254781016

254781016

diphosphomevalonate decarboxylase/isopentenyl-diphosphate delta-isomerase

GeneID in NCBI database:8210039Locus tag:CLIBASIA_04590
Protein GI in NCBI database:254781016Protein Accession:YP_003065429.1
Gene range:-(1016383, 1017450)Protein Length:355aa
Gene description:diphosphomevalonate decarboxylase/isopentenyl-diphosphate delta-isomerase
COG prediction:[I] Mevalonate pyrophosphate decarboxylase
KEGG prediction:mvaD; diphosphomevalonate decarboxylase/isopentenyl-diphosphate delta-isomerase; K01597 diphosphomevalonate decarboxylase [EC:4.1.1.33]
SEED prediction:Diphosphomevalonate decarboxylase (EC 4.1.1.33)
Pathway involved in KEGG:Terpenoid backbone biosynthesis [PATH:las00900]
Subsystem involved in SEED:Isoprenoid Biosynthesis;
Mevalonate Branch of Isoprenoid Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----
MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK
cccHHHHHHHHHHcccccccccEEEEEEcccEEEEEEcccccccccccccccEEEEEcccccEEEEEEccccccEEEEccEEccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHccEEEEccccccccccEEEEEccccccccEEEEEEEccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHcccEEEEEEccccEEEEEEccccHHHHHHHccccEEEEccccccccccccHHcccccEEccccc
cccccHHHHHHHHHHHccccccccEEccccHEEEEEEcccccHHHcccccccEEEEHcccccEEEEEEccccccEEEEcccEcccccHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccHHcccccEEEcccccccccccccccccccccccEEEEEEEccccccccccHccHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccEcccHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEEccccHHHHHHHHHHHcEEccccccccEEcccHHHHHHHHHHHccc
MSLSLRHILHRYIGecnpkinekssaflpsNIALCKywgkrdsklnlplnnslslslghlgtithitvidsdadciilngqkissqssFFKKTTQFCDLFRQFSKVYFLIEtsnniptkaglassasGFAALTLALFRIysipeksesLSRVARLGSGSACRSFYRGFCEWicgtdqngmdsfavpfnnqwpdLRIGLLKIIDREkkigsreameitrhhspfftqwTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMiaasppllywQKETIQGMERVWDARqqsipiyftldagpnlklLFTHKIEETIKQffpeitiidpldspdlwstkdslsqknsielgisk
MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLwstkdslsqknsielgisk
MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKlnlplnnslslslGHLGTITHITVIDSDADCIILNGqkissqssffkkttqfCDLFRQFSKVYFLIETSNNIPTKaglassasgfaaltlalfRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK
*********HRYIGECN**INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIID***************HHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLW******************
MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK
*SLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK
MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK
MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target355 diphosphomevalonate decarboxylase/isopentenyl-diphospha
315122513351 diphosphomevalonate decarboxylase/isopentenyl-diphospha 1 1e-166
89094695334 diphosphomevalonate decarboxylase [Oceanospirillum sp. 1 5e-86
212212910 503 diphosphomevalonate decarboxylase [Coxiella burnetii Cb 1 6e-77
154707588 503 diphosphomevalonate decarboxylase [Coxiella burnetii Du 1 8e-77
29653945 503 diphosphomevalonate decarboxylase/isopentenyl-diphospha 1 1e-76
78486075332 diphosphomevalonate decarboxylase [Thiomicrospira cruno 1 2e-76
146329706328 diphosphomevalonate decarboxylase [Dichelobacter nodosu 1 2e-76
153207695 503 diphosphomevalonate decarboxylase/isopentenyl-diphospha 1 2e-76
161831576 503 diphosphomevalonate decarboxylase/isopentenyl-diphospha 1 1e-75
254513287341 diphosphomevalonate decarboxylase [Rhodobacteraceae bac 1 1e-68
>gi|315122513|ref|YP_004063002.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate delta-isomerase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 351 Back     alignment and organism information
 Score =  589 bits (1519), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 277/347 (79%), Positives = 307/347 (88%)

Query: 1   MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL 60
           M LSLRHIL  Y+G+C+P+IN+K SAFLPSNIALCKYWGKRD KLNLPLNNSLSLSLG L
Sbjct: 1   MPLSLRHILRIYLGKCSPQINKKGSAFLPSNIALCKYWGKRDEKLNLPLNNSLSLSLGRL 60

Query: 61  GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA 120
           GT+T ITVI+++ DCIILNGQK+S QS FFKKTTQFCDLFRQF KVYFLIET NNIPTKA
Sbjct: 61  GTLTEITVINANEDCIILNGQKVSPQSDFFKKTTQFCDLFRQFEKVYFLIETFNNIPTKA 120

Query: 121 GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           GLASSASGFAALTLALFR+YS+PE  E+LSRVARLGSGSACRSFYRGFCEWICGTD NG+
Sbjct: 121 GLASSASGFAALTLALFRLYSLPEHIETLSRVARLGSGSACRSFYRGFCEWICGTDPNGI 180

Query: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
           DSFA+P  NQWPDLRIGLL II+ EKKIGSREAMEITRH SPFFTQW QQI  D AHIKQ
Sbjct: 181 DSFAIPLKNQWPDLRIGLLNIIETEKKIGSREAMEITRHSSPFFTQWNQQIPVDFAHIKQ 240

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL 300
           AI+DQDFIKLGEV+E NALKMHATM+ ASP +LYWQ+ETI+GM+RVW+ARQ+SIPIYFTL
Sbjct: 241 AIVDQDFIKLGEVSENNALKMHATMLTASPSILYWQEETIKGMQRVWNARQKSIPIYFTL 300

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKN 347
           DAGPNLK LFTH  EE I++ FPEI +I+PLDSP+L S KD     N
Sbjct: 301 DAGPNLKFLFTHDKEEIIRENFPEIMVINPLDSPNLQSNKDDFQLGN 347


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|89094695|ref|ZP_01167631.1| diphosphomevalonate decarboxylase [Oceanospirillum sp. MED92] Length = 334 Back     alignment and organism information
>gi|212212910|ref|YP_002303846.1| diphosphomevalonate decarboxylase [Coxiella burnetii CbuG_Q212] Length = 503 Back     alignment and organism information
>gi|154707588|ref|YP_001424026.1| diphosphomevalonate decarboxylase [Coxiella burnetii Dugway 5J108-111] Length = 503 Back     alignment and organism information
>gi|29653945|ref|NP_819637.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate delta-isomerase [Coxiella burnetii RSA 493] Length = 503 Back     alignment and organism information
>gi|78486075|ref|YP_392000.1| diphosphomevalonate decarboxylase [Thiomicrospira crunogena XCL-2] Length = 332 Back     alignment and organism information
>gi|146329706|ref|YP_001209416.1| diphosphomevalonate decarboxylase [Dichelobacter nodosus VCS1703A] Length = 328 Back     alignment and organism information
>gi|153207695|ref|ZP_01946342.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate delta-isomerase [Coxiella burnetii 'MSU Goat Q177'] Length = 503 Back     alignment and organism information
>gi|161831576|ref|YP_001596532.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate delta-isomerase [Coxiella burnetii RSA 331] Length = 503 Back     alignment and organism information
>gi|254513287|ref|ZP_05125352.1| diphosphomevalonate decarboxylase [Rhodobacteraceae bacterium KLH11] Length = 341 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target355 diphosphomevalonate decarboxylase/isopentenyl-diphospha
TIGR01240305 TIGR01240, mevDPdecarb, diphosphomevalonate decarboxyla 1e-71
KOG2833395 KOG2833, KOG2833, KOG2833, Mevalonate pyrophosphate dec 2e-53
PLN02407343 PLN02407, PLN02407, diphosphomevalonate decarboxylase 6e-50
COG3407329 COG3407, MVD1, Mevalonate pyrophosphate decarboxylase [ 4e-70
pfam0028867 pfam00288, GHMP_kinases_N, GHMP kinases N terminal doma 5e-07
COG1685278 COG1685, COG1685, Archaeal shikimate kinase [Amino acid 5e-04
COG1577307 COG1577, ERG12, Mevalonate kinase [Lipid metabolism] 8e-04
COG0083299 COG0083, ThrB, Homoserine kinase [Amino acid transport 0.004
>gnl|CDD|130307 TIGR01240, mevDPdecarb, diphosphomevalonate decarboxylase Back     alignment and domain information
>gnl|CDD|38044 KOG2833, KOG2833, KOG2833, Mevalonate pyrophosphate decarboxylase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178029 PLN02407, PLN02407, diphosphomevalonate decarboxylase Back     alignment and domain information
>gnl|CDD|33213 COG3407, MVD1, Mevalonate pyrophosphate decarboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|144028 pfam00288, GHMP_kinases_N, GHMP kinases N terminal domain Back     alignment and domain information
>gnl|CDD|31871 COG1685, COG1685, Archaeal shikimate kinase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|31765 COG1577, ERG12, Mevalonate kinase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|30432 COG0083, ThrB, Homoserine kinase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 355 diphosphomevalonate decarboxylase/isopentenyl-diphospha
TIGR01240325 mevDPdecarb diphosphomevalonate decarboxylase; InterPro 100.0
KOG2833395 consensus 100.0
COG3407329 MVD1 Mevalonate pyrophosphate decarboxylase [Lipid meta 100.0
COG0083299 ThrB Homoserine kinase [Amino acid transport and metabo 99.7
PRK01212293 homoserine kinase; Provisional 99.65
PRK00128281 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; 99.4
PTZ00299336 homoserine kinase; Provisional 99.4
PRK04344284 consensus 99.35
PRK03188299 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Prov 99.35
PRK03926302 mevalonate kinase; Provisional 99.32
TIGR00191359 thrB homoserine kinase; InterPro: IPR000870 Saccharomyc 99.23
PRK03817351 galactokinase; Provisional 99.18
PRK02534308 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Prov 99.18
PRK00555363 galactokinase; Provisional 98.88
PRK05322387 galactokinase; Provisional 98.73
PRK05905258 hypothetical protein; Provisional 98.69
PRK03009287 consensus 98.64
COG0153390 GalK Galactokinase [Carbohydrate transport and metaboli 98.61
PRK04943288 consensus 98.59
PRK00343279 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; 98.49
PRK00650288 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Prov 98.46
PRK04648295 consensus 98.44
COG1947289 IspE 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosph 98.44
PRK05101382 galactokinase; Provisional 98.44
TIGR01220367 Pmev_kin_Gr_pos phosphomevalonate kinase; InterPro: IPR 98.42
PRK01726312 consensus 98.4
PRK03288283 consensus 98.19
COG3890337 ERG8 Phosphomevalonate kinase [Lipid metabolism] 94.48
TIGR00144337 beta_RFAP_syn beta-ribofuranosylaminobenzene 5'-phospha 91.56
PRK01123283 shikimate kinase; Provisional 99.57
COG1577307 ERG12 Mevalonate kinase [Lipid metabolism] 99.29
COG1685278 Archaeal shikimate kinase [Amino acid transport and met 98.95
TIGR01920273 Shik_kin_archae shikimate kinase; InterPro: IPR010189 S 98.94
COG1907312 Predicted archaeal sugar kinases [General function pred 98.67
TIGR00154322 ispE 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; 97.69
PTZ00298328 mevalonate kinase; Provisional 99.4
PRK13412974 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransf 98.7
COG2605333 Predicted kinase related to galactokinase and mevalonat 98.61
KOG1537355 consensus 95.98
TIGR00549345 mevalon_kin mevalonate kinase; InterPro: IPR006205 Meva 99.09
COG4542293 PduX Protein involved in propanediol utilization, and r 97.12
PRK04181254 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Prov 98.21
PTZ00290468 galactokinase; Provisional 96.28
KOG1511397 consensus 98.13
pfam0028867 GHMP_kinases_N GHMP kinases N terminal domain. This fam 97.84
COG1829283 Predicted archaeal kinase (sugar kinase superfamily) [G 97.82
pfam0854482 GHMP_kinases_C GHMP kinases C terminal. This family inc 96.44
TIGR00131 500 gal_kin galactokinase; InterPro: IPR000705 Galactokinas 95.0
>TIGR01240 mevDPdecarb diphosphomevalonate decarboxylase; InterPro: IPR005935 Synonyms: mevalonate diphosphate decarboxylase; pyrophosphomevalonate decarboxylase Back     alignment and domain information
>KOG2833 consensus Back     alignment and domain information
>COG3407 MVD1 Mevalonate pyrophosphate decarboxylase [Lipid metabolism] Back     alignment and domain information
>COG0083 ThrB Homoserine kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01212 homoserine kinase; Provisional Back     alignment and domain information
>PRK00128 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PTZ00299 homoserine kinase; Provisional Back     alignment and domain information
>PRK04344 consensus Back     alignment and domain information
>PRK03188 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PRK03926 mevalonate kinase; Provisional Back     alignment and domain information
>TIGR00191 thrB homoserine kinase; InterPro: IPR000870 Saccharomyces cerevisiae strains containing the erg8-1 mutation are temperature sensitive for growth due to a defect in phosphomevalonate kinase, an enzyme of isoprene and ergosterol biosynthesis Back     alignment and domain information
>PRK03817 galactokinase; Provisional Back     alignment and domain information
>PRK02534 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PRK00555 galactokinase; Provisional Back     alignment and domain information
>PRK05322 galactokinase; Provisional Back     alignment and domain information
>PRK05905 hypothetical protein; Provisional Back     alignment and domain information
>PRK03009 consensus Back     alignment and domain information
>COG0153 GalK Galactokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04943 consensus Back     alignment and domain information
>PRK00343 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PRK00650 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PRK04648 consensus Back     alignment and domain information
>COG1947 IspE 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase [Lipid metabolism] Back     alignment and domain information
>PRK05101 galactokinase; Provisional Back     alignment and domain information
>TIGR01220 Pmev_kin_Gr_pos phosphomevalonate kinase; InterPro: IPR005917 Protein kinases are a group of enzymes that possess a catalytic subunit which transfers the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function Back     alignment and domain information
>PRK01726 consensus Back     alignment and domain information
>PRK03288 consensus Back     alignment and domain information
>COG3890 ERG8 Phosphomevalonate kinase [Lipid metabolism] Back     alignment and domain information
>TIGR00144 beta_RFAP_syn beta-ribofuranosylaminobenzene 5'-phosphate synthase family; InterPro: IPR004422 This protein family contains several archaeal examples of beta-ribofuranosylaminobenzene 5-prime-phosphate synthase (beta-RFAP synthase), an enzyme involved in methanopterin biosynthesis Back     alignment and domain information
>PRK01123 shikimate kinase; Provisional Back     alignment and domain information
>COG1577 ERG12 Mevalonate kinase [Lipid metabolism] Back     alignment and domain information
>COG1685 Archaeal shikimate kinase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR01920 Shik_kin_archae shikimate kinase; InterPro: IPR010189 Shikimate kinase (2 Back     alignment and domain information
>COG1907 Predicted archaeal sugar kinases [General function prediction only] Back     alignment and domain information
>TIGR00154 ispE 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; InterPro: IPR004424 4-diphosphocytidyl-2C-methyl-D-erythritol kinase is a member of the family of GHMP kinases that were previously designated as conserved hypothetical protein YchB or as isopentenyl monophosphate kinase Back     alignment and domain information
>PTZ00298 mevalonate kinase; Provisional Back     alignment and domain information
>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional Back     alignment and domain information
>COG2605 Predicted kinase related to galactokinase and mevalonate kinase [General function prediction only] Back     alignment and domain information
>KOG1537 consensus Back     alignment and domain information
>TIGR00549 mevalon_kin mevalonate kinase; InterPro: IPR006205 Mevalonate kinase (2 Back     alignment and domain information
>COG4542 PduX Protein involved in propanediol utilization, and related proteins (includes coumermycin biosynthetic protein), possible kinase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK04181 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PTZ00290 galactokinase; Provisional Back     alignment and domain information
>KOG1511 consensus Back     alignment and domain information
>pfam00288 GHMP_kinases_N GHMP kinases N terminal domain Back     alignment and domain information
>COG1829 Predicted archaeal kinase (sugar kinase superfamily) [General function prediction only] Back     alignment and domain information
>pfam08544 GHMP_kinases_C GHMP kinases C terminal Back     alignment and domain information
>TIGR00131 gal_kin galactokinase; InterPro: IPR000705 Galactokinase catalyses the first reaction in the galactose metabolism pathway, the ATP-dependent phosphorylation of galactose, yielding galactose-1-phosphate , Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target355 diphosphomevalonate decarboxylase/isopentenyl-diphospha
3f0n_A414 Mus Musculus Mevalonate Pyrophosphate Decarboxylase 2e-93
3d4j_A400 Crystal Structure Of Human Mevalonate Diphosphate D 1e-92
2hk2_A331 Crystal Structure Of Mevalonate Diphosphate Decarbo 1e-91
3qt5_A332 Crystal Structure Of Staphylococcus Epidermidis Mev 2e-89
3qt8_A332 Crystal Structure Of Mutant S192a Staphylococcus Ep 2e-89
1fi4_A416 The X-Ray Crystal Structure Of Mevalonate 5-Diphosp 5e-89
2hke_A380 Mevalonate Diphosphate Decarboxylase From Trypanoso 1e-78
2gs8_A317 Structure Of Mevalonate Pyrophosphate Decarboxylase 5e-61
3lto_A323 Crystal Structure Of A Mevalonate Diphosphate Decar 6e-60
3hul_A298 Structure Of Putative Homoserine Kinase Thrb From L 5e-07
>gi|215261394|pdb|3F0N|A Chain A, Mus Musculus Mevalonate Pyrophosphate Decarboxylase Length = 414 Back     alignment and structure
 Score =  347 bits (891), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 100/338 (29%), Positives = 154/338 (45%), Gaps = 27/338 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNG 80
            +   P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D   D I LNG
Sbjct: 24  VTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNG 83

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNIPTKAGLASSAS 127
           ++        +   +      +  +                 + + NN PT AGLASSA+
Sbjct: 84  REEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTAAGLASSAA 143

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--V 185
           G+A L   L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  +
Sbjct: 144 GYACLAYTLAQVYGVE---GDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQI 200

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIID 244
                WP LRI +L +   +K+ GS   M+ +   S       +  +   +  + + I +
Sbjct: 201 APEWHWPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESVVPERMKEMTRCIQE 260

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDA 302
           QDF    ++  K++ + HAT +   PP+ Y    + + ++ V           + +T DA
Sbjct: 261 QDFQGFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNTHHGQTKVAYTFDA 320

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
           GPN  +       +T+ +F   +    P  +      K
Sbjct: 321 GPNAVIFTLE---DTVAEFVAAVRHSFPPAANGDKFLK 355


gi|218681762|pdb|3D4J|A Chain A, Crystal Structure Of Human Mevalonate Diphosphate Decarboxylase Length = 400 Back     alignment and structure
>gi|149241985|pdb|2HK2|A Chain A, Crystal Structure Of Mevalonate Diphosphate Decarboxylase From Staphylococcus Aureus (Monoclinic Form) Length = 331 Back     alignment and structure
>gi|332639847|pdb|3QT5|A Chain A, Crystal Structure Of Staphylococcus Epidermidis Mevalonate Diphosphate Decarboxylase Length = 332 Back     alignment and structure
>gi|332639853|pdb|3QT8|A Chain A, Crystal Structure Of Mutant S192a Staphylococcus Epidermidis Mevalonate Diphosphate Decarboxylase Complexed With Inhibitor 6- Fmvapp Length = 332 Back     alignment and structure
>gi|13786942|pdb|1FI4|A Chain A, The X-Ray Crystal Structure Of Mevalonate 5-Diphosphate Decarboxylase At 2.3 Angstrom Resolution Length = 416 Back     alignment and structure
>gi|149241991|pdb|2HKE|A Chain A, Mevalonate Diphosphate Decarboxylase From Trypanosoma Brucei Length = 380 Back     alignment and structure
>gi|109158018|pdb|2GS8|A Chain A, Structure Of Mevalonate Pyrophosphate Decarboxylase From Streptococcus Pyogenes Length = 317 Back     alignment and structure
>gi|289526975|pdb|3LTO|A Chain A, Crystal Structure Of A Mevalonate Diphosphate Decarboxylase From Legionella Pneumophila Length = 323 Back     alignment and structure
>gi|254221101|pdb|3HUL|A Chain A, Structure Of Putative Homoserine Kinase Thrb From Listeria Monocytogenes Length = 298 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target355 diphosphomevalonate decarboxylase/isopentenyl-diphospha
1fi4_A416 Mevalonate 5-diphosphate decarboxylase; mixed alpha/bet 1e-80
2hke_A380 Diphosphomevalonate decarboxylase, putative; mevalonate 1e-80
3f0n_A414 Mevalonate pyrophosphate decarboxylase; cholesterol bio 5e-77
3lto_A323 Mevalonate diphosphate decarboxylase; protein structure 2e-68
2gs8_A317 Mevalonate pyrophosphate decarboxylase; structural geno 1e-60
2hk2_A331 Diphosphomevalonate decarboxylase; mevalonate diphospha 3e-57
1h72_C296 HK, homoserine kinase; transferase, threonine biosynthe 1e-07
3hul_A298 HSK, HK, homoserine kinase; structural genomics, putati 9e-05
>1fi4_A Mevalonate 5-diphosphate decarboxylase; mixed alpha/beta structure, ATP binding, cholesterol biosynthesis, structural genomics, PSI; 2.27A {Saccharomyces cerevisiae} SCOP: d.14.1.5 d.58.26.2 Length = 416 Back     alignment and structure
 Score =  295 bits (756), Expect = 1e-80
 Identities = 98/333 (29%), Positives = 164/333 (49%), Gaps = 19/333 (5%)

Query: 12  YIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-- 69
            +   +      +S   P NIA  KYWGKRD+KLNLP N+S+S++L      T  +    
Sbjct: 14  LVPRGSHMTVYTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATA 73

Query: 70  -DSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-----------VYFLIETSNNIP 117
            + + D + LNG+  S  +   +   +     R+  +               I + NN P
Sbjct: 74  PEFERDTLWLNGEPHSIDNERTQNCLRDLRQLRKEMESKDASLPTLSQWKLHIVSENNFP 133

Query: 118 TKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQ 177
           T AGLASSA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  +
Sbjct: 134 TAAGLASSAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAE 193

Query: 178 NGMDSFAVPFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTD 234
           +G DS AV   +   WP ++  +L + D +K + S + M++T   S  F +     +   
Sbjct: 194 DGHDSMAVQIADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKR 253

Query: 235 LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--Q 292
              +++AI+++DF    +    ++   HAT + + PP+ Y    + + +       Q   
Sbjct: 254 FEVMRKAIVEKDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYG 313

Query: 293 SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
              + +T DAGPN  L +  + E  +  F  ++
Sbjct: 314 ETIVAYTFDAGPNAVLYYLAENESKLFAFIYKL 346


>2hke_A Diphosphomevalonate decarboxylase, putative; mevalonate diphosphate decarboxylase, lyase; 1.80A {Trypanosoma brucei} Length = 380 Back     alignment and structure
>3f0n_A Mevalonate pyrophosphate decarboxylase; cholesterol biosynthesis, lipid synthesis, lyase, steroid biosynthesis, sterol biosynthesis; 1.90A {Mus musculus} PDB: 3d4j_A Length = 414 Back     alignment and structure
>3lto_A Mevalonate diphosphate decarboxylase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.27A {Legionella pneumophila} Length = 323 Back     alignment and structure
>2gs8_A Mevalonate pyrophosphate decarboxylase; structural genomics, PSI, protein structure initiative; HET: MSE; 1.50A {Streptococcus pyogenes m1 gas} Length = 317 Back     alignment and structure
>2hk2_A Diphosphomevalonate decarboxylase; mevalonate diphosphate decarboxylase, lyase; 2.30A {Staphylococcus aureus} PDB: 2hk3_A Length = 331 Back     alignment and structure
>1h72_C HK, homoserine kinase; transferase, threonine biosynthesis; HET: ANP; 1.8A {Methanococcus jannaschii} SCOP: d.14.1.5 d.58.26.1 PDB: 1fwl_A 1fwk_A* 1h73_A* 1h74_A* Length = 296 Back     alignment and structure
>3hul_A HSK, HK, homoserine kinase; structural genomics, putative homoserine kinase, THRB, amino-acid biosynthesis, ATP-binding, cytoplasm; 2.19A {Listeria monocytogenes} Length = 298 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target355 diphosphomevalonate decarboxylase/isopentenyl-diphospha
2hke_A380 Diphosphomevalonate decarboxylase, putative; mevalonate 100.0
1fi4_A416 Mevalonate 5-diphosphate decarboxylase; mixed alpha/bet 100.0
3f0n_A414 Mevalonate pyrophosphate decarboxylase; cholesterol bio 100.0
2gs8_A317 Mevalonate pyrophosphate decarboxylase; structural geno 100.0
3lto_A323 Mevalonate diphosphate decarboxylase; protein structure 100.0
2hk2_A331 Diphosphomevalonate decarboxylase; mevalonate diphospha 100.0
2x7i_A308 Mevalonate kinase; transferase; HET: CIT; 2.20A {Staphy 99.73
2oi2_A292 Mevalonate kinase; enzyme-inhibitor complex, transferas 99.59
3k17_A365 LIN0012 protein; protein structure initiative II(PSI II 99.49
1kkh_A317 Mevalonate kinase; mixed beta sheet, phosphate-binding 99.49
3k85_A357 D-glycero-D-manno-heptose 1-phosphate kinase; bacteriod 99.34
2v8p_A271 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; nucl 99.26
2ww4_A283 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; non-m 98.94
1uek_A275 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 98.89
1wuu_A399 Galactokinase; galactosemia, GHMP superfamily, transfer 98.78
1h72_C296 HK, homoserine kinase; transferase, threonine biosynthe 99.82
3hul_A298 HSK, HK, homoserine kinase; structural genomics, putati 99.7
2pg9_A337 Phosphomevalonate kinase; GHMP kinase superfamily, tran 99.56
2hfs_A332 Mevalonate kinase, putative; GHMP kinase, trypanosomati 99.54
2cz9_A350 Probable galactokinase; structural genomics, NPPSFA, na 99.26
1kvk_A395 MK, mevalonate kinase; RMK, ATP, GHMP, transferase; HET 98.99
1pie_A419 Galactokinase; galactose, galactosemia, transferase; HE 98.89
2a2c_A478 N-acetylgalactosamine kinase; galactokinase, , transfer 98.26
2aj4_A 548 Galactokinase; galactosemia, transcription, transferase 97.06
>2hke_A Diphosphomevalonate decarboxylase, putative; mevalonate diphosphate decarboxylase, lyase; 1.80A {Trypanosoma brucei} Back     alignment and structure
Probab=100.00  E-value=0  Score=747.18  Aligned_cols=305  Identities=28%  Similarity=0.452  Sum_probs=280.8

Q ss_pred             CCEEEECCCCEEEEECCCCCC--HHHCCCCCCCEEEEECC--CCEEEEEEECCC-CCCEEEECCEECCCCCHHHHHHHHH
Q ss_conf             637897488424881167767--01175789843468127--810799997178-8857998787256652068999999
Q gi|254781016|r   22 EKSSAFLPSNIALCKYWGKRD--SKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNGQKISSQSSFFKKTTQF   96 (355)
Q Consensus        22 ~~~ta~ap~NIALIKYWGK~d--~~l~lP~n~SiS~TL~~--~~T~T~v~~~~~-~~d~~~lnG~~~~~~~~~~~ri~~~   96 (355)
                      ...||+||+||||||||||||  +.+|||+|||||+||+.  ++|+|+|+++++ +.|++||||++.+..+  .+|+.++
T Consensus         4 ~~vt~~AP~NIAlIKYWGKrD~~e~L~lP~N~SiS~TL~~~~~~T~Ttv~~~~~~~~D~~~lNG~~~~~~~--~~ri~~~   81 (380)
T 2hke_A            4 QCVTVEAPINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRLNGTEVDVGK--TPRVQSM   81 (380)
T ss_dssp             CEEEEEECCEEEEECCCCBCTTCTTTTCBSSCEEEEEBCSSSCCEEEEEEEESSCSSCEEEETTEEECGGG--CHHHHHH
T ss_pred             CEEEEEEECEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCEEEEEEEECCCCCCCEEEECCEECCCCC--CHHHHHH
T ss_conf             61999820513465326777888677789998057995599976899999888887757999997787420--1689999


Q ss_pred             HHHHHHHCC-----CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHC
Q ss_conf             742167619-----439999850233211012322479999999999818899988999886521353034310562002
Q gi|254781016|r   97 CDLFRQFSK-----VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEW  171 (355)
Q Consensus        97 l~~~r~~~~-----~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W  171 (355)
                      ++.+|...+     .+++|+|+|||||||||||||||||||++|+.++|+.+   .++|+|||+||||||||+|||||+|
T Consensus        82 l~~ir~~~~~~~~~~~~~I~S~NnFPtaAGLASSAsg~AALa~al~~~~~~~---~~lS~lAR~GSGSAcRSi~GGfv~W  158 (380)
T 2hke_A           82 LLHLRSTCPEELKNKKVNIVSENNFPTAAGMASSASGYCAMSAALIRAFKST---TNVSMLARLGSGSACRSAFGGFVIW  158 (380)
T ss_dssp             HHHHHTSSCHHHHTCEEEEEEEECSCTTSCCCHHHHHHHHHHHHHHHHHTCS---SCHHHHHHHHCGGGGGGGSSSEEEE
T ss_pred             HHHHHHHCHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCC---HHHHHHHHHHCCCCHHHHCCCEEEE
T ss_conf             9999985614304751699975788205657877899999999999874254---4578998752765013303884572


Q ss_pred             CCCCCCCCCCEEEEEC--CCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHH-HHHHHHHHHHHHHHCCHH
Q ss_conf             5789876544131015--6668642158999728766752105679887618568999973-055099999999809999
Q gi|254781016|r  172 ICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFI  248 (355)
Q Consensus       172 ~~g~~~~~sds~a~~~--~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~-~~~~~~~~~~ai~~~Df~  248 (355)
                      ++|..+|++|+||+++  +.|||||+++|++|++++|+|+||+|||++|+|||||+.|..+ +++++++|++||+++||+
T Consensus       159 ~~g~~~dgsds~A~qi~~~~~w~~l~~~ilvvs~~~K~vsSt~GM~~~v~TSpl~~~r~~~~~~~~~~~~~~Ai~~~Df~  238 (380)
T 2hke_A          159 NKGEKPDGSDCVATQFVDETHWPEIQVMCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFA  238 (380)
T ss_dssp             ECCSCTTSTTCEEEEEECTTSCTTEEEEEEECCCCSCCCCHHHHHHHHHHHCTTHHHHHHTHHHHHHHHHHHHHHHTCHH
T ss_pred             CCCCCCCCCCCCEEECCCCCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             26899996000035236644551120699994377677775288999988391089999986377899999999839999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHH--CCCEEEEEECCCCEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999999999989998703899568657889999999999742--89619999777981799955898999999976321
Q gi|254781016|r  249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEIT  326 (355)
Q Consensus       249 ~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~--~g~~v~fT~DAGPNv~il~~~~~~~~i~~~l~~i~  326 (355)
                      +|++++|+|+++|||+||+++|||+||+|+|+++|++|+++|+  +|+++||||||||||||||+++++++|.++|.+  
T Consensus       239 ~~~ei~e~ds~~mHA~~l~s~Ppi~Yl~~~S~~ii~~V~~~r~~~~~~~v~yT~DAGPNv~ll~~~~~~~~v~~~l~~--  316 (380)
T 2hke_A          239 TFAEIAMLESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANCFLFVLKEDLPEAVAMLME--  316 (380)
T ss_dssp             HHHHHHHHHHHHHHHHHHTSSSCCCCCCHHHHHHHHHHHHHHHHHTSCCEEEECCSSSCEEEEEEGGGHHHHHHHHHH--
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCEEEEECCCCHHHHHHHHHH--
T ss_conf             999999999999999985379987997846999999999999746894199997889877999725129999999998--


Q ss_pred             CCCCCCCC
Q ss_conf             00368887
Q gi|254781016|r  327 IIDPLDSP  334 (355)
Q Consensus       327 ~~~~~~~~  334 (355)
                       .+|....
T Consensus       317 -~fp~~~~  323 (380)
T 2hke_A          317 -HFPTPFE  323 (380)
T ss_dssp             -HSCCCGG
T ss_pred             -HCCCCHH
T ss_conf             -7899615



>1fi4_A Mevalonate 5-diphosphate decarboxylase; mixed alpha/beta structure, ATP binding, cholesterol biosynthesis, structural genomics, PSI; 2.27A {Saccharomyces cerevisiae} SCOP: d.14.1.5 d.58.26.2 Back     alignment and structure
>3f0n_A Mevalonate pyrophosphate decarboxylase; cholesterol biosynthesis, lipid synthesis, lyase, steroid biosynthesis, sterol biosynthesis; 1.90A {Mus musculus} PDB: 3d4j_A Back     alignment and structure
>2gs8_A Mevalonate pyrophosphate decarboxylase; structural genomics, PSI, protein structure initiative; HET: MSE; 1.50A {Streptococcus pyogenes m1 gas} Back     alignment and structure
>3lto_A Mevalonate diphosphate decarboxylase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.27A {Legionella pneumophila} Back     alignment and structure
>2hk2_A Diphosphomevalonate decarboxylase; mevalonate diphosphate decarboxylase, lyase; 2.30A {Staphylococcus aureus} PDB: 2hk3_A Back     alignment and structure
>2x7i_A Mevalonate kinase; transferase; HET: CIT; 2.20A {Staphylococcus aureus} Back     alignment and structure
>2oi2_A Mevalonate kinase; enzyme-inhibitor complex, transferase; HET: DP6; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>3k17_A LIN0012 protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics, NEW YORK SGX research center for structural genomics; HET: PGE; 2.10A {Listeria innocua} Back     alignment and structure
>1kkh_A Mevalonate kinase; mixed beta sheet, phosphate-binding loop, beta-alpha-beta, transferase; 2.40A {Methanocaldococcus jannaschii} SCOP: d.14.1.5 d.58.26.3 PDB: 1vis_A Back     alignment and structure
>3k85_A D-glycero-D-manno-heptose 1-phosphate kinase; bacteriodes thetaiotaomicron, protein structure initiative II(PSI II), nysgxrc; 2.28A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v8p_A 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; nucleotide-binding, isoprene biosynthesis, transferase, ATP-binding, non-mevalonate; HET: CDP ADP; 2.1A {Aquifex aeolicus} PDB: 2v2v_A* 2v2q_A* 2v34_A* 2v2z_A* 2vf3_A* Back     alignment and structure
>2ww4_A 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; non-mevalonate pathway, isoprenoid biosynthesis, transferase; HET: ADP; 2.00A {Escherichia coli} PDB: 1oj4_A* Back     alignment and structure
>1uek_A 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase; non-mevalonate pathway, GHMP superfamily; 1.70A {Thermus thermophilus} SCOP: d.14.1.5 d.58.26.5 Back     alignment and structure
>1wuu_A Galactokinase; galactosemia, GHMP superfamily, transferase; HET: GLA ANP; 2.50A {Homo sapiens} SCOP: d.14.1.5 d.58.26.7 Back     alignment and structure
>1h72_C HK, homoserine kinase; transferase, threonine biosynthesis; HET: ANP; 1.8A {Methanococcus jannaschii} SCOP: d.14.1.5 d.58.26.1 PDB: 1fwl_A 1fwk_A* 1h73_A* 1h74_A* Back     alignment and structure
>3hul_A HSK, HK, homoserine kinase; structural genomics, putative homoserine kinase, THRB, amino-acid biosynthesis, ATP-binding, cytoplasm; 2.19A {Listeria monocytogenes} Back     alignment and structure
>2hfs_A Mevalonate kinase, putative; GHMP kinase, trypanosomatid parasite, transferase; 1.75A {Leishmania major} PDB: 2hfu_A* Back     alignment and structure
>2cz9_A Probable galactokinase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.50A {Pyrococcus horikoshii} PDB: 2dei_A* 2dej_A* 1s4e_A* Back     alignment and structure
>1kvk_A MK, mevalonate kinase; RMK, ATP, GHMP, transferase; HET: ATP; 2.40A {Rattus norvegicus} SCOP: d.14.1.5 d.58.26.3 PDB: 2r42_A* 2r3v_A Back     alignment and structure
>1pie_A Galactokinase; galactose, galactosemia, transferase; HET: GLA; 2.10A {Lactococcus lactis} SCOP: d.14.1.5 d.58.26.7 Back     alignment and structure
>2a2c_A N-acetylgalactosamine kinase; galactokinase, , transferase; HET: NG1 ADP; 1.65A {Homo sapiens} PDB: 2a2d_A* Back     alignment and structure
>2aj4_A Galactokinase; galactosemia, transcription, transferase; HET: GLA ANP; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 355 diphosphomevalonate decarboxylase/isopentenyl-diphospha
d1fi4a1188 d.14.1.5 (A:3-190) Mevalonate 5-diphosphate decarboxyla 6e-47
d1h72c1163 d.14.1.5 (C:5-167) Homoserine kinase {Archaeon Methanoc 4e-04
d1fi4a2203 d.58.26.2 (A:191-393) Mevalonate 5-diphosphate decarbox 5e-37
>d1fi4a1 d.14.1.5 (A:3-190) Mevalonate 5-diphosphate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 188 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: GHMP Kinase, N-terminal domain
domain: Mevalonate 5-diphosphate decarboxylase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  181 bits (461), Expect = 6e-47
 Identities = 71/186 (38%), Positives = 103/186 (55%), Gaps = 16/186 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI---DSDADCIILN 79
            +S   P NIA  KYWGKRD+KLNLP N+S+S++L      T  +     + + D + LN
Sbjct: 3   TASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWLN 62

Query: 80  GQKISSQSSFFKKTTQFCDLFRQF-----------SKVYFLIETSNNIPTKAGLASSASG 128
           G+  S  +   +   +     R+            S+    I + NN PT AGLASSA+G
Sbjct: 63  GEPHSIDNERTQNCLRDLRQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLASSAAG 122

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF- 187
           FAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS AV   
Sbjct: 123 FAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMAVQIA 182

Query: 188 -NNQWP 192
            ++ WP
Sbjct: 183 DSSDWP 188


>d1h72c1 d.14.1.5 (C:5-167) Homoserine kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 163 Back     information, alignment and structure
>d1fi4a2 d.58.26.2 (A:191-393) Mevalonate 5-diphosphate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 203 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target355 diphosphomevalonate decarboxylase/isopentenyl-diphospha
d1fi4a1188 Mevalonate 5-diphosphate decarboxylase {Baker's yeast ( 100.0
d1h72c1163 Homoserine kinase {Archaeon Methanococcus jannaschii [T 99.35
d1kkha1180 Mevalonate kinase {Archaeon Methanococcus jannaschii [T 98.78
d1k47a1194 Phosphomevalonate kinase (PMK) {Streptococcus pneumonia 98.4
d1piea1205 Galactokinase {Lactococcus lactis [TaxId: 1358]} 97.85
d1wuua1215 Galactokinase {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1ueka1148 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 97.27
d1fi4a2203 Mevalonate 5-diphosphate decarboxylase {Baker's yeast ( 100.0
d1h72c2133 Homoserine kinase {Archaeon Methanococcus jannaschii [T 96.5
d1k47a2135 Phosphomevalonate kinase (PMK) {Streptococcus pneumonia 95.32
d1kvka1225 Mevalonate kinase {Rat (Rattus norvegicus) [TaxId: 1011 97.9
d1oj4a1163 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 97.74
d1s4ea1176 Galactokinase {Archaeon Pyrococcus furiosus [TaxId: 226 97.61
d1s4ea2171 Galactokinase {Archaeon Pyrococcus furiosus [TaxId: 226 90.34
>d1fi4a1 d.14.1.5 (A:3-190) Mevalonate 5-diphosphate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: GHMP Kinase, N-terminal domain
domain: Mevalonate 5-diphosphate decarboxylase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=0  Score=429.35  Aligned_cols=171  Identities=43%  Similarity=0.701  Sum_probs=151.4

Q ss_pred             CCEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECC--CCEEEEEEECCC-CCCEEEECCEECCCCCHHHHHHHHHHH
Q ss_conf             63789748842488116776701175789843468127--810799997178-885799878725665206899999974
Q gi|254781016|r   22 EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNGQKISSQSSFFKKTTQFCD   98 (355)
Q Consensus        22 ~~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~--~~T~T~v~~~~~-~~d~~~lnG~~~~~~~~~~~ri~~~l~   98 (355)
                      .++||+||+||||||||||+|+++|||.||||||||+.  ++|+|++++.+. ++|+++|||++.+...++.+++...++
T Consensus         2 ~~~t~~apsNIALiKYWGK~d~~~~lP~n~SiS~TL~~~~~~T~t~v~~~~~~~~d~~~lnG~~~~~~~~~~~~~~~~l~   81 (188)
T d1fi4a1           2 YTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWLNGEPHSIDNERTQNCLRDLR   81 (188)
T ss_dssp             EEEEEEECCEEEEECCCCEEETTTTEESSCEEEEEBCTTTSCEEEEEEECTTCCSCBCTTTCCBSSSSSSSHHHHHHHHH
T ss_pred             EEEEEECCCCEEEEEECCCCCCCCCCCCCCEEEEEECCCCCEEEEEEEECCCCCCCCEEECCEECCCCHHHHHHHHHHHH
T ss_conf             57899753748788752645754577899827899358986788999867877654135788203640278899999999


Q ss_pred             HHHHH-----------CCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCC
Q ss_conf             21676-----------1943999985023321101232247999999999981889998899988652135303431056
Q gi|254781016|r   99 LFRQF-----------SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRG  167 (355)
Q Consensus        99 ~~r~~-----------~~~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG  167 (355)
                      .++..           .+++++|+|+|||||+|||||||||||||+.|+.++++++++.+++|+|||+||||||||+|||
T Consensus        82 ~~~~~~~~~~~~~p~~~~~~~~I~S~N~FP~aaGLASSAsg~aAl~~al~~~~~~~~~~~~~S~lARlGSGSAcRSi~Gg  161 (188)
T d1fi4a1          82 QLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLASSAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGG  161 (188)
T ss_dssp             HHHHHHHTTCTTSCCGGGSCEEEEEEECCCTTSCCCHHHHHHHHHHHHHHHHTTCCSCHHHHHHHHHHHHGGGGGGGSSS
T ss_pred             HHHHHHHCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHCCC
T ss_conf             99988730243576412442899962788221108887988999999999997177888999999876454403232088


Q ss_pred             CHHCCCCCCCCCCCEEEEEC--CCCCC
Q ss_conf             20025789876544131015--66686
Q gi|254781016|r  168 FCEWICGTDQNGMDSFAVPF--NNQWP  192 (355)
Q Consensus       168 ~v~W~~g~~~~~sds~a~~~--~~~~~  192 (355)
                      ||+|+.|..+|++|+||+++  ++|||
T Consensus       162 ~v~W~~g~~~dg~d~~a~~~~~~~hWp  188 (188)
T d1fi4a1         162 YVAWEMGKAEDGHDSMAVQIADSSDWP  188 (188)
T ss_dssp             EEEEECCSCTTCTTCEEEEEECGGGST
T ss_pred             EEEECCCCCCCCCCEEEEECCCCCCCC
T ss_conf             668026899998860378888745798



>d1h72c1 d.14.1.5 (C:5-167) Homoserine kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kkha1 d.14.1.5 (A:1-180) Mevalonate kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1k47a1 d.14.1.5 (A:1-194) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6 [TaxId: 171101]} Back     information, alignment and structure
>d1piea1 d.14.1.5 (A:9-213) Galactokinase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1wuua1 d.14.1.5 (A:2-216) Galactokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueka1 d.14.1.5 (A:1-148) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fi4a2 d.58.26.2 (A:191-393) Mevalonate 5-diphosphate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h72c2 d.58.26.1 (C:168-300) Homoserine kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1k47a2 d.58.26.4 (A:195-329) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6 [TaxId: 171101]} Back     information, alignment and structure
>d1kvka1 d.14.1.5 (A:1-225) Mevalonate kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oj4a1 d.14.1.5 (A:1-163) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s4ea1 d.14.1.5 (A:5-180) Galactokinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s4ea2 d.58.26.7 (A:181-351) Galactokinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 355 diphosphomevalonate decarboxylase/isopentenyl-diph
1fi4_A_32-61_179-397249 (A:32-61,A:179-397) Mevalonate 5-diphosphate decar 6e-44
2hk2_A_176-322147 (A:176-322) Diphosphomevalonate decarboxylase; mev 1e-43
2hke_A_179-364186 (A:179-364) Diphosphomevalonate decarboxylase, put 3e-38
3lto_A_173-323151 (A:173-323) Mevalonate diphosphate decarboxylase; 1e-37
3f0n_A_205-389185 (A:205-389) Mevalonate pyrophosphate decarboxylase 9e-27
1fi4_A_32-61_179-397249 (A:32-61,A:179-397) Mevalonate 5-diphosphate decar 1e-09
2gs8_A_170-317148 (A:170-317) Mevalonate pyrophosphate decarboxylase 9e-38
3f0n_A_1-204_390-414229 (A:1-204,A:390-414) Mevalonate pyrophosphate decar 4e-22
2gs8_A_1-169169 (A:1-169) Mevalonate pyrophosphate decarboxylase; 7e-21
3lto_A_1-172172 (A:1-172) Mevalonate diphosphate decarboxylase; pr 7e-17
2hk2_A_1-175_323-331184 (A:1-175,A:323-331) Diphosphomevalonate decarboxyl 3e-16
2hke_A_1-178_365-380194 (A:1-178,A:365-380) Diphosphomevalonate decarboxyl 7e-16
1fi4_A_1-31_62-178_398-416167 (A:1-31,A:62-178,A:398-416) Mevalonate 5-diphospha 3e-10
3hul_A_1-154_284-298169 (A:1-154,A:284-298) HSK, HK, homoserine kinase; st 0.004
2pff_B_1772-1800_1916-2006120 (B:1772-1800,B:1916-2006) Fatty acid synthase subu 7e-04
2v8p_A_1-158158 (A:1-158) 4-diphosphocytidyl-2-C-methyl-D-erythrit 0.002
>1fi4_A (A:32-61,A:179-397) Mevalonate 5-diphosphate decarboxylase; mixed alpha/beta structure, ATP binding, cholesterol biosynthesis, structural genomics, PSI; 2.27A {Saccharomyces cerevisiae}Length = 249 Back     alignment and structure
 Score =  172 bits (438), Expect = 6e-44
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 10/199 (5%)

Query: 162 RSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRH 219
           +S + G+  W  G  ++G DS AV    ++ WP  +  +L + D +K + S +  ++T  
Sbjct: 30  QSLFGGYVAWEXGKAEDGHDSXAVQIADSSDWPQXKACVLVVSDIKKDVSSTQGXQLTVA 89

Query: 220 HSPFFTQW-TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKE 278
            S  F +     +       ++AI+++DF    +    ++   HAT + + PP+ Y    
Sbjct: 90  TSELFKERIEHVVPKRFEVXRKAIVEKDFATFAKETXXDSNSFHATCLDSFPPIFYXNDT 149

Query: 279 TIQGMERVWDARQQ--SIPIYFTLDAGPNLKLLFTHK----IEETIKQFFPEITIIDP-L 331
           + + +       Q      + +T DAGPN  L +  +    +   I + F  +   D   
Sbjct: 150 SKRIISWCHTINQFYGETIVAYTFDAGPNAVLYYLAENESKLFAFIYKLFGSVPGWDKKF 209

Query: 332 DSPDLWSTKDSLSQKNSIE 350
            +  L +        N   
Sbjct: 210 TTEQLEAFNHQFESSNFTA 228


>2hk2_A (A:176-322) Diphosphomevalonate decarboxylase; mevalonate diphosphate decarboxylase, lyase; 2.30A {Staphylococcus aureus} PDB: 2hk3_ALength = 147 Back     alignment and structure
>2hke_A (A:179-364) Diphosphomevalonate decarboxylase, putative; mevalonate diphosphate decarboxylase, lyase; 1.80A {Trypanosoma brucei}Length = 186 Back     alignment and structure
>3lto_A (A:173-323) Mevalonate diphosphate decarboxylase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.27A {Legionella pneumophila}Length = 151 Back     alignment and structure
>3f0n_A (A:205-389) Mevalonate pyrophosphate decarboxylase; cholesterol biosynthesis, lipid synthesis, lyase, steroid biosynthesis, sterol biosynthesis; 1.90A {Mus musculus} PDB: 3d4j_ALength = 185 Back     alignment and structure
>1fi4_A (A:32-61,A:179-397) Mevalonate 5-diphosphate decarboxylase; mixed alpha/beta structure, ATP binding, cholesterol biosynthesis, structural genomics, PSI; 2.27A {Saccharomyces cerevisiae}Length = 249 Back     alignment and structure
>2gs8_A (A:170-317) Mevalonate pyrophosphate decarboxylase; structural genomics, PSI, protein structure initiative; HET: MSE; 1.50A {Streptococcus pyogenes m1 gas}Length = 148 Back     alignment and structure
>3f0n_A (A:1-204,A:390-414) Mevalonate pyrophosphate decarboxylase; cholesterol biosynthesis, lipid synthesis, lyase, steroid biosynthesis, sterol biosynthesis; 1.90A {Mus musculus} PDB: 3d4j_ALength = 229 Back     alignment and structure
>2gs8_A (A:1-169) Mevalonate pyrophosphate decarboxylase; structural genomics, PSI, protein structure initiative; HET: MSE; 1.50A {Streptococcus pyogenes m1 gas}Length = 169 Back     alignment and structure
>3lto_A (A:1-172) Mevalonate diphosphate decarboxylase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.27A {Legionella pneumophila}Length = 172 Back     alignment and structure
>2hk2_A (A:1-175,A:323-331) Diphosphomevalonate decarboxylase; mevalonate diphosphate decarboxylase, lyase; 2.30A {Staphylococcus aureus} PDB: 2hk3_ALength = 184 Back     alignment and structure
>2hke_A (A:1-178,A:365-380) Diphosphomevalonate decarboxylase, putative; mevalonate diphosphate decarboxylase, lyase; 1.80A {Trypanosoma brucei}Length = 194 Back     alignment and structure
>1fi4_A (A:1-31,A:62-178,A:398-416) Mevalonate 5-diphosphate decarboxylase; mixed alpha/beta structure, ATP binding, cholesterol biosynthesis, structural genomics, PSI; 2.27A {Saccharomyces cerevisiae}Length = 167 Back     alignment and structure
>3hul_A (A:1-154,A:284-298) HSK, HK, homoserine kinase; structural genomics, putative homoserine kinase, THRB, amino-acid biosynthesis, ATP-binding, cytoplasm; 2.19A {Listeria monocytogenes}Length = 169 Back     alignment and structure
>2pff_B (B:1772-1800,B:1916-2006) Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae}Length = 120 Back     alignment and structure
>2v8p_A (A:1-158) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; nucleotide-binding, isoprene biosynthesis, transferase, ATP-binding, non-mevalonate; HET: CDP ADP; 2.1A {Aquifex aeolicus} PDB: 2v2v_A* 2v2q_A* 2v34_A* 2v2z_A* 2vf3_A*Length = 158 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target355 diphosphomevalonate decarboxylase/isopentenyl-diphospha
1fi4_A_32-61_179-397249 Mevalonate 5-diphosphate decarboxylase; mixed alph 100.0
2hke_A_179-364186 Diphosphomevalonate decarboxylase, putative; meval 100.0
2hk2_A_176-322147 Diphosphomevalonate decarboxylase; mevalonate diph 100.0
2gs8_A_170-317148 Mevalonate pyrophosphate decarboxylase; structural 100.0
3lto_A_173-323151 Mevalonate diphosphate decarboxylase; protein stru 100.0
3f0n_A_205-389185 Mevalonate pyrophosphate decarboxylase; cholestero 99.97
2oi2_A_160-292133 Mevalonate kinase; enzyme-inhibitor complex, trans 97.35
2hfs_A_185-332148 Mevalonate kinase, putative; GHMP kinase, trypanos 96.35
3k17_A_211-350140 LIN0012 protein; protein structure initiative II(P 95.87
1kkh_A_182-317136 Mevalonate kinase; mixed beta sheet, phosphate-bin 95.31
3k85_A_188-331144 D-glycero-D-manno-heptose 1-phosphate kinase; bact 94.78
1h72_C_165-289125 HK, homoserine kinase; transferase, threonine bios 92.07
3f0n_A_1-204_390-414229 Mevalonate pyrophosphate decarboxylase; cholestero 99.91
3lto_A_1-172172 Mevalonate diphosphate decarboxylase; protein stru 99.88
2hke_A_1-178_365-380194 Diphosphomevalonate decarboxylase, putative; meval 99.81
2gs8_A_1-169169 Mevalonate pyrophosphate decarboxylase; structural 99.79
2hk2_A_1-175_323-331184 Diphosphomevalonate decarboxylase; mevalonate diph 99.64
1h72_C_1-164_290-296171 HK, homoserine kinase; transferase, threonine bios 99.33
3hul_A_1-154_284-298169 HSK, HK, homoserine kinase; structural genomics, p 99.07
1oj4_A_283 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; 99.05
2v8p_A_1-158158 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; 99.01
2oi2_A_1-159159 Mevalonate kinase; enzyme-inhibitor complex, trans 98.9
1kkh_A_1-181181 Mevalonate kinase; mixed beta sheet, phosphate-bin 98.85
3k85_A_1-187_332-357213 D-glycero-D-manno-heptose 1-phosphate kinase; bact 98.74
2hfs_A_1-184184 Mevalonate kinase, putative; GHMP kinase, trypanos 98.73
2a2c_A_1-238_468-478249 N-acetylgalactosamine kinase; galactokinase, , tra 98.64
1uek_A_1-148148 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol k 98.58
1pie_A_1-232_410-419242 Galactokinase; galactose, galactosemia, transferas 98.52
2cz9_A_1-178_344-350185 Probable galactokinase; structural genomics, NPPSF 98.37
3k17_A_1-210_351-365225 LIN0012 protein; protein structure initiative II(P 98.33
1wuu_A_1-222_390-399232 Galactokinase; galactosemia, GHMP superfamily, tra 98.19
1fi4_A_1-31_62-178_398-416167 Mevalonate 5-diphosphate decarboxylase; mixed alph 99.02
1kvk_A_1-227_375-395248 MK, mevalonate kinase; RMK, ATP, GHMP, transferase 97.9
2aj4_A_1-268_539-548278 Galactokinase; galactosemia, transcription, transf 97.35
2cz9_A_179-343165 Probable galactokinase; structural genomics, NPPSF 96.92
3hul_A_155-283129 HSK, HK, homoserine kinase; structural genomics, p 93.88
2aj4_A_269-287_437-538121 Galactokinase; galactosemia, transcription, transf 90.05
>1fi4_A (A:32-61,A:179-397) Mevalonate 5-diphosphate decarboxylase; mixed alpha/beta structure, ATP binding, cholesterol biosynthesis, structural genomics, PSI; 2.27A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=0  Score=470.33  Aligned_cols=195  Identities=29%  Similarity=0.567  Sum_probs=185.9

Q ss_pred             CCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHHHHCCCEEE
Q ss_conf             84248811677670117578984346812781079999717888579987872566520689999997421676194399
Q gi|254781016|r   30 SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFL  109 (355)
Q Consensus        30 ~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~~~~~~  109 (355)
                      .||||||||||||+++|||+|+|||+|||                                                   
T Consensus         1 vNIAliKYWGKrd~~l~lP~n~SlS~TL~---------------------------------------------------   29 (249)
T 1fi4_A            1 VNIATLKYWGKRDTKLNLPTNSSISVTLS---------------------------------------------------   29 (249)
T ss_dssp             CEEEEECCCCEEETTTTEESSCEEEEEBC---------------------------------------------------
T ss_pred             CCEEEEECCCCCCCCCCCCCCCEEEEEEC---------------------------------------------------
T ss_conf             50457622577688778889983668934---------------------------------------------------


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCCCCCEEEEECC-
Q ss_conf             9985023321101232247999999999981889998899988652135303431056200257898765441310156-
Q gi|254781016|r  110 IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-  188 (355)
Q Consensus       110 I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~~sds~a~~~~-  188 (355)
                                                                          +|+|||||+|++|.++|++||||+++. 
T Consensus        30 ----------------------------------------------------~Si~GGfv~W~~G~~~dg~dS~A~~i~~   57 (249)
T 1fi4_A           30 ----------------------------------------------------QSLFGGYVAWEXGKAEDGHDSXAVQIAD   57 (249)
T ss_dssp             ----------------------------------------------------TGGSSSEEEEECCSCTTCTTCEEEEEEC
T ss_pred             ----------------------------------------------------CHHHCCEEEECCCCCCCCCCCEEEECCC
T ss_conf             ----------------------------------------------------8541884884278888877723566466


Q ss_pred             -CCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHH-HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -668642158999728766752105679887618568999973-055099999999809999999999999998999870
Q gi|254781016|r  189 -NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI  266 (355)
Q Consensus       189 -~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~-~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~  266 (355)
                       +|||||++++++|++++|+|+||+||+++++|||||+.|++. ++.++.+|++||+++||++||+++|+|+++|||+||
T Consensus        58 ~~~w~dl~iii~vv~~~~K~vsSt~gM~~~~~TS~~y~~w~~~~a~~~l~~~~~Ai~~~Df~~~~ei~e~ds~~mHA~~l  137 (249)
T 1fi4_A           58 SSDWPQXKACVLVVSDIKKDVSSTQGXQLTVATSELFKERIEHVVPKRFEVXRKAIVEKDFATFAKETXXDSNSFHATCL  137 (249)
T ss_dssp             GGGSTTEEEEEEEECCCSCCCCHHHHHHHHHHHCSHHHHHHHTHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHEEEEEEECCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             43310110699994388776652577777765282357899987899999999999808999999999999999999985


Q ss_pred             CCCCCEEEECHHHHHHHHHHHHHHH--CCCEEEEEECCCCEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             3899568657889999999999742--896199997779817999558989999999763210
Q gi|254781016|r  267 AASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITI  327 (355)
Q Consensus       267 ~s~P~~~Y~~~~t~~ii~~v~~~R~--~g~~v~fT~DAGPNv~il~~~~~~~~i~~~l~~i~~  327 (355)
                      ++.|||+||+|+|+++|+.|+++|+  +|++|||||||||||||||++++++.|.+++.+...
T Consensus       138 ~s~Pp~~Y~~~~S~~ii~~V~~lr~~~~g~~v~yT~DAGPNv~vl~~~~~~~~i~~~l~~~f~  200 (249)
T 1fi4_A          138 DSFPPIFYXNDTSKRIISWCHTINQFYGETIVAYTFDAGPNAVLYYLAENESKLFAFIYKLFG  200 (249)
T ss_dssp             TSSSCCCCCCHHHHHHHHHHHHHHHHHTSCCEEEEECSSSCEEEEEEGGGHHHHHHHHHHHHT
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCEEEEECHHHHHHHHHHHHHHCC
T ss_conf             479974876760899999999999865895189995788667999656349999999999758



>2hke_A (A:179-364) Diphosphomevalonate decarboxylase, putative; mevalonate diphosphate decarboxylase, lyase; 1.80A {Trypanosoma brucei} Back     alignment and structure
>2hk2_A (A:176-322) Diphosphomevalonate decarboxylase; mevalonate diphosphate decarboxylase, lyase; 2.30A {Staphylococcus aureus} PDB: 2hk3_A Back     alignment and structure
>2gs8_A (A:170-317) Mevalonate pyrophosphate decarboxylase; structural genomics, PSI, protein structure initiative; HET: MSE; 1.50A {Streptococcus pyogenes m1 gas} Back     alignment and structure
>3lto_A (A:173-323) Mevalonate diphosphate decarboxylase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.27A {Legionella pneumophila} Back     alignment and structure