254781015
hypothetical protein CLIBASIA_04585
| GeneID in NCBI database: | 8210038 | Locus tag: | CLIBASIA_04585 |
| Protein GI in NCBI database: | 254781015 | Protein Accession: | YP_003065428.1 |
| Gene range: | +(1015365, 1015601) | Protein Length: | 78aa |
| Gene description: | hypothetical protein | ||
| COG prediction: | none | ||
| KEGG prediction: | hypothetical protein | ||
| SEED prediction: | hypothetical protein | ||
| Pathway involved in KEGG: | not defined | ||
| Subsystem involved in SEED: | - none - | ||
| sequence | sequence profile | ||
Prediction of Local Sequence Properties
| Source | Summary | Result |
|---|
|
|
Close Homologs Detected by BLAST or PSI-BLAST
Homolog within the Genome Detected by BLAST
Original result of BLAST against C. L. asiaticus genome
No hits with e-value below 0.05
Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations
Original result of PSI-BLAST first 2 iterations
| Identity | Alignment graph | Length | Definition | Round | E-value |
| Target | 78 | hypothetical protein CLIBASIA_04585 [Candidatus Liberib | |||
| 315122514 | 138 | hypothetical protein CKC_03830 [Candidatus Liberibacter | 1 | 3e-16 | |
| 218674837 | 318 | putative peptidoglycan binding (cell wall degradation) | 1 | 2e-05 | |
| 327193899 | 318 | putative peptidoglycan binding (cell wall degradation) | 1 | 1e-04 | |
| 218508965 | 272 | putative peptidoglycan binding (cell wall degradation) | 1 | 1e-04 | |
| 190890966 | 318 | peptidoglycan binding (cell wall degradation) protein [ | 1 | 1e-04 | |
| 209548488 | 307 | peptidoglycan-binding protein [Rhizobium leguminosarum | 1 | 1e-04 | |
| 116251151 | 317 | peptidoglycan binding transmembrane protein [Rhizobium | 1 | 2e-04 | |
| 241203749 | 317 | peptidoglycan-binding domain 1 protein [Rhizobium legum | 1 | 2e-04 | |
| 86356893 | 296 | putative peptidoglycan-binding protein (cell wall degra | 1 | 4e-04 | |
| 218661838 | 318 | putative peptidoglycan binding (cell wall degradation) | 1 | 6e-04 |
| >gi|315122514|ref|YP_004063003.1| hypothetical protein CKC_03830 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 138 | Back alignment and organism information |
|---|
Score = 88.2 bits (217), Expect = 3e-16, Method: Compositional matrix adjust.
Identities = 44/79 (55%), Positives = 56/79 (70%), Gaps = 3/79 (3%)
Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGS---GSEVSKDKGITFKVEKVGDQ 59
+ F WIL NALWNQ GKHPSPIFTTRH QS RI LGS + ++K +TFKV+++GD+
Sbjct: 40 VIFLWILFNALWNQKGKHPSPIFTTRHSQSNRIILGSNHNSKDFFQEKSMTFKVKRMGDR 99
Query: 60 HNKILLKEYSSDNNNNKKL 78
++ ILL + SS N K L
Sbjct: 100 YDTILLHDSSSVEKNKKLL 118
|
Species: Candidatus Liberibacter solanacearum Genus: Candidatus Liberibacter Family: Rhizobiaceae Order: Rhizobiales Class: Alphaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|218674837|ref|ZP_03524506.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli GR56] Length = 318 | Back alignment and organism information |
|---|
| >gi|327193899|gb|EGE60774.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli CNPAF512] Length = 318 | Back alignment and organism information |
|---|
| >gi|218508965|ref|ZP_03506843.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli Brasil 5] Length = 272 | Back alignment and organism information |
|---|
| >gi|190890966|ref|YP_001977508.1| peptidoglycan binding (cell wall degradation) protein [Rhizobium etli CIAT 652] Length = 318 | Back alignment and organism information |
|---|
| >gi|209548488|ref|YP_002280405.1| peptidoglycan-binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 307 | Back alignment and organism information |
|---|
| >gi|116251151|ref|YP_766989.1| peptidoglycan binding transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 317 | Back alignment and organism information |
|---|
| >gi|241203749|ref|YP_002974845.1| peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 317 | Back alignment and organism information |
|---|
| >gi|86356893|ref|YP_468785.1| putative peptidoglycan-binding protein (cell wall degradation activity) [Rhizobium etli CFN 42] Length = 296 | Back alignment and organism information |
|---|
| >gi|218661838|ref|ZP_03517768.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli IE4771] Length = 318 | Back alignment and organism information |
|---|
Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch
Conserved Domains in CDD Database Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Original result of RPS-BLAST against CDD database part II
No hit with e-value below 0.005
Conserved Domains in CDD Database Detected by HHsearch
Original result of HHsearch against CDD database
No hit with probability above 90.00
Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch
Homologous Structures Detected by PSI-BLAST against Nonredundant Database
No homologous structure with e-value below 0.005
Homologous Structures in PDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Homologous Structures in PDB70 Database Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 90.00
Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch
Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 90.00
Homologous Domains in MMDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against MMDB70 database
No hit with e-value below 0.005
Homologous Domains in MMDB70 Database Detected by HHsearch
Original result of HHsearch against MMDB70 database
No hit with probability higher than 90.00