254781014

254781014

hypothetical protein CLIBASIA_04580

GeneID in NCBI database:8210037Locus tag:CLIBASIA_04580
Protein GI in NCBI database:254781014Protein Accession:YP_003065427.1
Gene range:-(1014403, 1014753)Protein Length:116aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMTATSGTVGYASNLCNAKPEICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYPPPLPSHH
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcEEEEEccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccEEEccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccc
MFWIAKKFFWISVLLIVLSNvyaqpfleetekgkkTEITDfmtatsgtvgyasnlcnakpeICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESvaihskneyppplpshh
MFWIAKKFFWISVLLIVLSNVYAQPFLeetekgkkteITDFMTATSGTVGYASNLCNAKPEICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNEREsvaihskneyppplpshh
MFWIAKKFFWISVLLIVLSNVYAQPFLeetekgkkteitDFMTATSGTVGYASNLCNAKPEICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYPPPLPSHH
MFWIAKKFFWISVLLIVLS*********************FMTATSGTVGYASNLCNAKPEICLLWKKIMRNVKRHTLNGAKIVYGF*****************************
MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMTATSGTVGYASNLCNAKPEICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYPPPLPSHH
MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMTATSGTVGYASNLCNAKPEICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYPPPL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMTATSGTVGYASNLCNAKPEICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYPPPLPSHH
MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMTATSGTVGYASNLCNAKPEICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYPPPLPSHH
MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMTATSGTVGYASNLCNAKPEICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYPPPLPSHH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target116 hypothetical protein CLIBASIA_04580 [Candidatus Liberib
315122515108 hypothetical protein CKC_03835 [Candidatus Liberibacter 1 1e-26
209548486164 hypothetical protein Rleg2_0883 [Rhizobium leguminosaru 1 8e-07
222085299153 hypothetical protein Arad_1477 [Agrobacterium radiobact 1 4e-06
116251149164 hypothetical protein RL1381 [Rhizobium leguminosarum bv 1 5e-06
241203747164 hypothetical protein Rleg_1009 [Rhizobium leguminosarum 1 5e-06
86356891162 hypothetical protein RHE_CH01251 [Rhizobium etli CFN 42 1 3e-05
190890964164 hypothetical protein RHECIAT_CH0001347 [Rhizobium etli 1 4e-05
218671799164 hypothetical protein RetlG_09167 [Rhizobium etli GR56] 1 5e-05
218663388219 hypothetical protein RetlI_30803 [Rhizobium etli IE4771 1 5e-05
222147977154 hypothetical protein Avi_1303 [Agrobacterium vitis S4] 1 6e-05
>gi|315122515|ref|YP_004063004.1| hypothetical protein CKC_03835 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 108 Back     alignment and organism information
 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 77/107 (71%)

Query: 1   MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMTATSGTVGYASNLCNAKP 60
           MF+I KK FWIS+  IV+SN+Y +  LE T++  +TEI D ++ TSGT+ YASN+CN KP
Sbjct: 1   MFFIFKKVFWISLFFIVISNLYPENSLENTKQNAETEIKDIISLTSGTISYASNICNEKP 60

Query: 61  EICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNE 107
           E+C LW+K   N K+HTL GAKI Y FAKS L+KNE +S    SK +
Sbjct: 61  ELCSLWEKNFYNFKKHTLKGAKITYKFAKSILKKNEEKSSEFISKQQ 107


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209548486|ref|YP_002280403.1| hypothetical protein Rleg2_0883 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 164 Back     alignment and organism information
>gi|222085299|ref|YP_002543829.1| hypothetical protein Arad_1477 [Agrobacterium radiobacter K84] Length = 153 Back     alignment and organism information
>gi|116251149|ref|YP_766987.1| hypothetical protein RL1381 [Rhizobium leguminosarum bv. viciae 3841] Length = 164 Back     alignment and organism information
>gi|241203747|ref|YP_002974843.1| hypothetical protein Rleg_1009 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 164 Back     alignment and organism information
>gi|86356891|ref|YP_468783.1| hypothetical protein RHE_CH01251 [Rhizobium etli CFN 42] Length = 162 Back     alignment and organism information
>gi|190890964|ref|YP_001977506.1| hypothetical protein RHECIAT_CH0001347 [Rhizobium etli CIAT 652] Length = 164 Back     alignment and organism information
>gi|218671799|ref|ZP_03521468.1| hypothetical protein RetlG_09167 [Rhizobium etli GR56] Length = 164 Back     alignment and organism information
>gi|218663388|ref|ZP_03519318.1| hypothetical protein RetlI_30803 [Rhizobium etli IE4771] Length = 219 Back     alignment and organism information
>gi|222147977|ref|YP_002548934.1| hypothetical protein Avi_1303 [Agrobacterium vitis S4] Length = 154 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00