254781015

254781015

hypothetical protein CLIBASIA_04585

GeneID in NCBI database:8210038Locus tag:CLIBASIA_04585
Protein GI in NCBI database:254781015Protein Accession:YP_003065428.1
Gene range:+(1015365, 1015601)Protein Length:78aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------
MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQHNKILLKEYSSDNNNNKKL
ccEEEEHHHHHHHHHHcccccccEEEcccccEEEEEEEccccccccccEEEEEEEccccccEEEEEEEcccccccccc
ccHHHHHHHHHHHHHcccccccccEEcccccccEEEEcccccccccccEEEEEEEccccccHEHEEEEcccccccccc
MFLFFCWILSNalwnqtgkhpspifttrhpqsyriflgsgsevskdkgitfkvekVGDQHNKILLKEyssdnnnnkkl
MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLgsgsevskdKGITFkvekvgdqhnkillkeyssdnnnnkkl
MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQHNKILLKEYSSDNNNNKKL
MFLFFCWILSNALWNQTGKHPSPIFTTRHPQS*****************TFKVEKVGDQHNK****************
MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQHNKILLKEYSS********
MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQHNKILLKEYSS********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQHNKILLKEYSSDNNNNKKL
MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQHNKILLKEYSSDNNNNKKL
MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQHNKILLKEYSSDNNNNKKL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target78 hypothetical protein CLIBASIA_04585 [Candidatus Liberib
315122514138 hypothetical protein CKC_03830 [Candidatus Liberibacter 1 3e-16
218674837 318 putative peptidoglycan binding (cell wall degradation) 1 2e-05
327193899 318 putative peptidoglycan binding (cell wall degradation) 1 1e-04
218508965 272 putative peptidoglycan binding (cell wall degradation) 1 1e-04
190890966 318 peptidoglycan binding (cell wall degradation) protein [ 1 1e-04
209548488 307 peptidoglycan-binding protein [Rhizobium leguminosarum 1 1e-04
116251151 317 peptidoglycan binding transmembrane protein [Rhizobium 1 2e-04
241203749 317 peptidoglycan-binding domain 1 protein [Rhizobium legum 1 2e-04
86356893 296 putative peptidoglycan-binding protein (cell wall degra 1 4e-04
218661838 318 putative peptidoglycan binding (cell wall degradation) 1 6e-04
>gi|315122514|ref|YP_004063003.1| hypothetical protein CKC_03830 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 138 Back     alignment and organism information
 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/79 (55%), Positives = 56/79 (70%), Gaps = 3/79 (3%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGS---GSEVSKDKGITFKVEKVGDQ 59
           + F WIL NALWNQ GKHPSPIFTTRH QS RI LGS     +  ++K +TFKV+++GD+
Sbjct: 40  VIFLWILFNALWNQKGKHPSPIFTTRHSQSNRIILGSNHNSKDFFQEKSMTFKVKRMGDR 99

Query: 60  HNKILLKEYSSDNNNNKKL 78
           ++ ILL + SS   N K L
Sbjct: 100 YDTILLHDSSSVEKNKKLL 118


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218674837|ref|ZP_03524506.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli GR56] Length = 318 Back     alignment and organism information
>gi|327193899|gb|EGE60774.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli CNPAF512] Length = 318 Back     alignment and organism information
>gi|218508965|ref|ZP_03506843.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli Brasil 5] Length = 272 Back     alignment and organism information
>gi|190890966|ref|YP_001977508.1| peptidoglycan binding (cell wall degradation) protein [Rhizobium etli CIAT 652] Length = 318 Back     alignment and organism information
>gi|209548488|ref|YP_002280405.1| peptidoglycan-binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 307 Back     alignment and organism information
>gi|116251151|ref|YP_766989.1| peptidoglycan binding transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 317 Back     alignment and organism information
>gi|241203749|ref|YP_002974845.1| peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 317 Back     alignment and organism information
>gi|86356893|ref|YP_468785.1| putative peptidoglycan-binding protein (cell wall degradation activity) [Rhizobium etli CFN 42] Length = 296 Back     alignment and organism information
>gi|218661838|ref|ZP_03517768.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli IE4771] Length = 318 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00