254781022

254781022

hypothetical protein CLIBASIA_04620

GeneID in NCBI database:8210045Locus tag:CLIBASIA_04620
Protein GI in NCBI database:254781022Protein Accession:YP_003065435.1
Gene range:-(1022916, 1023407)Protein Length:163aa
Gene description:hypothetical protein
COG prediction:[R] Predicted membrane-bound metal-dependent hydrolases
KEGG prediction:hypothetical protein; K07038
SEED prediction:Predicted membrane-bound metal-dependent hydrolases
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED4 TM-Helix
HMMTOP4 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKTLSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLTPTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH
cccccHHHHHHHHHHHHHHHcccHHcccccccHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHcccccHHHccccEEEHHHHHHHHccccccccccHHcccccHccHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccEEcccccEEEEEEEcccccHHHHHHHHHHHHHHHHccc
MTYEGHCIFALASVILAKKVNFlssftdaewGTVVLGALLScllpdidhprsfISKRFKTLSLLTSCISSHRGFTHSILAVILYKWLIHhffpselisyQGLQDALIIGYVSHLVAdvltptgipllwpyhwrfclpilhpnspigEIFFCVLFLIYAIISVH
MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKTLSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLTPTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH
MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKTLSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLTPTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH
MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKTLSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLTPTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH
MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKTLSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLTPTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH
*TYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKTLSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLTPTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKTLSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLTPTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH
MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKTLSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLTPTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH
MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKTLSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLTPTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target163 hypothetical protein CLIBASIA_04620 [Candidatus Liberib
315122507166 hypothetical protein CKC_03795 [Candidatus Liberibacter 1 2e-61
85058714192 hypothetical protein SG0736 [Sodalis glossinidius str. 1 1e-34
238791740182 Inner membrane protein ydjM [Yersinia intermedia ATCC 2 1 4e-32
317491909193 hypothetical protein HMPREF0864_01108 [Enterobacteriace 1 5e-32
188533983196 hypothetical protein ETA_18470 [Erwinia tasmaniensis Et 1 6e-32
238797408182 Inner membrane protein ydjM [Yersinia mollaretii ATCC 4 1 7e-32
238757811182 Inner membrane protein ydjM [Yersinia aldovae ATCC 3523 1 9e-32
317047859196 membrane-bound metal-dependent hydrolase [Pantoea sp. A 1 1e-31
300716451196 Inner membrane protein YdjM [Erwinia billingiae Eb661] 1 2e-31
308186638196 Inner membrane protein ydjM precursor [Pantoea vagans C 1 3e-31
>gi|315122507|ref|YP_004062996.1| hypothetical protein CKC_03795 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 166 Back     alignment and organism information
 Score =  238 bits (607), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 131/163 (80%)

Query: 1   MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKT 60
           MT++GHCIFALASVILAKKV+F  +  + EWG + LGALLSCLLPDIDH +SFIS+  K 
Sbjct: 4   MTFKGHCIFALASVILAKKVSFSPALAEGEWGIIALGALLSCLLPDIDHSQSFISRHLKI 63

Query: 61  LSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLT 120
           +S  TS I  HRGFTHSILAVILY   IH FFPS LI YQ  QDA+IIGYVSHLVAD+LT
Sbjct: 64  ISFFTSYILKHRGFTHSILAVILYVECIHQFFPSTLIPYQDFQDAMIIGYVSHLVADILT 123

Query: 121 PTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH 163
           P GIPLLWP  WRFCLP+LHPNS + EI FCVLFLIYA + +H
Sbjct: 124 PAGIPLLWPCPWRFCLPVLHPNSSVREILFCVLFLIYATVVIH 166


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|85058714|ref|YP_454416.1| hypothetical protein SG0736 [Sodalis glossinidius str. 'morsitans'] Length = 192 Back     alignment and organism information
>gi|238791740|ref|ZP_04635377.1| Inner membrane protein ydjM [Yersinia intermedia ATCC 29909] Length = 182 Back     alignment and organism information
>gi|317491909|ref|ZP_07950344.1| hypothetical protein HMPREF0864_01108 [Enterobacteriaceae bacterium 9_2_54FAA] Length = 193 Back     alignment and organism information
>gi|188533983|ref|YP_001907780.1| hypothetical protein ETA_18470 [Erwinia tasmaniensis Et1/99] Length = 196 Back     alignment and organism information
>gi|238797408|ref|ZP_04640908.1| Inner membrane protein ydjM [Yersinia mollaretii ATCC 43969] Length = 182 Back     alignment and organism information
>gi|238757811|ref|ZP_04618994.1| Inner membrane protein ydjM [Yersinia aldovae ATCC 35236] Length = 182 Back     alignment and organism information
>gi|317047859|ref|YP_004115507.1| membrane-bound metal-dependent hydrolase [Pantoea sp. At-9b] Length = 196 Back     alignment and organism information
>gi|300716451|ref|YP_003741254.1| Inner membrane protein YdjM [Erwinia billingiae Eb661] Length = 196 Back     alignment and organism information
>gi|308186638|ref|YP_003930769.1| Inner membrane protein ydjM precursor [Pantoea vagans C9-1] Length = 196 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target163 hypothetical protein CLIBASIA_04620 [Candidatus Liberib
PRK11648195 PRK11648, PRK11648, inner membrane protein; Provisional 3e-42
COG1988190 COG1988, COG1988, Predicted membrane-bound metal-depend 1e-09
pfam0430781 pfam04307, DUF457, Predicted membrane-bound metal-depen 2e-10
>gnl|CDD|183256 PRK11648, PRK11648, inner membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|32171 COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only] Back     alignment and domain information
>gnl|CDD|146772 pfam04307, DUF457, Predicted membrane-bound metal-dependent hydrolase (DUF457) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 163 hypothetical protein CLIBASIA_04620 [Candidatus Liberib
PRK11648195 hypothetical protein; Provisional 100.0
COG1988190 Predicted membrane-bound metal-dependent hydrolases [Ge 99.93
pfam0430781 DUF457 Predicted membrane-bound metal-dependent hydrola 99.84
pfam09988174 DUF2227 Uncharacterized metal-binding protein (DUF2227) 98.19
COG2389179 Uncharacterized metal-binding protein [General function 97.71
>PRK11648 hypothetical protein; Provisional Back     alignment and domain information
>COG1988 Predicted membrane-bound metal-dependent hydrolases [General function prediction only] Back     alignment and domain information
>pfam04307 DUF457 Predicted membrane-bound metal-dependent hydrolase (DUF457) Back     alignment and domain information
>pfam09988 DUF2227 Uncharacterized metal-binding protein (DUF2227) Back     alignment and domain information
>COG2389 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00