A +T+NS HG+ ++D +MPVL
Sbjct: 67  PAGHDFTPLMTCYLTDSLDPNELERGFNEGVFTAAXLYPANATSNSSHGVTSVDAIMPVL 126

Query: 124 ERMETIGMPLCIHGEILNQDIDIFDRELMFIDKILDPLRNKLPNLKIILEHITTSNGIDY 183
           ERME IGMPL +HGE+ + DIDIFDRE  FI+ +++PLR +L  LK++ EHITT +  DY
Sbjct: 127 ERMEKIGMPLLVHGEVTHADIDIFDREARFIESVMEPLRQRLTALKVVFEHITTKDAADY 186

Query: 184 VNNAT-NIAGSITVHHLIINRNAIFHDGLNPHYYCLPIPKREKHRLSLRKAALSGNPRFF 242
           V +    +A +IT  HL+ NRN +   G+ PH YCLPI KR  H+ +LR+   SG  R F
Sbjct: 187 VRDGNERLAATITPQHLMFNRNHMLVGGVRPHLYCLPILKRNIHQQALRELVASGFNRVF 246

Query: 243 LGTDSAPHWDSSKESSCGCAGIYTARNALNCLAQIFEEENKLENLESFVSINGATWYGIP 302
           LGTDSAPH    KESSCGCAG + A  AL   A +FEE N L++ E+F S+NG  +YG+P
Sbjct: 247 LGTDSAPHARHRKESSCGCAGCFNAPTALGSYATVFEEMNALQHFEAFCSVNGPQFYGLP 306

Query: 303 VNTRKISLKRREQPIIFDEKITTSTGSITIFNPIFPLYWEVM 344
           VN   I L R EQ     E I  +  ++  F     + W V 
Sbjct: 307 VNDTFIELVREEQQ--VAESIALTDDTLVPFLAGETVRWSVK 346


>gi|158431309|pdb|2Z25|A Chain A, Thr110val Dihydroorotase From E. Coli Length = 347 Back     alignment and structure
>gi|66360533|pdb|1XGE|A Chain A, Dihydroorotase From Escherichia Coli: Loop Movement And Cooperativity Between Subunits Length = 347 Back     alignment and structure
>gi|158431311|pdb|2Z26|A Chain A, Thr110ala Dihydroorotase From E. Coli Length = 347 Back     alignment and structure
>gi|325053903|pdb|3MJM|A Chain A, His257ala Mutant Of Dihydroorotase From E. Coli Length = 347 Back     alignment and structure
>gi|145579291|pdb|2E25|A Chain A, The Crystal Structure Of The T109s Mutant Of E. Coli Dihydroorotase Complexed With An Inhibitor 5-Fluoroorotate Length = 347 Back     alignment and structure
>gi|158431315|pdb|2Z28|A Chain A, Thr109val Dihydroorotase From E. Coli Length = 347 Back     alignment and structure
>gi|14719683|pdb|1J79|A Chain A, Molecular Structure Of Dihydroorotase: A Paradigm For Catalysis Through The Use Of A Binuclear Metal Center Length = 347 Back     alignment and structure
>gi|158431319|pdb|2Z2A|A Chain A, Thr109gly Dihydroorotase From E. Coli Length = 347 Back     alignment and structure
>gi|158431317|pdb|2Z29|A Chain A, Thr109ala Dihydroorotase From E. Coli Length = 347 Back     alignment and structure
>gi|260100238|pdb|3JZE|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Dihydroorotase (Pyrc) From Salmonella Enterica Subsp. Enterica Serovar Typhimurium Str. Lt2 Length = 372 Back     alignment and structure
>gi|158431321|pdb|2Z2B|A Chain A, Deletion 107-116 Mutant Of Dihydroorotase From E. Coli Length = 337 Back     alignment and structure
>gi|73536332|pdb|1XRF|A Chain A, The Crystal Structure Of A Novel, Latent Dihydroorotase From Aquifex Aeolicus At 1.7 A Resolution Length = 467 Back     alignment and structure
gi|221046673|pdb|3D6N|A Chain A, Crystal Structure Of Aquifex Dihydroorotase Activated By Aspartate Transcarbamoylase Length = 422 Back     alignment and structure
gi|311772131|pdb|3MPG|A Chain A, Dihydroorotase From Bacillus Anthracis Length = 428 Back     alignment and structure
>gi|313103984|pdb|3PNU|A Chain A, 2.4 Angstrom Crystal Structure Of Dihydroorotase (Pyrc) From Campylobacter Jejuni. Length = 359 Back     alignment and structure
>gi|237823988|pdb|3GRI|A Chain A, The Crystal Structure Of A Dihydroorotase From Staphylococcus Aureus Length = 424 Back     alignment and structure
>gi|239782181|pdb|3HM7|A Chain A, Crystal Structure Of Allantoinase From Bacillus Halodurans C-125 Length = 448 Back     alignment and structure
>gi|160286286|pdb|2Z00|A Chain A, Crystal Structure Of Dihydroorotase From Thermus Thermophilus Length = 426 Back     alignment and structure
>gi|22218649|pdb|1GKR|A Chain A, L-Hydantoinase (Dihydropyrimidinase) From Arthrobacter Aurescens Length = 458 Back     alignment and structure
>gi|109158122|pdb|2GWN|A Chain A, The Structure Of Putative Dihydroorotase From Porphyromonas Gingivalis Length = 452 Back     alignment and structure