255764509

255764509

hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase

GeneID in NCBI database:8210044Locus tag:CLIBASIA_04615
Protein GI in NCBI database:255764509Protein Accession:YP_003065434.2
Gene range:-(1021548, 1022603)Protein Length:351aa
Gene description:hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase
COG prediction:[I] Hydroxymethylglutaryl-CoA reductase
KEGG prediction:hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase; K00021 hydroxymethylglutaryl-CoA reductase (NADPH) [EC:1.1.1.34]
SEED prediction:Hydroxymethylglutaryl-CoA reductase (EC 1.1.1.34)
Pathway involved in KEGG:Terpenoid backbone biosynthesis [PATH:las00900]
Subsystem involved in SEED:Isoprenoid Biosynthesis;
Mevalonate Branch of Isoprenoid Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE
ccccEEEEEEEEEEEcccEEEccccccccEEEEEEEHHHHHHHHHHHHHHHHHHccccEEEEEEcccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHcccccEEEEEEEEcHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEccccHHHHcccccEEEEEEEEccEEEEEEEcccEEEEccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccHHccccc
ccEEEEccEcccccccccEEEccccccccEEEEccccccEEEEEccccHHHHEEcccccEEEEEccccccccEEEccHHHHHHHHHHHcHHcHHHHHHHHHcccccEEEEEEEEEEEccEEEEEEEEEEccEccHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHccEEEEEEEEEEcHHHHHHcccccHHHHHHHHHHHHcHHHHHcccccEEcccHHHHHHHHHHHccccHHHHHHHccEEEEEEcccccEEEEEEcccEEEEEccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccc
mhmkkvssismpmrwigpmkitgnviqdkvkvplatyeyplwhsvkrgahismlcpdgiratlidermtrsiffETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEfatgdasghnMVTKAADAVMDWILSQWSYLHygsvsgnicsdkkataingimgrgknFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATgqdaanivegsqgltyaklhddslyfsctipnlilgcvgngknipaiKNNLtalgcieerktgDNARRLAAICAATVLCGELSLlaaqtnpgeLMEAHLRLERMHLNGE
mhmkkvssismpmrwigPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE
MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE
*HMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG*********NARRLAAICAATVLCGELSLLAAQTNPGELMEA************
MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE
MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAH***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE
MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE
MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target351 hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [C
315122508349 hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [C 1 0.0
89094690344 Hydroxymethylglutaryl-CoA reductase (NADPH) [Oceanospir 1 1e-132
258544191348 hydroxymethylglutaryl-CoA reductase (NADPH) [Cardiobact 1 1e-122
237784668369 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Coryne 1 1e-120
254513255361 Hydroxymethylglutaryl-coenzyme A reductase [Rhodobacter 1 1e-118
312190952353 HMG-CoA reductase [Streptomyces cinnamonensis] Length = 1 1e-116
86475804352 3-hydroxy-3-methylglutaryl-CoA reductase [Streptomyces 1 1e-116
153799373353 NapT2 [Streptomyces aculeolatus] Length = 353 1 1e-115
238623521353 putative 3-hydroxy-3-methylglutaryl-CoA reductase [Stre 1 1e-115
3721848353 3-hydroxy-3-methylglutaryl coenzyme A reductase [Strept 1 1e-114
>gi|315122508|ref|YP_004062997.1| hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 349 Back     alignment and organism information
 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/349 (87%), Positives = 328/349 (93%)

Query: 3   MKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRAT 62
           MKK+S+IS+PMRWIGP+KITGNV+QD+V VPLATYE PLW+SVKRGA+ISMLC DGIRAT
Sbjct: 1   MKKISTISVPMRWIGPIKITGNVVQDQVNVPLATYESPLWNSVKRGAYISMLCQDGIRAT 60

Query: 63  LIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
           LIDERMTRSIFFETE+AEMAL ALQEIT++K EI +++EQTSQFTRF+QLHSQIA NLLF
Sbjct: 61  LIDERMTRSIFFETEHAEMALKALQEITIRKKEIEQIVEQTSQFTRFIQLHSQIAANLLF 120

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           LRLEF+TGDASGHNMVTKAADAVM WILSQW+YL YGS+SGNICSDKKATAINGIMGRGK
Sbjct: 121 LRLEFSTGDASGHNMVTKAADAVMTWILSQWTYLRYGSISGNICSDKKATAINGIMGRGK 180

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           NFVAEITINR ICQKYLRTSPE I+ LNT KNLIGTFLAGGIRSANAHFANMLLAYYLAT
Sbjct: 181 NFVAEITINRQICQKYLRTSPENIVRLNTHKNLIGTFLAGGIRSANAHFANMLLAYYLAT 240

Query: 243 GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           GQDAANIVEGSQGLTYA+L DDSLYFSCTIPNLILGCVGNGKNIPA K NL  LGC E+R
Sbjct: 241 GQDAANIVEGSQGLTYAQLQDDSLYFSCTIPNLILGCVGNGKNIPATKKNLAELGCTEKR 300

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE 351
           K G+NARRLAAICAATVLCGELSL+AAQTNPGELM+AHL LERMHLNGE
Sbjct: 301 KNGENARRLAAICAATVLCGELSLIAAQTNPGELMKAHLLLERMHLNGE 349


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|89094690|ref|ZP_01167626.1| Hydroxymethylglutaryl-CoA reductase (NADPH) [Oceanospirillum sp. MED92] Length = 344 Back     alignment and organism information
>gi|258544191|ref|ZP_05704425.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Cardiobacterium hominis ATCC 15826] Length = 348 Back     alignment and organism information
>gi|237784668|ref|YP_002905373.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Corynebacterium kroppenstedtii DSM 44385] Length = 369 Back     alignment and organism information
>gi|254513255|ref|ZP_05125320.1| Hydroxymethylglutaryl-coenzyme A reductase [Rhodobacteraceae bacterium KLH11] Length = 361 Back     alignment and organism information
>gi|312190952|gb|ADQ43377.1| HMG-CoA reductase [Streptomyces cinnamonensis] Length = 353 Back     alignment and organism information
>gi|86475804|dbj|BAE78981.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Streptomyces sp. KO-3988] Length = 352 Back     alignment and organism information
>gi|153799373|gb|ABS50444.1| NapT2 [Streptomyces aculeolatus] Length = 353 Back     alignment and organism information
>gi|238623521|emb|CAX48660.1| putative 3-hydroxy-3-methylglutaryl-CoA reductase [Streptomyces anulatus] Length = 353 Back     alignment and organism information
>gi|3721848|dbj|BAA70975.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Streptomyces sp.] Length = 353 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target351 hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [C
pfam00368370 pfam00368, HMG-CoA_red, Hydroxymethylglutaryl-coenzyme 2e-80
KOG2480602 KOG2480, KOG2480, KOG2480, 3-hydroxy-3-methylglutaryl-C 4e-66
TIGR00533402 TIGR00533, HMG_CoA_R_NADP, 3-hydroxy-3-methylglutaryl C 4e-61
TIGR00920886 TIGR00920, 2A060605, 3-hydroxy-3-methylglutaryl-coenzym 6e-58
COG1257436 COG1257, HMG1, Hydroxymethylglutaryl-CoA reductase [Lip 6e-56
cd00365376 cd00365, HMG-CoA_reductase, Hydroxymethylglutaryl-coenz 8e-18
cd00643403 cd00643, HMG-CoA_reductase_classI, Class I hydroxymethy 3e-88
>gnl|CDD|144090 pfam00368, HMG-CoA_red, Hydroxymethylglutaryl-coenzyme A reductase Back     alignment and domain information
>gnl|CDD|37691 KOG2480, KOG2480, KOG2480, 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) reductase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|129624 TIGR00533, HMG_CoA_R_NADP, 3-hydroxy-3-methylglutaryl Coenzyme A reductase, hydroxymethylglutaryl-CoA reductase (NADP) Back     alignment and domain information
>gnl|CDD|162108 TIGR00920, 2A060605, 3-hydroxy-3-methylglutaryl-coenzyme A reductase Back     alignment and domain information
>gnl|CDD|31449 COG1257, HMG1, Hydroxymethylglutaryl-CoA reductase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|153080 cd00365, HMG-CoA_reductase, Hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR) Back     alignment and domain information
>gnl|CDD|153081 cd00643, HMG-CoA_reductase_classI, Class I hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 351 hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [C
pfam00368370 HMG-CoA_red Hydroxymethylglutaryl-coenzyme A reductase. 100.0
cd00643403 HMG-CoA_reductase_classI Class I hydroxymethylglutaryl- 100.0
cd00644417 HMG-CoA_reductase_classII Class II hydroxymethylglutary 100.0
TIGR00920988 2A060605 3-hydroxy-3-methylglutaryl-coenzyme A reductas 100.0
cd00365376 HMG-CoA_reductase Hydroxymethylglutaryl-coenzyme A (HMG 100.0
KOG2480602 consensus 100.0
TIGR00533419 HMG_CoA_R_NADP 3-hydroxy-3-methylglutaryl Coenzyme A re 100.0
COG1257436 HMG1 Hydroxymethylglutaryl-CoA reductase [Lipid metabol 100.0
TIGR00532402 HMG_CoA_R_NAD hydroxymethylglutaryl-CoA reductase, degr 100.0
COG1257436 HMG1 Hydroxymethylglutaryl-CoA reductase [Lipid metabol 99.09
>pfam00368 HMG-CoA_red Hydroxymethylglutaryl-coenzyme A reductase Back     alignment and domain information
>cd00643 HMG-CoA_reductase_classI Class I hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR) Back     alignment and domain information
>cd00644 HMG-CoA_reductase_classII Class II hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR) Back     alignment and domain information
>TIGR00920 2A060605 3-hydroxy-3-methylglutaryl-coenzyme A reductase; InterPro: IPR004816 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A reductase, HMG-CoA reductase Back     alignment and domain information
>cd00365 HMG-CoA_reductase Hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR) Back     alignment and domain information
>KOG2480 consensus Back     alignment and domain information
>TIGR00533 HMG_CoA_R_NADP 3-hydroxy-3-methylglutaryl Coenzyme A reductase; InterPro: IPR004554 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A reductase, HMG-CoA reductase Back     alignment and domain information
>COG1257 HMG1 Hydroxymethylglutaryl-CoA reductase [Lipid metabolism] Back     alignment and domain information
>TIGR00532 HMG_CoA_R_NAD hydroxymethylglutaryl-CoA reductase, degradative; InterPro: IPR004553 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A reductase, HMG-CoA reductase Back     alignment and domain information
>COG1257 HMG1 Hydroxymethylglutaryl-CoA reductase [Lipid metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target351 hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [C
1dq8_A467 Complex Of The Catalytic Portion Of Human Hmg-Coa R 1e-117
2q1l_A441 Design And Synthesis Of Pyrrole-Based, Hepatoselect 1e-116
3qae_A458 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase Of 5e-71
1qax_A428 Ternary Complex Of Pseudomonas Mevalonii Hmg-Coa Re 1e-70
>gi|7245353|pdb|1DQ8|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa Reductase With Hmg And Coa Length = 467 Back     alignment and structure
 Score =  424 bits (1091), Expect = e-117,   Method: Composition-based stats.
 Identities = 119/354 (33%), Positives = 187/354 (52%), Gaps = 13/354 (3%)

Query: 3   MKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRAT 62
              +  + +P+   GP+ +       + +VP+AT E  L  S  RG   ++    G  + 
Sbjct: 107 ENVIGYMPIPVGVAGPLCLDEK----EFQVPMATTEGCLVASTNRGCR-AIGLGGGASSR 161

Query: 63  LIDERMTRSIFFETENAEMALTALQEIT--LKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
           ++ + MTR        A  +      +      A I    + TS+F R  +LH+ IAG  
Sbjct: 162 VLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRN 221

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           L++R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GR
Sbjct: 222 LYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGR 281

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+
Sbjct: 282 GKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYI 341

Query: 241 ATGQDAANIVEGSQGLTYAK---LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
           A GQDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG
Sbjct: 342 ACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLG 401

Query: 298 CIE--ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
                +   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 402 VQGACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 454


>gi|152149428|pdb|2Q1L|A Chain A, Design And Synthesis Of Pyrrole-Based, Hepatoselective Hmg- Coa Reductase Inhibitors Length = 441 Back     alignment and structure
>gi|320089961|pdb|3QAE|A Chain A, 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase Of Streptococcus Pneumoniae Length = 458 Back     alignment and structure
gi|5542333|pdb|1QAX|A Chain A, Ternary Complex Of Pseudomonas Mevalonii Hmg-Coa Reductase With Hmg-Coa And Nad+ Length = 428 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target351 hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [C
2r4f_A441 3-hydroxy-3-methylglutaryl-coenzyme A reductase; oxidor 7e-74
1r31_A428 3-hydroxy-3-methylglutaryl-coenzyme A reductase; 4-elec 7e-49
>2r4f_A 3-hydroxy-3-methylglutaryl-coenzyme A reductase; oxidoreductase, cholesterol, biocynthesis, HMG-COA, NADPH, statin, alternative splicing; HET: RIE; 1.70A {Homo sapiens} PDB: 2q1l_A* 2q6c_A* 2q6b_A* 3bgl_A* 3cct_A* 3ccw_A* 3ccz_A* 3cd0_A* 3cd5_A* 3cd7_A* 3cda_A* 3cdb_A* 1dqa_A* 1dq9_A* 1dq8_A* 1hw8_A* 1hw9_A* 1hwi_A* 1hwj_A* 1hwk_A* ... Length = 441 Back     alignment and structure
 Score =  272 bits (698), Expect = 7e-74
 Identities = 123/351 (35%), Positives = 188/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ +       + +VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 97  IGYMPIPVGVAGPLCLDE----KEFQVPMATTEGCLVASTNRGCRAIGLG-GGASSRVLA 151

Query: 66  ERMTRSIFFETENAE--MALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E +   A I    + TS+F R  +LH+ IAG  L++
Sbjct: 152 DGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYI 211

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 212 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 271

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 272 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 331

Query: 244 QDAANIVEGSQGLT---YAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T    +   ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 332 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 391

Query: 301 ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 392 ACKDNPGENARQLARIVCGTVMAGELSLMAALAA-GHLVKSHMIHNRSKIN 441


>1r31_A 3-hydroxy-3-methylglutaryl-coenzyme A reductase; 4-electron oxido-reductase, oxidoreductase; HET: COA MEV; 2.10A {Pseudomonas mevalonii} SCOP: d.58.20.1 d.179.1.1 PDB: 1qay_A* 1qax_A* 1r7i_A 1t02_A* Length = 428 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target351 hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [C
2r4f_A441 3-hydroxy-3-methylglutaryl-coenzyme A reductase; oxidor 100.0
1r31_A428 3-hydroxy-3-methylglutaryl-coenzyme A reductase; 4-elec 100.0
>2r4f_A 3-hydroxy-3-methylglutaryl-coenzyme A reductase; oxidoreductase, cholesterol, biocynthesis, HMG-COA, NADPH, statin, alternative splicing; HET: RIE; 1.70A {Homo sapiens} PDB: 2q1l_A* 2q6c_A* 2q6b_A* 3bgl_A* 3cct_A* 3ccw_A* 3ccz_A* 3cd0_A* 3cd5_A* 3cd7_A* 3cda_A* 3cdb_A* 1dqa_A* 1dq9_A* 1dq8_A* 1hw8_A* 1hw9_A* 1hwi_A* 1hwj_A* 1hwk_A* ... Back     alignment and structure
Probab=100.00  E-value=0  Score=820.28  Aligned_cols=343  Identities=35%  Similarity=0.519  Sum_probs=330.4

Q ss_pred             CCCCCEEEEEEEEEEECCEEECCCCCCCCEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCEEEEEEEEECCHH
Q ss_conf             97641037861127603756765136774788653034538999989999999559988999967922412599858977
Q gi|255764509|r    1 MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAE   80 (351)
Q Consensus         1 m~en~IG~~~lPlGia~~l~InG~~a~~~y~VPMATeE~SvVAAas~gak~~~~~sGG~~t~~~~~~m~r~~~f~~~~~~   80 (351)
                      ++||+||+++||+||||||+|||+    +|+|||||||||||||+|||||++ +.+|||++++.++.|+|+|+|.|.+..
T Consensus        92 ~~EN~IG~~~lPlGVAgpl~InGk----~y~VPMATeEgSvVASasrGaK~i-~~~GG~~t~v~~d~m~r~pv~~~~~~~  166 (441)
T 2r4f_A           92 CCENVIGYMPIPVGVAGPLCLDEK----EFQVPMATTEGCLVASTNRGCRAI-GLGGGASSRVLADGMTRGPVVRLPRAC  166 (441)
T ss_dssp             TBSSEEEEEEEEEEEEEEEEETTE----EEEEEEECCCTTHHHHHHHHHHHH-HHTTCBEEEEEEEEEEECCEEECSSHH
T ss_pred             CCCCEEEEEECCEEEECCEEECCC----EEEEEEEECHHHHHHHHHHHHHHH-HCCCCEEEEECCCCEEEEEEEEECCHH
T ss_conf             755010146213157636798795----899877753778999998899998-707986999857864885599958768


Q ss_pred             HHHHHHHHHH--HHHHHHHHHHHHCCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             8999997617--50999999973015780478888787388699999997320067215889999999999986798148
Q gi|255764509|r   81 MALTALQEIT--LKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHY  158 (351)
Q Consensus        81 ~a~~~~~~i~--~~~~~i~~~a~~~sr~ggl~~i~~~~~g~~v~l~~~~dt~DAMGaNmvnt~~E~v~~~i~~~~~~~~~  158 (351)
                      ++.+|..|+.  ++++.+++.+++++||||++++++...+++++|+|.|||||||||||||+++|+++++|+++|++.++
T Consensus       167 ~a~~~~~~~~~~e~~~~i~~~~~stsr~g~l~~i~~~~~g~~l~lrf~~dTgDAMGaNmVn~~~E~~~~~l~~~~~~~~~  246 (441)
T 2r4f_A          167 DSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQI  246 (441)
T ss_dssp             HHHHHHHHHHSHHHHHHHHHHHHTTCSSCEECCCEEEEETTEEEEEEEEECTTBCCHHHHHHHHHHHHHHHHHHCTTCEE
T ss_pred             HHHHHHHHHHCHHHHHHHHHHHCCCCCCCCCCEEEEEEECCEEEEEEEECHHHHHCCHHHHHHHHHHHHHHHHHCCCCCE
T ss_conf             89999997638577999987610555400032588764077799999974343111047889999999999986787735


Q ss_pred             EEECCCCCHHHHHHHHHHCCCCCCEEEEEEEECHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCHHHCCCCCHHHHHHHH
Q ss_conf             97347743123335543103772079999875699997573899999998878665655422002202162166778888
Q gi|255764509|r  159 GSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAY  238 (351)
Q Consensus       159 ~~ilsN~~tdkk~s~~n~~~~rG~~V~Ae~~i~~~~~~~~l~~~~e~~~~~~~~~~~~a~~~~~~a~t~NkgimNgI~Av  238 (351)
                      ++|+||||+|||+++.|++.+||++|+||+.||.++++++++++++++++.+..++.++++++||++|||||+||||+||
T Consensus       247 l~I~sN~~tdkk~sa~n~i~grGk~vvae~~i~~~vv~~vlk~~~~~l~~~~~~k~~igsa~~~~~~~~N~~iaNgI~AV  326 (441)
T 2r4f_A          247 LAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAI  326 (441)
T ss_dssp             EESCCSCSCCSSCCHHHHHHCCEEEEEEEEEECHHHHHHTSSSCHHHHHHHHHHHHTHHHHHTTCSSEESSSHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHEEEECCCCCEEEEEECCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             87525306655402214651555255321002599999997017899999999888988761202355432133337999


Q ss_pred             HHHCCCCHHHHHHHCCCEEEEEEE---CCEEEEEEEECCEEEEEECCCCCCHHHHHHHHHHCCCCCCC--CCCCHHHHHH
Q ss_conf             876276378888640320256872---89089999805646773066446888999998608687788--7769889999
Q gi|255764509|r  239 YLATGQDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNARRLAA  313 (351)
Q Consensus       239 ~lATGnD~a~v~a~~~a~t~~~~~---~~~L~g~i~lPsl~vGtVGG~t~lp~~~~~l~ilg~~~~~~--~~~~A~~La~  313 (351)
                      |||||||||++++++|+||.|+..   +++|++++|||||+||||||+|+||+||+||+||||.|.++  +.+||++||+
T Consensus       327 ~lATGqD~a~v~~ss~~~t~~e~~~~~~~dL~~sitlPsL~VGTVGGgT~l~pq~~~L~iLgv~g~~~~~p~~nA~~LA~  406 (441)
T 2r4f_A          327 YIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR  406 (441)
T ss_dssp             HHHTTCCGGGHHHHTCEEEEEEEESTTSCEEEEEEEEEEECCCSBSGGGGSHHHHHHHHHTTCCSCCSSSTTHHHHHHHH
T ss_pred             HHHHCCCHHHHHHHCCEEEEEEEEECCCCCEEEEEEECCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHH
T ss_conf             99952768887530563688888865899099999956864798577567666999999739887688898727999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCC
Q ss_conf             999999888999999880788689999872603367
Q gi|255764509|r  314 ICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN  349 (351)
Q Consensus       314 iiAavgLAqnlaal~Al~t~G~iq~gHmkl~R~~~~  349 (351)
                      ||||+|||||||+|+||++.| ||+|||||+|++++
T Consensus       407 IiAa~gLA~nlsal~ALat~g-iqkgHM~l~R~~~~  441 (441)
T 2r4f_A          407 IVCGTVMAGELSLMAALAAGH-LVKSHMIHNRSKIN  441 (441)
T ss_dssp             HHHHHHHHHHHHHHHHHHHC----------------
T ss_pred             HHHHHHHHHHHHHHHHHHCCH-HHHHHHHHHCCCCC
T ss_conf             999999999999999987170-89999998545799



>1r31_A 3-hydroxy-3-methylglutaryl-coenzyme A reductase; 4-electron oxido-reductase, oxidoreductase; HET: COA MEV; 2.10A {Pseudomonas mevalonii} SCOP: d.58.20.1 d.179.1.1 PDB: 1qay_A* 1qax_A* 1r7i_A 1t02_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 351 hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [C
d1dqaa4292 d.179.1.1 (A:462-586,A:704-870) Substrate-binding domai 1e-39
d1dqaa4292 d.179.1.1 (A:462-586,A:704-870) Substrate-binding domai 5e-06
d1dqaa1117 d.58.20.1 (A:587-703) NAD-binding domain of HMG-CoA red 2e-31
d1r31a2266 d.179.1.1 (A:3-110,A:221-378) Substrate-binding domain 4e-10
>d1dqaa4 d.179.1.1 (A:462-586,A:704-870) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Substrate-binding domain of HMG-CoA reductase
superfamily: Substrate-binding domain of HMG-CoA reductase
family: Substrate-binding domain of HMG-CoA reductase
domain: Substrate-binding domain of HMG-CoA reductase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  157 bits (399), Expect = 1e-39
 Identities = 66/169 (39%), Positives = 97/169 (57%), Gaps = 6/169 (3%)

Query: 180 RGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYY 239
             K+ V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y
Sbjct: 124 ADKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIY 183

Query: 240 LATGQDAANIVEGSQGLTYA---KLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTAL 296
           +A GQDAA  V  S  +T        ++ LY SCT+P++ +G VG G N+   +  L  L
Sbjct: 184 IACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQML 243

Query: 297 GCIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRL 343
           G     K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+  
Sbjct: 244 GVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA-GHLVKSHMIH 291


>d1dqaa4 d.179.1.1 (A:462-586,A:704-870) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1dqaa1 d.58.20.1 (A:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1r31a2 d.179.1.1 (A:3-110,A:221-378) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]} Length = 266 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target351 hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [C
d1dqaa4292 Substrate-binding domain of HMG-CoA reductase {Human (H 100.0
d1r31a2266 Substrate-binding domain of HMG-CoA reductase {Pseudomo 100.0
d1dqaa1117 NAD-binding domain of HMG-CoA reductase {Human (Homo sa 100.0
d1r31a1110 NAD-binding domain of HMG-CoA reductase {Pseudomonas me 99.92
d1r31a2266 Substrate-binding domain of HMG-CoA reductase {Pseudomo 90.67
>d1dqaa4 d.179.1.1 (A:462-586,A:704-870) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Substrate-binding domain of HMG-CoA reductase
superfamily: Substrate-binding domain of HMG-CoA reductase
family: Substrate-binding domain of HMG-CoA reductase
domain: Substrate-binding domain of HMG-CoA reductase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=0  Score=524.88  Aligned_cols=223  Identities=35%  Similarity=0.538  Sum_probs=206.1

Q ss_pred             CCCCCEEEEEEEEEEECCEEECCCCCCCCEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCEEEEEEEEECCHH
Q ss_conf             97641037861127603756765136774788653034538999989999999559988999967922412599858977
Q gi|255764509|r    1 MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAE   80 (351)
Q Consensus         1 m~en~IG~~~lPlGia~~l~InG~~a~~~y~VPMATeE~SvVAAas~gak~~~~~sGG~~t~~~~~~m~r~~~f~~~~~~   80 (351)
                      ++||+||+++||+|||+||+|||+    +|+|||||||||||||+|||||+ ++.+|||++.+.++              
T Consensus        65 ~~EN~IG~~~lPlGvAgpl~InG~----~y~VPMATeEgslVAS~nrGaK~-i~~~GG~~~~v~~d--------------  125 (292)
T d1dqaa4          65 CCENVIGYMPIPVGVAGPLCLDEK----EFQVPMATTEGCLVASTNRGCRA-IGLGGGASSRVLAD--------------  125 (292)
T ss_dssp             TCSSEEEEEEEEEEEEEEEEETTE----EEEEEEECSCTTHHHHHHHHHHH-HHHTTCBEEEEEEE--------------
T ss_pred             CCCCEEEEEECCCEEECCEEECCE----EEEEEEEECHHHHHHHHHHHHHH-HHHCCCCEEEEEHH--------------
T ss_conf             852014667445046506798890----78986542140799876579899-98539988998021--------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             89999976175099999997301578047888878738869999999732006721588999999999998679814897
Q gi|255764509|r   81 MALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS  160 (351)
Q Consensus        81 ~a~~~~~~i~~~~~~i~~~a~~~sr~ggl~~i~~~~~g~~v~l~~~~dt~DAMGaNmvnt~~E~v~~~i~~~~~~~~~~~  160 (351)
                                                                                                      
T Consensus       126 --------------------------------------------------------------------------------  125 (292)
T d1dqaa4         126 --------------------------------------------------------------------------------  125 (292)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
T ss_conf             --------------------------------------------------------------------------------


Q ss_pred             ECCCCCHHHHHHHHHHCCCCCCEEEEEEEECHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCHHHCCCCCHHHHHHHHHH
Q ss_conf             34774312333554310377207999987569999757389999999887866565542200220216216677888887
Q gi|255764509|r  161 VSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL  240 (351)
Q Consensus       161 ilsN~~tdkk~s~~n~~~~rG~~V~Ae~~i~~~~~~~~l~~~~e~~~~~~~~~~~~a~~~~~~a~t~NkgimNgI~Av~l  240 (351)
                                           +.+.++..+|.++++++++++++++.+.+..++.++++.++.+.+||||+||||+||||
T Consensus       126 ---------------------~~~~a~~~~~~~vv~~~Lk~~~e~l~~~~~~~nl~gsa~ag~~~g~N~~i~NgI~Av~l  184 (292)
T d1dqaa4         126 ---------------------KSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYI  184 (292)
T ss_dssp             ---------------------EEEEEEEEECHHHHHHTTSSCHHHHHHHHHHHHTHHHHHTTCSSEESSSHHHHHHHHHH
T ss_pred             ---------------------HHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             ---------------------11122115708999999807999999998778899999974111210567657788776


Q ss_pred             HCCCCHHHHHHHCCCEEEEE---EECCEEEEEEEECCEEEEEECCCCCCHHHHHHHHHHCCCCCCC--CCCCHHHHHHHH
Q ss_conf             62763788886403202568---7289089999805646773066446888999998608687788--776988999999
Q gi|255764509|r  241 ATGQDAANIVEGSQGLTYAK---LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNARRLAAIC  315 (351)
Q Consensus       241 ATGnD~a~v~a~~~a~t~~~---~~~~~L~g~i~lPsl~vGtVGG~t~lp~~~~~l~ilg~~~~~~--~~~~A~~La~ii  315 (351)
                      |||||||++++++|+|+..+   .++++|++++|||||+||||||+|+||+||+||+||||+++++  +.+||++||+||
T Consensus       185 ATGqD~a~v~~ss~a~t~~~~~~~~~~~L~~s~tlPsl~VGtVGGgT~l~~q~~~L~iLgv~g~~~~~p~~nA~~LA~Ii  264 (292)
T d1dqaa4         185 ACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIV  264 (292)
T ss_dssp             HTTCCGGGHHHHTCEEEEEEEETTTTCEEEEEEEEEEECCCSBSGGGGSHHHHHHHHHHTCCSCCSSSTTHHHHHHHHHH
T ss_pred             HCCCHHHHHHHHHCCEEEEEEEECCCCCEEEEEEECCEEEEECCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
T ss_conf             63542999987404137888997189977999982240566415766580599999984877767888760799999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHC
Q ss_conf             99998889999998807886899998726
Q gi|255764509|r  316 AATVLCGELSLLAAQTNPGELMEAHLRLE  344 (351)
Q Consensus       316 AavgLAqnlaal~Al~t~G~iq~gHmkl~  344 (351)
                      ||+|||||||+|+||++.| ||+|||||+
T Consensus       265 aa~~LA~els~l~ALat~~-i~~~HMk~n  292 (292)
T d1dqaa4         265 CGTVMAGELSLMAALAAGH-LVKSHMIHN  292 (292)
T ss_dssp             HHHHHHHHHHHHHHHHHTC-HHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCC-HHHHHHCCC
T ss_conf             9999999999999987471-788761129



>d1r31a2 d.179.1.1 (A:3-110,A:221-378) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]} Back     information, alignment and structure
>d1dqaa1 d.58.20.1 (A:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r31a1 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]} Back     information, alignment and structure
>d1r31a2 d.179.1.1 (A:3-110,A:221-378) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 351 hydroxymethylglutaryl-coenzyme A (HMG-CoA) reducta
2r4f_A_86-153_259-441251 (A:86-153,A:259-441) 3-hydroxy-3-methylglutaryl-co 5e-48
1r31_A_56-109_219-428264 (A:56-109,A:219-428) 3-hydroxy-3-methylglutaryl-co 3e-39
2r4f_A_154-258105 (A:154-258) 3-hydroxy-3-methylglutaryl-coenzyme A 8e-25
>2r4f_A (A:86-153,A:259-441) 3-hydroxy-3-methylglutaryl-coenzyme A reductase; oxidoreductase, cholesterol, biocynthesis, HMG-COA, NADPH, statin, alternative splicing; HET: RIE; 1.70A {Homo sapiens} PDB: 2q1l_A* 2q6c_A* 2q6b_A* 3bgl_A* 3cct_A* 3ccw_A* 3ccz_A* 3cd0_A* 3cd5_A* 3cd7_A* 3cda_A* 3cdb_A* 1dqa_A* 1dq9_A* 1dq8_A* 1hw8_A* 1hw9_A* 1hwi_A* 1hwj_A* 1hwk_A* ...Length = 251 Back     alignment and structure
 Score =  186 bits (473), Expect = 5e-48
 Identities = 75/184 (40%), Positives = 108/184 (58%), Gaps = 6/184 (3%)

Query: 171 ATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAH 230
             AIN I GRGK+ V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH
Sbjct: 69  PAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAH 128

Query: 231 FANMLLAYYLATGQDAANIVEGSQGLT---YAKLHDDSLYFSCTIPNLILGCVGNGKNIP 287
            AN++ A Y+A GQDAA  V  S  +T    +   ++ LY SCT+P++ +G VG G N+ 
Sbjct: 129 AANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLL 188

Query: 288 AIKNNLTALGCIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             +  L  LG     K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R
Sbjct: 189 PQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA-GHLVKSHMIHNR 247

Query: 346 MHLN 349
             +N
Sbjct: 248 SKIN 251


>1r31_A (A:56-109,A:219-428) 3-hydroxy-3-methylglutaryl-coenzyme A reductase; 4-electron oxido-reductase, oxidoreductase; HET: COA MEV; 2.10A {Pseudomonas mevalonii}Length = 264 Back     alignment and structure
>2r4f_A (A:154-258) 3-hydroxy-3-methylglutaryl-coenzyme A reductase; oxidoreductase, cholesterol, biocynthesis, HMG-COA, NADPH, statin, alternative splicing; HET: RIE; 1.70A {Homo sapiens} PDB: 2q1l_A* 2q6c_A* 2q6b_A* 3bgl_A* 3cct_A* 3ccw_A* 3ccz_A* 3cd0_A* 3cd5_A* 3cd7_A* 3cda_A* 3cdb_A* 1dqa_A* 1dq9_A* 1dq8_A* 1hw8_A* 1hw9_A* 1hwi_A* 1hwj_A* 1hwk_A* ...Length = 105 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target351 hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [C
2r4f_A_86-153_259-441251 3-hydroxy-3-methylglutaryl-coenzyme A reductase; o 100.0
1r31_A_56-109_219-428264 3-hydroxy-3-methylglutaryl-coenzyme A reductase; 4 100.0
2r4f_A_154-258105 3-hydroxy-3-methylglutaryl-coenzyme A reductase; o 99.96
1r31_A_110-218109 3-hydroxy-3-methylglutaryl-coenzyme A reductase; 4 99.93
>2r4f_A (A:86-153,A:259-441) 3-hydroxy-3-methylglutaryl-coenzyme A reductase; oxidoreductase, cholesterol, biocynthesis, HMG-COA, NADPH, statin, alternative splicing; HET: RIE; 1.70A {Homo sapiens} PDB: 2q1l_A* 2q6c_A* 2q6b_A* 3bgl_A* 3cct_A* 3ccw_A* 3ccz_A* 3cd0_A* 3cd5_A* 3cd7_A* 3cda_A* 3cdb_A* 1dqa_A* 1dq9_A* 1dq8_A* 1hw8_A* 1hw9_A* 1hwi_A* 1hwj_A* 1hwk_A* ... Back     alignment and structure
Probab=100.00  E-value=0  Score=579.56  Aligned_cols=240  Identities=36%  Similarity=0.547  Sum_probs=223.8

Q ss_pred             CCCCCEEEEEEEEEEECCEEECCCCCCCCEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCEEEEEEEEECCHH
Q ss_conf             97641037861127603756765136774788653034538999989999999559988999967922412599858977
Q gi|255764509|r    1 MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAE   80 (351)
Q Consensus         1 m~en~IG~~~lPlGia~~l~InG~~a~~~y~VPMATeE~SvVAAas~gak~~~~~sGG~~t~~~~~~m~r~~~f~~~~~~   80 (351)
                      ||||+||+++||+|||+||+|||+    +|+|||||||||||||+|||||+ ++.+|||++.++++.             
T Consensus         7 ~iEN~IG~~~vPlGva~~l~InG~----~~~vPmAteE~svVAs~srgak~-i~~~GG~~~~v~~~g-------------   68 (251)
T 2r4f_A            7 CCENVIGYMPIPVGVAGPLCLDEK----EFQVPMATTEGCLVASTNRGCRA-IGLGGGASSRVLADG-------------   68 (251)
T ss_dssp             TBSSEEEEEEEEEEEEEEEEETTE----EEEEEEECCCTTHHHHHHHHHHH-HHHTTCBEEEEEEEE-------------
T ss_pred             CCCCEEEEEECCEEEECCEEECCE----EEEEEEEEEHHHHHHHHHHHHHH-HHCCCCEEEEECCCC-------------
T ss_conf             765100045212079647899687----99887675077899999889999-871798499985785-------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             89999976175099999997301578047888878738869999999732006721588999999999998679814897
Q gi|255764509|r   81 MALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS  160 (351)
Q Consensus        81 ~a~~~~~~i~~~~~~i~~~a~~~sr~ggl~~i~~~~~g~~v~l~~~~dt~DAMGaNmvnt~~E~v~~~i~~~~~~~~~~~  160 (351)
                                                                                                      
T Consensus        69 --------------------------------------------------------------------------------   68 (251)
T 2r4f_A           69 --------------------------------------------------------------------------------   68 (251)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
T ss_conf             --------------------------------------------------------------------------------


Q ss_pred             ECCCCCHHHHHHHHHHCCCCCCEEEEEEEECHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCHHHCCCCCHHHHHHHHHH
Q ss_conf             34774312333554310377207999987569999757389999999887866565542200220216216677888887
Q gi|255764509|r  161 VSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL  240 (351)
Q Consensus       161 ilsN~~tdkk~s~~n~~~~rG~~V~Ae~~i~~~~~~~~l~~~~e~~~~~~~~~~~~a~~~~~~a~t~NkgimNgI~Av~l  240 (351)
                                +++.|++.+||++|+||+.||.+++++++++++|++++++..++.++++|+||+.|||||+||||+|+||
T Consensus        69 ----------~s~~n~~~gRg~~Viae~~i~~~~~~~~l~~~~e~l~~~~~~~~~~a~~~~~ra~t~Nkgi~NgI~Av~l  138 (251)
T 2r4f_A           69 ----------PAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYI  138 (251)
T ss_dssp             ----------CCHHHHHHCCEEEEEEEEEECHHHHHHTSSSCHHHHHHHHHHHHTHHHHHTTCSSEESSSHHHHHHHHHH
T ss_pred             ----------HHHEEEECCCEEEEEHHHCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHH
T ss_conf             ----------1322444153037521104619999988701699999999998898876442246644410012144443


Q ss_pred             HCCCCHHHHHHHCCCEE---EEEEECCEEEEEEEECCEEEEEECCCCCCHHHHHHHHHHCCCCCCCC--CCCHHHHHHHH
Q ss_conf             62763788886403202---56872890899998056467730664468889999986086877887--76988999999
Q gi|255764509|r  241 ATGQDAANIVEGSQGLT---YAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT--GDNARRLAAIC  315 (351)
Q Consensus       241 ATGnD~a~v~a~~~a~t---~~~~~~~~L~g~i~lPsl~vGtVGG~t~lp~~~~~l~ilg~~~~~~~--~~~A~~La~ii  315 (351)
                      |||||||+|+|++|+|+   ||+.++++|++++|||||+||||||+|++|+||+||+||||+++++.  .+||++||+||
T Consensus       139 ATGqD~raV~~~~~a~a~~~~~~~~~~~L~~sitlPsl~VGtVGGgt~lp~~~~~L~ilg~~g~~~~~~~~~A~~LA~Ii  218 (251)
T 2r4f_A          139 ACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIV  218 (251)
T ss_dssp             HTTCCGGGHHHHTCEEEEEEEESTTSCEEEEEEEEEEECCCSBSGGGGSHHHHHHHHHTTCCSCCSSSTTHHHHHHHHHH
T ss_pred             HHCCCHHHHHHHCCEEEEEEEEECCCCEEEEEEEECCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
T ss_conf             63386788875225148878876589909999994682079746867765699999983988768889870899999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCC
Q ss_conf             9999888999999880788689999872603367
Q gi|255764509|r  316 AATVLCGELSLLAAQTNPGELMEAHLRLERMHLN  349 (351)
Q Consensus       316 AavgLAqnlaal~Al~t~G~iq~gHmkl~R~~~~  349 (351)
                      ||+|||||||+|+||+++| ||+|||||+|++++
T Consensus       219 aa~gLA~nlsal~Al~t~g-i~~gHm~L~r~~l~  251 (251)
T 2r4f_A          219 CGTVMAGELSLMAALAAGH-LVKSHMIHNRSKIN  251 (251)
T ss_dssp             HHHHHHHHHHHHHHHHHC----------------
T ss_pred             HHHHHHHHHHHHHHHHCCC-HHHHHHHHHCCCCC
T ss_conf             9999999999999987070-89999998445799



>1r31_A (A:56-109,A:219-428) 3-hydroxy-3-methylglutaryl-coenzyme A reductase; 4-electron oxido-reductase, oxidoreductase; HET: COA MEV; 2.10A {Pseudomonas mevalonii} Back     alignment and structure
>2r4f_A (A:154-258) 3-hydroxy-3-methylglutaryl-coenzyme A reductase; oxidoreductase, cholesterol, biocynthesis, HMG-COA, NADPH, statin, alternative splicing; HET: RIE; 1.70A {Homo sapiens} PDB: 2q1l_A* 2q6c_A* 2q6b_A* 3bgl_A* 3cct_A* 3ccw_A* 3ccz_A* 3cd0_A* 3cd5_A* 3cd7_A* 3cda_A* 3cdb_A* 1dqa_A* 1dq9_A* 1dq8_A* 1hw8_A* 1hw9_A* 1hwi_A* 1hwj_A* 1hwk_A* ... Back     alignment and structure
>1r31_A (A:110-218) 3-hydroxy-3-methylglutaryl-coenzyme A reductase; 4-electron oxido-reductase, oxidoreductase; HET: COA MEV; 2.10A {Pseudomonas mevalonii} Back     alignment and structure