254781013

254781013

phage-associated protein

GeneID in NCBI database:8210036Locus tag:CLIBASIA_04575
Protein GI in NCBI database:254781013Protein Accession:YP_003065426.1
Gene range:-(1013239, 1014147)Protein Length:302aa
Gene description:phage-associated protein
COG prediction:[S] Uncharacterized phage-associated protein
KEGG prediction:phage-associated protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFWVTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGKGLFGVHNDTQP
ccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccHHcccccEEHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHccccccccccccHHHHHHHHccccccHHHHHHHHHccHHHccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccccccc
ccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccHHccccccHHHHHHHHHccccccccHcccccEcccccccHHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHEccccccccccccHHHHHHHHccccccHHHHHHHHcccEEEccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHEEEHEHHHHHHHHHHHHHccccccccccccc
mkkrtftqtnppystIAVANFFIdkgvkysipidhlKIQQFIYLTHCDVVLQKKKsmldeepqawkqgpvfvGVYHrfkyfdshpievIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWrrlydpndpntnrtiTVEEITkmadgsnispenvveqikkpvrfdsdsefATLESQLVkgfksmppqltKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFWVTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGkglfgvhndtqp
mkkrtftqtnppystiAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKtwrrlydpndpntnrTITVEEITkmadgsnispenvVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFWVTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGKGLFGVHNDTQP
MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFwvtivwitiivAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGKGLFGVHNDTQP
*************STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLY*********TITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTK**********************NIMRFAYSNRSFWVTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGKGLFGVH*****
********TNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFWVTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGKGLFGVHNDTQP
*****F**TNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFWVTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGKGLFGVH*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFWVTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGKGLFGVHNDTQP
MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFWVTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGKGLFGVHNDTQP
MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFWVTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGKGLFGVHNDTQP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target302 phage-associated protein [Candidatus Liberibacter asiat
294502072170 phage-associated protein [Salinibacter ruber M8] Length 1 3e-11
260910168174 phage protein [Prevotella sp. oral taxon 472 str. F0295 1 3e-09
262381010169 conserved hypothetical protein [Bacteroides sp. 2_1_33B 1 7e-09
146302603149 phage-associated protein [Flavobacterium johnsoniae UW1 1 3e-08
121608301161 hypothetical protein Veis_1323 [Verminephrobacter eisen 1 6e-08
291458021156 putative prophage protein [Oribacterium sp. oral taxon 1 4e-07
16127745188 hypothetical protein CC_3515 [Caulobacter crescentus CB 1 6e-07
229588705164 hypothetical protein PFLU1166 [Pseudomonas fluorescens 1 7e-07
307271322182 hypothetical protein HMPREF9514_00077 [Enterococcus fae 1 9e-07
71274687173 similar to Uncharacterized phage-associated protein [Xy 1 1e-06
>gi|294502072|ref|YP_003566137.1| phage-associated protein [Salinibacter ruber M8] Length = 170 Back     alignment and organism information
 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 76/149 (51%), Gaps = 8/149 (5%)

Query: 9   TNPPYSTIAVANFFIDKGVKYSI--PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
           ++PPY  +AVANFFID  V+     P+  LK+Q+ +Y+ H   +    + ++ E  +AW+
Sbjct: 2   SSPPYPAVAVANFFIDTAVEDPDVGPVTQLKLQKLVYIAHGWHLAIYDEHLIKEPVEAWE 61

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMD-LSFRIFPKI-----ANQEIGEIMESIWNKYQSHS 120
            GPV   +Y R   + S PI   +D  S R  P++     +++     + S+W  Y+ +S
Sbjct: 62  FGPVVRDLYSRAGDYGSDPISDRLDGTSSRSAPELLEIPSSDERTRNFLRSVWQTYREYS 121

Query: 121 TEQLQEIVQEENKTWRRLYDPNDPNTNRT 149
             +L  I  +E+  W   ++      N+T
Sbjct: 122 AVELTSITHKEDTPWYDTWERRGGKENKT 150


Species: Salinibacter ruber
Genus: Salinibacter
Family: Rhodothermaceae
Order: Sphingobacteriales
Class: Sphingobacteria
Phylum: Bacteroidetes
Superkingdom: Bacteria
>gi|260910168|ref|ZP_05916845.1| phage protein [Prevotella sp. oral taxon 472 str. F0295] Length = 174 Back     alignment and organism information
>gi|262381010|ref|ZP_06074148.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B] Length = 169 Back     alignment and organism information
>gi|146302603|ref|YP_001197194.1| phage-associated protein [Flavobacterium johnsoniae UW101] Length = 149 Back     alignment and organism information
>gi|121608301|ref|YP_996108.1| hypothetical protein Veis_1323 [Verminephrobacter eiseniae EF01-2] Length = 161 Back     alignment and organism information
>gi|291458021|ref|ZP_06597411.1| putative prophage protein [Oribacterium sp. oral taxon 078 str. F0262] Length = 156 Back     alignment and organism information
>gi|16127745|ref|NP_422309.1| hypothetical protein CC_3515 [Caulobacter crescentus CB15] Length = 188 Back     alignment and organism information
>gi|229588705|ref|YP_002870824.1| hypothetical protein PFLU1166 [Pseudomonas fluorescens SBW25] Length = 164 Back     alignment and organism information
>gi|307271322|ref|ZP_07552601.1| hypothetical protein HMPREF9514_00077 [Enterococcus faecalis TX0855] Length = 182 Back     alignment and organism information
>gi|71274687|ref|ZP_00650975.1| similar to Uncharacterized phage-associated protein [Xylella fastidiosa Dixon] Length = 173 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target302 phage-associated protein [Candidatus Liberibacter asiat
COG3600154 COG3600, GepA, Uncharacterized phage-associated protein 1e-13
>gnl|CDD|33400 COG3600, GepA, Uncharacterized phage-associated protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 302 phage-associated protein [Candidatus Liberibacter asiat
COG3600154 GepA Uncharacterized phage-associated protein [Function 100.0
>COG3600 GepA Uncharacterized phage-associated protein [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00