254781024

254781024

electron transfer flavoprotein-ubiquinone oxidoreductase

GeneID in NCBI database:8210047Locus tag:CLIBASIA_04630
Protein GI in NCBI database:254781024Protein Accession:YP_003065437.1
Gene range:+(1024397, 1026061)Protein Length:554aa
Gene description:electron transfer flavoprotein-ubiquinone oxidoreductase
COG prediction:[C] Dehydrogenases (flavoproteins)
KEGG prediction:electron transfer flavoprotein-ubiquinone oxidoreductase; K00311 electron-transferring-flavoprotein dehydrogenase [EC:1.5.5.1]
SEED prediction:Electron transfer flavoprotein-ubiquinone oxidoreductase (EC 1.5.5.1)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Anaerobic respiratory reductases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550----
MNSCDILHNKDVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKNKAEALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKHYIAPMLLLSKYMLVGEGACGSLTRQLIERYSLMDGRQPQKFGLGIKELWKIKPQYHRRGLALHSIGWPLDMNTSGGGFVYHFDDNLVSIGFVLHLDYRNPWISAYEELQRFKTHPDIRIIFTEGERLEYGARVISEGGWQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLSNGKKHDDPIEIEDSWRQTQIGKDLWIIRNIKPLLSRFGVFIGLSLGLMDIWIQKILGFSFLGTLKHHKMDSCSLEAASQHKKIDYPKPDGKLTFDIMSSLFLAKVKYVKEQPMHLLIKDKDLQKKSELRIYSGPSMRYCPAGVYEWHQNNDENNYIIHAQNCIHCKACVIKDPNQNIEWNPPQGGDGPHYVDM
ccccccccccccccccEEEEcccHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHcEEEEEcccccEEcccccccccccccccEEEEHHHHHHHHHHHHHHcccEEEcccEEEEEEEccccEEEEEEEcccccccccccccccccccEEEEEEEEEccccccHHHHHHHHHccccccccccEEEEEEEEEEEcccccccccEEEEEEccccccccccEEEEEEccccEEEEEEEEccccccccccHHHHHHHHHHcHHHHHHHcccEEEEcccccccccccccccEEEcccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccccccccEEEEccHHHHHccccccccccEEEEEccHHHHHHHccHHHccccccccccEEEEEEEcccccEEEEEccccEEccccccccccccEEEEccccccccccccc
ccccccccccccccEEEEEEcccHHHHHHHHHHHHcccccEEEEEEccccHcHHHcccccccHHHHHHHcccHHHHcccccccccccccEEEEccccccccccccccccccccccEEEEccHHHHHHHHHHHHHccEEcccccHHHHHEcccccEEEEEEcccccccccccccccccccEEEcEEEEEccccccHHHHHHHHHccccccccccHcEEEEEEEEcccHHHccccEEEEEcccccccccccccEEEEccccEEEEEEEEEccccccccccHHHHHHHcccHHHHHHHccccEEEEcHHHHHcccccccccccccccEEEEcccccccHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEcccccccHHHHccHHHccccccccccccEEEccccEEEEEcccccccccEEEEEccccccccccHHHccccccccccccEEEEEEcccccEEEEEccccEEccccccccccccEEEEccccccccccccc
mnscdilhnkdvfeYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHIlsgaiidpigidsllprwredkghpfhtvVKRDLYWFLNaqrsiqiphfclpdfmdnkeHYIVSLGQVCRWLKNKAEALGVEIYCGFTAteiyygkkgealgiltgekgknydgtqgkhyiaPMLLLSKYMLVGEGACGSLTRQLIERYslmdgrqpqkfglgikELWKIkpqyhrrglalhsigwpldmntsgggfvyhfddnlVSIGFVLhldyrnpwISAYEELQrfkthpdiriiftegerlEYGARviseggwqsvpklsfpggsligCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLsngkkhddpieiedswrqtqigkdlWIIRNIKPLLSRFGVFIGLSLGLMDIWIQKILgfsflgtlkhhkmdscsleaasqhkkidypkpdgklTFDIMSSLFLAKVKYvkeqpmhllikdkdlqkkselriysgpsmrycpagvyewhqnndennyIIHAQNcihckacvikdpnqniewnppqggdgphyvdm
MNSCDILHNKDVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKNKAEALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKHYIAPMLLLSKYMLVGEGACGSLTRQLIERYSLMDGRQPQKFGLGIKELWKIKPQYHRRGLALHSIGWPLDMNTSGGGFVYHFDDNLVSIGFVLHLDYRNPWISAYEELQRFKTHPDIRIIFTEGERLEYGARVISEGGWQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLSngkkhddpieiedswrqtqigkdLWIIRNIKPLLSRFGVFIGLSLGLMDIWIQKILGFSFLGTLKHHKMDSCSLEAASQHKKIDYPKPDGKLTFDIMSSLFLAKVKYVKEQPMhllikdkdlqkkSELRIYSGPSMRYCPAGVYEWHQNNDENNYIIHAQNCIHCKACVIKDPNQNIewnppqggdgphyvdm
MNSCDILHNKDVFEYDVViigagpaglaaaiRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKNKAEALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKHYIAPMLLLSKYMLVGEGACGSLTRQLIERYSLMDGRQPQKFGLGIKELWKIKPQYHRRGLALHSIGWPLDMNTSGGGFVYHFDDNLVSIGFVLHLDYRNPWISAYEELQRFKTHPDIRIIFTEGERLEYGARVISEGGWQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLSNGKKHDDPIEIEDSWRQTQIGKDLWIIRNIKPLLSRFGVFIGLSLGLMDIWIQKILGFSFLGTLKHHKMDSCSLEAASQHKKIDYPKPDGKLTFDIMSSLFLAKVKYVKEQPMHLLIKDKDLQKKSELRIYSGPSMRYCPAGVYEWHQNNDENNYIIHAQNCIHCKACVIKDPNQNIEWNPPQGGDGPHYVDM
**********DVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKNKAEALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKHYIAPMLLLSKYMLVGEGACGSLTRQLIERYSLMDGRQPQKFGLGIKELWKIKPQYHRRGLALHSIGWPLDMNTSGGGFVYHFDDNLVSIGFVLHLDYRNPWISAYEELQRFKTHPDIRIIFTEGERLEYGARVISEGGWQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLSNGKKHDDPIEIEDSWRQTQIGKDLWIIRNIKPLLSRFGVFIGLSLGLMDIWIQKILGFSFLGTLKHHKMDSCSLEAASQHKKIDYPKPDGKLTFDIMSSLFLAKVKYVKEQPMHLLIKDKDLQKKSELRIYSGPSMRYCPAGVYEWHQNNDENNYIIHAQNCIHCKACVIKDPNQNIEWNPPQGGDGP*Y***
MNSCDILHNKDVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKNKAEALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKHYIAPMLLLSKYMLVGEGACGSLTRQLIERYSLMDGRQPQKFGLGIKELWKIKPQYHRRGLALHSIGWPLDMNTSGGGFVYHFDDNLVSIGFVLHLDYRNPWISAYEELQRFKTHPDIRIIFTEGERLEYGARVISEGGWQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLSNGKKHDDPIEIEDSWRQTQIGKDLWIIRNIKPLLSRFGVFIGLSLGLMDIWIQKILGFSFLGTLKHHKMDSCSLEAASQHKKIDYPKPDGKLTFDIMSSLFLAKVKYVKEQPMHLLIKDKDLQKKSELRIYSGPSMRYCPAGVYEWHQNNDENNYIIHAQNCIHCKACVIKDPNQNIEWNPPQGGDGPHYVDM
**********DVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKNKAEALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKHYIAPMLLLSKYMLVGEGACGSLTRQLIERYSLMDGRQPQKFGLGIKELWKIKPQYHRRGLALHSIGWPLDMNTSGGGFVYHFDDNLVSIGFVLHLDYRNPWISAYEELQRFKTHPDIRIIFTEGERLEYGARVISEGGWQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLSNGKKHDDPIEIEDSWRQTQIGKDLWIIRNIKPLLSRFGVFIGLSLGLMDIWIQKILGFSFLGTLKHHKMDSCSLEAASQHKKIDYPKPDGKLTFDIMSSLFLAKVKYVKEQPMHLLIKDKDLQKKSELRIYSGPSMRYCPAGVYEWHQNNDENNYIIHAQNCIHCKACVIKDPNQNIEWNPPQGGDG******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSCDILHNKDVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKNKAEALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKHYIAPMLLLSKYMLVGEGACGSLTRQLIERYSLMDGRQPQKFGLGIKELWKIKPQYHRRGLALHSIGWPLDMNTSGGGFVYHFDDNLVSIGFVLHLDYRNPWISAYEELQRFKTHPDIRIIFTEGERLEYGARVISEGGWQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLSNGKKHDDPIEIEDSWRQTQIGKDLWIIRNIKPLLSRFGVFIGLSLGLMDIWIQKILGFSFLGTLKHHKMDSCSLEAASQHKKIDYPKPDGKLTFDIMSSLFLAKVKYVKEQPMHLLIKDKDLQKKSELRIYSGPSMRYCPAGVYEWHQNNDENNYIIHAQNCIHCKACVIKDPNQNIEWNPPQGGDGPHYVDM
MNSCDILHNKDVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKNKAEALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKHYIAPMLLLSKYMLVGEGACGSLTRQLIERYSLMDGRQPQKFGLGIKELWKIKPQYHRRGLALHSIGWPLDMNTSGGGFVYHFDDNLVSIGFVLHLDYRNPWISAYEELQRFKTHPDIRIIFTEGERLEYGARVISEGGWQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLSNGKKHDDPIEIEDSWRQTQIGKDLWIIRNIKPLLSRFGVFIGLSLGLMDIWIQKILGFSFLGTLKHHKMDSCSLEAASQHKKIDYPKPDGKLTFDIMSSLFLAKVKYVKEQPMHLLIKDKDLQKKSELRIYSGPSMRYCPAGVYEWHQNNDENNYIIHAQNCIHCKACVIKDPNQNIEWNPPQGGDGPHYVDM
MNSCDILHNKDVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKNKAEALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKHYIAPMLLLSKYMLVGEGACGSLTRQLIERYSLMDGRQPQKFGLGIKELWKIKPQYHRRGLALHSIGWPLDMNTSGGGFVYHFDDNLVSIGFVLHLDYRNPWISAYEELQRFKTHPDIRIIFTEGERLEYGARVISEGGWQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLSNGKKHDDPIEIEDSWRQTQIGKDLWIIRNIKPLLSRFGVFIGLSLGLMDIWIQKILGFSFLGTLKHHKMDSCSLEAASQHKKIDYPKPDGKLTFDIMSSLFLAKVKYVKEQPMHLLIKDKDLQKKSELRIYSGPSMRYCPAGVYEWHQNNDENNYIIHAQNCIHCKACVIKDPNQNIEWNPPQGGDGPHYVDM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target554 electron transfer flavoprotein-ubiquinone oxidoreductas
254780675481 dihydrolipoamide dehydrogenase [Candidatus Liberib 0.002
254781053466 dihydrolipoamide dehydrogenase [Candidatus Liberib 0.002
>gi|254780675|ref|YP_003065088.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 481 Back     alignment
 Score = 35.8 bits (81), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (75%)

Query: 15 YDVVIIGAGPAGLAAAIRCKQINPHLSVV 43
          YD+++IG+GPAG  AAIR  Q+   +++V
Sbjct: 5  YDIILIGSGPAGYVAAIRAAQLGFKVAIV 33

>gi|254781053|ref|YP_003065466.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 466 Back     alignment
 Score = 35.4 bits (80), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 15 YDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKS 48
          YDV ++G GPAG A AI+  Q+   ++++  EK+
Sbjct: 3  YDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKT 36

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target554 electron transfer flavoprotein-ubiquinone oxidoreductas
315122605552 electron transfer flavoprotein-ubiquinone oxidoreductas 1 0.0
209548545554 electron-transferring-flavoprotein dehydrogenase [Rhizo 1 0.0
222085334554 electrotransfer ubiquinone oxidoreductase protein [Agro 1 0.0
161618596563 electron transfer flavoprotein-ubiquinone oxidoreductas 1 0.0
15888337554 electrotransfer ubiquinone oxidoreductase [Agrobacteriu 1 0.0
23501508563 electron transfer flavoprotein-ubiquinone oxidoreductas 1 0.0
256060755563 Electron-transferring-flavoprotein dehydrogenase [Bruce 1 0.0
225627128563 electron transfer flavoprotein-ubiquinone oxidoreductas 1 0.0
163842896563 electron transfer flavoprotein-ubiquinone oxidoreductas 1 0.0
306845227563 electron transfer flavoprotein-ubiquinone oxidoreductas 1 0.0
>gi|315122605|ref|YP_004063094.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 552 Back     alignment and organism information
 Score =  920 bits (2378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/554 (81%), Positives = 501/554 (90%), Gaps = 2/554 (0%)

Query: 1   MNSCDILHNKDVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAI 60
           MN CD+ H +DV EY+VVI+GAGPAGLAAAIRCKQINP LSVV+LEKSAEVG HI+SGAI
Sbjct: 1   MNQCDMSHERDVLEYEVVIVGAGPAGLAAAIRCKQINPRLSVVVLEKSAEVGDHIISGAI 60

Query: 61  IDPIGIDSLLPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSL 120
           IDPIGID LLP WRE+   PFHT+V++D+YWFLN+++SIQIPHFC+PDFM NK +YIVSL
Sbjct: 61  IDPIGIDRLLPGWREES--PFHTLVEKDIYWFLNSKKSIQIPHFCMPDFMSNKGNYIVSL 118

Query: 121 GQVCRWLKNKAEALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKHYIAPML 180
           GQVCRWLK+KAEALG+EIYCGF AT IYYGK GEALG+ TGEKG+N DGT GK+YI P+L
Sbjct: 119 GQVCRWLKDKAEALGIEIYCGFVATGIYYGKNGEALGVFTGEKGRNSDGTLGKNYIPPIL 178

Query: 181 LLSKYMLVGEGACGSLTRQLIERYSLMDGRQPQKFGLGIKELWKIKPQYHRRGLALHSIG 240
           LLSKYML+GEGACGSLTRQLIERYSL DGRQPQKFGLGIKELWKIKPQYH +GL LHS G
Sbjct: 179 LLSKYMLIGEGACGSLTRQLIERYSLADGRQPQKFGLGIKELWKIKPQYHTKGLVLHSFG 238

Query: 241 WPLDMNTSGGGFVYHFDDNLVSIGFVLHLDYRNPWISAYEELQRFKTHPDIRIIFTEGER 300
           WPLDM  SGGGF+YHFD NLVSIGFVLHLDY NPW+SAYEE QRFKTHP IR IF EGER
Sbjct: 239 WPLDMGASGGGFIYHFDKNLVSIGFVLHLDYSNPWLSAYEEFQRFKTHPAIRTIFEEGER 298

Query: 301 LEYGARVISEGGWQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERL 360
           LEYGARVISEGGWQSVPKLSFPGGSLIGC+AGFVNL+RIKGSHNAI+SG+LAAEKIVERL
Sbjct: 299 LEYGARVISEGGWQSVPKLSFPGGSLIGCSAGFVNLVRIKGSHNAILSGILAAEKIVERL 358

Query: 361 SNGKKHDDPIEIEDSWRQTQIGKDLWIIRNIKPLLSRFGVFIGLSLGLMDIWIQKILGFS 420
           S G KHDDP++IE SWRQT IGKDLWI+RNIKPLLSRFG+ IGL LGL+DIWIQKI+GFS
Sbjct: 359 SQGYKHDDPVDIEYSWRQTDIGKDLWIVRNIKPLLSRFGLLIGLCLGLIDIWIQKIIGFS 418

Query: 421 FLGTLKHHKMDSCSLEAASQHKKIDYPKPDGKLTFDIMSSLFLAKVKYVKEQPMHLLIKD 480
           FLGTLKHHK D  SL+ A ++KKIDYPKPDGKLTFDIMSSLFL+K+ Y KEQP HL IKD
Sbjct: 419 FLGTLKHHKTDYSSLKPAIKYKKIDYPKPDGKLTFDIMSSLFLSKINYAKEQPTHLSIKD 478

Query: 481 KDLQKKSELRIYSGPSMRYCPAGVYEWHQNNDENNYIIHAQNCIHCKACVIKDPNQNIEW 540
           K+LQKKSE  +Y+GPSMRYCPAGVYEW+Q + +N YIIHAQNCIHCK CV+KDPNQNIEW
Sbjct: 479 KNLQKKSEFDVYAGPSMRYCPAGVYEWYQQDGKNTYIIHAQNCIHCKTCVVKDPNQNIEW 538

Query: 541 NPPQGGDGPHYVDM 554
           NPPQGGDGP+Y+DM
Sbjct: 539 NPPQGGDGPYYLDM 552


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209548545|ref|YP_002280462.1| electron-transferring-flavoprotein dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 554 Back     alignment and organism information
>gi|222085334|ref|YP_002543864.1| electrotransfer ubiquinone oxidoreductase protein [Agrobacterium radiobacter K84] Length = 554 Back     alignment and organism information
>gi|161618596|ref|YP_001592483.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Brucella canis ATCC 23365] Length = 563 Back     alignment and organism information
>gi|15888337|ref|NP_354018.1| electrotransfer ubiquinone oxidoreductase [Agrobacterium tumefaciens str. C58] Length = 554 Back     alignment and organism information
>gi|23501508|ref|NP_697635.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Brucella suis 1330] Length = 563 Back     alignment and organism information
>gi|256060755|ref|ZP_05450918.1| Electron-transferring-flavoprotein dehydrogenase [Brucella neotomae 5K33] Length = 563 Back     alignment and organism information
>gi|225627128|ref|ZP_03785166.1| electron transfer flavoprotein-ubiquinone oxidoreductase precursor [Brucella ceti str. Cudo] Length = 563 Back     alignment and organism information
>gi|163842896|ref|YP_001627300.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Brucella suis ATCC 23445] Length = 563 Back     alignment and organism information
>gi|306845227|ref|ZP_07477803.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Brucella sp. BO1] Length = 563 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target554 electron transfer flavoprotein-ubiquinone oxidoreductas
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy p 5e-68
pfam05187110 pfam05187, ETF_QO, Electron transfer flavoprotein-ubiqu 9e-32
PRK10015429 PRK10015, PRK10015, oxidoreductase; Provisional 3e-20
PRK10157428 PRK10157, PRK10157, putative oxidoreductase FixC; Provi 8e-15
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase 9e-09
TIGR00275400 TIGR00275, TIGR00275, flavoprotein, HI0933 family 7e-07
KOG1335506 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogena 1e-06
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase family 2e-06
KOG1399448 KOG1399, KOG1399, KOG1399, Flavin-containing monooxygen 2e-05
pfam01266309 pfam01266, DAO, FAD dependent oxidoreductase 4e-05
PLN02661357 PLN02661, PLN02661, Putative thiazole synthesis 7e-05
COG244099 COG2440, FixX, Ferredoxin-like protein [Energy producti 2e-07
PRK08275554 PRK08275, PRK08275, putative oxidoreductase; Provisiona 3e-07
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase com 6e-07
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 2e-06
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 2e-06
COG1232444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme met 2e-06
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Val 3e-06
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate reducta 4e-06
PRK11728393 PRK11728, PRK11728, hydroxyglutarate oxidase; Provision 7e-06
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Rev 7e-06
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslational 8e-06
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Rev 1e-05
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in K+ tr 2e-05
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and related pr 2e-05
TIGR01350461 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase 2e-05
TIGR01292300 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase 2e-05
TIGR01176580 TIGR01176, fum_red_Fp, fumarate reductase, flavoprotein 3e-05
PRK11883451 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewe 3e-05
pfam07992277 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide 4e-05
PRK07208479 PRK07208, PRK07208, hypothetical protein; Provisional 4e-05
COG0579429 COG0579, COG0579, Predicted dehydrogenase [General func 6e-05
PRK06069577 PRK06069, sdhA, succinate dehydrogenase flavoprotein su 7e-05
PRK06481506 PRK06481, PRK06481, fumarate reductase flavoprotein sub 1e-04
PRK07233434 PRK07233, PRK07233, hypothetical protein; Provisional 1e-04
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehy 1e-04
COG2081408 COG2081, COG2081, Predicted flavoproteins [General func 2e-04
PRK09231582 PRK09231, PRK09231, fumarate reductase flavoprotein sub 2e-04
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Val 2e-04
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Rev 2e-04
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide transhy 3e-04
PRK12844557 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrogenase 3e-04
PRK12843578 PRK12843, PRK12843, putative FAD-binding dehydrogenase; 4e-04
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Rev 4e-04
PRK07843557 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase 5e-04
pfam05834374 pfam05834, Lycopene_cycl, Lycopene cyclase protein 6e-04
PRK07364415 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydrox 6e-04
PRK06854608 PRK06854, PRK06854, adenylylsulfate reductase subunit a 7e-04
KOG2960328 KOG2960, KOG2960, KOG2960, Protein involved in thiamine 8e-04
TIGR01372 985 TIGR01372, soxA, sarcosine oxidase, alpha subunit famil 8e-04
PRK12842574 PRK12842, PRK12842, putative succinate dehydrogenase; R 8e-04
KOG0029501 KOG0029, KOG0029, KOG0029, Amine oxidase [Secondary met 9e-04
TIGR01813439 TIGR01813, flavo_cyto_c, flavocytochrome c 9e-04
PRK09126392 PRK09126, PRK09126, hypothetical protein; Provisional 0.001
TIGR03329460 TIGR03329, Phn_aa_oxid, putative aminophosphonate oxido 0.001
PRK07803626 PRK07803, sdhA, succinate dehydrogenase flavoprotein su 0.001
PRK06183538 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxyla 0.002
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 0.002
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehyd 0.003
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; Review 0.003
PRK07333403 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydrox 0.003
TIGR03143555 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide r 0.003
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deaminati 0.004
PRK06134581 PRK06134, PRK06134, putative FAD-binding dehydrogenase; 0.004
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Val 5e-04
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase subun 0.002
PRK07494388 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydrox 0.004
PRK05945575 PRK05945, sdhA, succinate dehydrogenase flavoprotein su 7e-04
COG1635262 COG1635, THI4, Flavoprotein involved in thiazole biosyn 0.001
KOG2415621 KOG2415, KOG2415, KOG2415, Electron transfer flavoprote 1e-164
>gnl|CDD|30989 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|147396 pfam05187, ETF_QO, Electron transfer flavoprotein-ubiquinone oxidoreductase Back     alignment and domain information
>gnl|CDD|182194 PRK10015, PRK10015, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|182273 PRK10157, PRK10157, putative oxidoreductase FixC; Provisional Back     alignment and domain information
>gnl|CDD|30999 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|161797 TIGR00275, TIGR00275, flavoprotein, HI0933 family Back     alignment and domain information
>gnl|CDD|36549 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162668 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|36613 KOG1399, KOG1399, KOG1399, Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|144747 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|178267 PLN02661, PLN02661, Putative thiazole synthesis Back     alignment and domain information
>gnl|CDD|32561 COG2440, FixX, Ferredoxin-like protein [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181346 PRK08275, PRK08275, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|31441 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|146239 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|144475 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|31425 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|180516 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|31253 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183292 PRK11728, PRK11728, hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|180558 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|30838 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|32255 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31426 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|162312 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|162288 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|162238 TIGR01176, fum_red_Fp, fumarate reductase, flavoprotein subunit Back     alignment and domain information
>gnl|CDD|183358 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>gnl|CDD|149204 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|180885 PRK07208, PRK07208, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|30924 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|180382 PRK06069, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180584 PRK06481, PRK06481, fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>gnl|CDD|180899 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180019 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|32264 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|181714 PRK09231, PRK09231, fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>gnl|CDD|180333 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181132 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|179973 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183787 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|183786 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|181140 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|114555 pfam05834, Lycopene_cycl, Lycopene cyclase protein Back     alignment and domain information
>gnl|CDD|180946 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|180733 PRK06854, PRK06854, adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|38171 KOG2960, KOG2960, KOG2960, Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>gnl|CDD|162324 TIGR01372, soxA, sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>gnl|CDD|183785 PRK12842, PRK12842, putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|35252 KOG0029, KOG0029, KOG0029, Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|162543 TIGR01813, flavo_cyto_c, flavocytochrome c Back     alignment and domain information
>gnl|CDD|181663 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132372 TIGR03329, Phn_aa_oxid, putative aminophosphonate oxidoreductase Back     alignment and domain information
>gnl|CDD|181124 PRK07803, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180449 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|180546 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|30795 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|183763 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|132187 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>gnl|CDD|31009 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180419 PRK06134, PRK06134, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180529 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|185217 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|180319 PRK05945, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|31822 COG1635, THI4, Flavoprotein involved in thiazole biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|37626 KOG2415, KOG2415, KOG2415, Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 554 electron transfer flavoprotein-ubiquinone oxidoreductas
KOG2415621 consensus 100.0
PRK10015429 hypothetical protein; Provisional 100.0
PRK10157428 putative oxidoreductase FixC; Provisional 100.0
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 99.97
PRK07045388 putative monooxygenase; Reviewed 99.96
PRK09126392 hypothetical protein; Provisional 99.96
PRK07608389 hypothetical protein; Provisional 99.95
PRK08163396 salicylate hydroxylase; Provisional 99.95
PRK07588391 hypothetical protein; Provisional 99.95
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 99.95
PRK06475400 salicylate hydroxylase; Provisional 99.95
PRK06847375 hypothetical protein; Provisional 99.95
PRK08013400 hypothetical protein; Provisional 99.94
PRK06753373 hypothetical protein; Provisional 99.94
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 99.92
PRK08294634 phenol 2-monooxygenase; Provisional 99.92
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 99.91
PRK08255 770 salicylyl-CoA 5-hydroxylase; Reviewed 99.88
pfam04820457 Trp_halogenase Tryptophan halogenase. Tryptophan haloge 99.79
KOG0042680 consensus 98.98
TIGR02061651 aprA adenylylsulfate reductase, alpha subunit; InterPro 98.0
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 100.0
TIGR02032343 GG-red-SF geranylgeranyl reductase family; InterPro: IP 100.0
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 100.0
PRK11445348 putative oxidoreductase; Provisional 100.0
TIGR02028401 ChlP geranylgeranyl reductase; InterPro: IPR011774 This 100.0
PRK06185409 hypothetical protein; Provisional 99.97
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 99.97
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 99.96
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 99.95
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 99.95
PRK06126545 hypothetical protein; Provisional 99.94
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 99.94
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.94
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 99.94
PRK07538413 hypothetical protein; Provisional 99.94
PRK08132549 hypothetical protein; Provisional 99.94
PRK05868372 hypothetical protein; Validated 99.93
PRK08948392 consensus 99.93
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 99.93
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 99.92
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 99.92
PRK08774402 consensus 99.92
PRK06996397 hypothetical protein; Provisional 99.91
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 99.87
TIGR01984425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 99.79
KOG2614420 consensus 99.79
KOG1298509 consensus 99.78
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 99.74
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.7
TIGR01989481 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterP 99.69
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 99.65
PRK13369503 glycerol-3-phosphate dehydrogenase; Provisional 99.35
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 99.33
KOG3855481 consensus 99.3
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy product 99.27
PRK08401464 L-aspartate oxidase; Provisional 99.18
TIGR01816615 sdhA_forward succinate dehydrogenase, flavoprotein subu 99.13
TIGR01789392 lycopene_cycl lycopene cyclase; InterPro: IPR008461 Thi 99.11
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 99.04
TIGR01377401 soxA_mon sarcosine oxidase, monomeric form; InterPro: I 98.96
TIGR00551546 nadB L-aspartate oxidase; InterPro: IPR005288 L-asparta 98.71
TIGR02485467 CobZ_N-term precorrin 3B synthase CobZ; InterPro: IPR01 98.69
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 98.65
KOG2852380 consensus 98.05
pfam05187110 ETF_QO Electron transfer flavoprotein-ubiquinone oxidor 100.0
PRK06183554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 99.95
PRK06184503 hypothetical protein; Provisional 99.94
PRK08244494 hypothetical protein; Provisional 99.94
PRK07190480 hypothetical protein; Provisional 99.93
PRK06834488 hypothetical protein; Provisional 99.93
PRK07236386 hypothetical protein; Provisional 99.88
pfam05834374 Lycopene_cycl Lycopene cyclase protein. This family con 99.77
PRK06175433 L-aspartate oxidase; Provisional 99.56
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.78
PRK08275554 putative oxidoreductase; Provisional 99.77
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.77
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.76
PRK07121491 hypothetical protein; Validated 99.74
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.74
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.73
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 99.73
PRK06069582 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.72
PRK07803631 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.72
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 99.72
PRK08626657 fumarate reductase flavoprotein subunit; Provisional 99.72
PRK09231582 fumarate reductase flavoprotein subunit; Validated 99.72
PRK06263539 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.71
PTZ00139622 succinate dehydrogenase (flavoprotein) subunit; Provisi 99.71
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 99.7
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.69
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.68
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 99.67
PRK11259377 solA N-methyltryptophan oxidase; Provisional 99.66
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.65
PRK06854610 adenylylsulfate reductase; Validated 99.56
pfam03486405 HI0933_like HI0933-like protein. 99.55
PRK13800 894 putative oxidoreductase/HEAT repeat-containing protein; 99.54
pfam00890401 FAD_binding_2 FAD binding domain. This family includes 99.49
PRK09077535 L-aspartate oxidase; Provisional 99.48
PRK11728400 hypothetical protein; Provisional 99.46
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 99.46
PRK11101545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 99.46
COG2081408 Predicted flavoproteins [General function prediction on 99.46
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreductase. T 99.45
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 99.44
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, flavop 99.41
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 99.38
PRK07395556 L-aspartate oxidase; Provisional 99.37
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 99.36
PRK08071510 L-aspartate oxidase; Provisional 99.35
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 99.34
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 99.33
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 99.33
TIGR01813487 flavo_cyto_c flavocytochrome c; InterPro: IPR010960 Thi 99.31
PRK07512507 L-aspartate oxidase; Provisional 99.29
TIGR01373407 soxB sarcosine oxidase, beta subunit family; InterPro: 99.28
PRK10262321 thioredoxin reductase; Provisional 99.26
PRK12266503 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.24
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 99.22
PRK07573638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.21
TIGR01812636 sdhA_frdA_Gneg succinate dehydrogenase or fumarate redu 99.2
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 99.19
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 99.19
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 99.18
COG0579429 Predicted dehydrogenase [General function prediction on 99.17
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 99.17
PRK05976464 dihydrolipoamide dehydrogenase; Validated 99.15
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.14
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.12
PRK07804533 L-aspartate oxidase; Provisional 99.08
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 99.08
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 99.07
PTZ00052541 thioredoxin reductase; Provisional 99.05
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.0
pfam01134391 GIDA Glucose inhibited division protein A. 99.0
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 98.98
PRK12775993 putative trifunctional 2-polyprenylphenol hydroxylase/g 98.96
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 98.96
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 98.88
KOG2820399 consensus 98.79
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 98.79
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 98.79
PRK05192 621 tRNA uridine 5-carboxymethylaminomethyl modification en 98.75
KOG1399448 consensus 98.68
TIGR01176585 fum_red_Fp fumarate reductase, flavoprotein subunit; In 98.59
KOG2960328 consensus 98.58
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 98.55
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 98.51
KOG2844 856 consensus 98.48
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.41
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary metabo 98.37
TIGR01811620 sdhA_Bsu succinate dehydrogenase or fumarate reductase, 98.32
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.19
PRK09897535 hypothetical protein; Provisional 98.1
COG4529474 Uncharacterized protein conserved in bacteria [Function 98.02
KOG0404322 consensus 97.98
KOG2665453 consensus 97.97
pfam06039489 Mqo Malate:quinone oxidoreductase (Mqo). This family co 97.97
TIGR01421475 gluta_reduc_1 glutathione-disulfide reductase; InterPro 97.94
KOG2311 679 consensus 97.73
PRK05257499 malate:quinone oxidoreductase; Validated 97.72
KOG2404477 consensus 97.57
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 97.3
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 97.16
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 97.16
TIGR01320487 mal_quin_oxido malate:quinone-oxidoreductase; InterPro: 97.03
KOG0405478 consensus 96.92
TIGR00136 630 gidA glucose-inhibited division protein A; InterPro: IP 94.96
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 94.39
PRK06567 1048 putative bifunctional glutamate synthase subunit beta/2 92.88
TIGR00275411 TIGR00275 conserved hypothetical protein TIGR00275; Int 92.48
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 99.65
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 99.49
PRK11883452 protoporphyrinogen oxidase; Reviewed 99.36
PRK11749460 putative oxidoreductase; Provisional 99.27
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 99.25
PRK12831464 putative oxidoreductase; Provisional 99.23
PRK05329425 anaerobic glycerol-3-phosphate dehydrogenase subunit B; 99.19
PRK09564443 coenzyme A disulfide reductase; Reviewed 99.19
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 99.14
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 99.13
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 99.13
PRK06370459 mercuric reductase; Validated 99.12
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 99.09
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 99.09
PRK07845467 flavoprotein disulfide reductase; Reviewed 99.07
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 99.05
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.04
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, ana 99.03
PRK13984604 putative oxidoreductase; Provisional 99.01
PRK06116450 glutathione reductase; Validated 98.99
PRK12814652 putative NADPH-dependent glutamate synthase small subun 98.96
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 98.93
PRK13748561 putative mercuric reductase; Provisional 98.91
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.85
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 98.85
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 98.78
PRK07846453 mycothione/glutathione reductase; Reviewed 98.69
PRK02106555 choline dehydrogenase; Validated 98.64
PRK07208474 hypothetical protein; Provisional 98.63
PRK12770350 putative glutamate synthase subunit beta; Provisional 98.6
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.6
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 98.56
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 98.55
PRK098531032 putative selenate reductase subunit YgfK; Provisional 98.54
PRK04965378 nitric oxide reductase; Provisional 98.51
KOG0029501 consensus 98.48
KOG1335506 consensus 98.38
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 98.38
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 98.33
PRK13512438 coenzyme A disulfide reductase; Provisional 98.31
COG2303542 BetA Choline dehydrogenase and related flavoproteins [A 98.31
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 98.26
PTZ00153673 lipoamide dehydrogenase; Provisional 98.17
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amin 98.13
PRK12416466 protoporphyrinogen oxidase; Provisional 98.1
KOG2853509 consensus 98.09
COG3349485 Uncharacterized conserved protein [Function unknown] 98.02
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biogenesi 97.9
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.85
TIGR01438513 TGR thioredoxin and glutathione reductase; InterPro: IP 97.84
KOG1238623 consensus 97.83
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 97.73
KOG1276491 consensus 97.69
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 97.68
COG1231450 Monoamine oxidase [Amino acid transport and metabolism] 97.61
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 97.42
KOG0685498 consensus 97.4
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 97.27
KOG4716503 consensus 97.25
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 97.21
KOG1336478 consensus 97.16
KOG3851446 consensus 96.93
PTZ00052541 thioredoxin reductase; Provisional 96.88
PTZ00188506 adrenodoxin reductase; Provisional 96.87
KOG1800468 consensus 96.86
TIGR01810540 betA choline dehydrogenase; InterPro: IPR011533 Choline 96.7
COG2907447 Predicted NAD/FAD-binding protein [General function pre 96.6
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 96.36
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase; InterPro: IPR0 96.08
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 95.9
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 95.56
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 95.43
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 95.39
KOG4405547 consensus 94.53
PTZ00318514 NADH dehydrogenase; Provisional 94.5
TIGR02731454 phytoene_desat phytoene desaturase; InterPro: IPR014102 94.43
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 94.37
COG5044434 MRS6 RAB proteins geranylgeranyltransferase component A 94.33
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 94.12
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.09
KOG2755334 consensus 93.82
PRK09496455 trkA potassium transporter peripheral membrane componen 93.67
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 93.67
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 93.32
KOG2403642 consensus 92.99
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.88
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 92.87
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.86
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.86
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.26
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.08
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.07
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.95
PRK07660283 consensus 91.9
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 91.87
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 91.83
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 91.75
PRK09117282 consensus 91.59
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.57
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.56
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 91.44
PRK08229341 2-dehydropantoate 2-reductase; Provisional 91.22
pfam06100500 Strep_67kDa_ant Streptococcal 67 kDa myosin-cross-react 91.2
PRK13977577 myosin-cross-reactive antigen; Provisional 91.19
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 90.9
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 90.84
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.78
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 90.75
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.72
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.65
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.61
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 90.61
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 90.59
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.45
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.37
KOG1439440 consensus 90.34
TIGR01763308 MalateDH_bact malate dehydrogenase, NAD-dependent; Inte 90.31
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily of act 90.21
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 90.15
PRK05708305 2-dehydropantoate 2-reductase; Provisional 90.06
PRK12842567 putative succinate dehydrogenase; Reviewed 99.6
PRK07233430 hypothetical protein; Provisional 99.57
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 99.56
PRK06134579 putative FAD-binding dehydrogenase; Reviewed 99.53
PRK07843560 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.48
PRK12839574 hypothetical protein; Provisional 99.48
PRK12845566 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.37
pfam01593444 Amino_oxidase Flavin containing amine oxidoreductase. T 98.92
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 98.8
KOG4254561 consensus 98.66
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine 98.6
TIGR02733499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 98.18
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.88
PRK05976464 dihydrolipoamide dehydrogenase; Validated 97.71
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 97.56
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 96.98
PRK04965378 nitric oxide reductase; Provisional 94.86
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 94.08
PRK12549284 shikimate 5-dehydrogenase; Reviewed 91.94
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 99.56
TIGR02730506 carot_isom carotene isomerase; InterPro: IPR014101 Memb 98.19
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, ana 97.61
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.54
PRK12843576 putative FAD-binding dehydrogenase; Reviewed 99.5
PRK08274456 tricarballylate dehydrogenase; Validated 99.53
PRK12844552 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.53
PRK12837515 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.39
COG3573552 Predicted oxidoreductase [General function prediction o 98.16
TIGR01424478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 96.37
COG244099 FixX Ferredoxin-like protein [Energy production and con 99.32
PRK08348111 NADH-plastoquinone oxidoreductase subunit; Provisional 96.85
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subunit Oor 96.74
PRK12387178 formate hydrogenlyase complex iron-sulfur subunit; Prov 95.84
PRK08222181 hydrogenase 4 subunit H; Validated 95.37
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. This mod 94.28
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase subuni 92.93
TIGR01971129 NuoI NADH-quinone oxidoreductase, chain I; InterPro: IP 91.75
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit delta; R 91.46
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 98.55
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 98.24
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 97.81
PRK09564443 coenzyme A disulfide reductase; Reviewed 97.8
PRK06116450 glutathione reductase; Validated 97.67
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.6
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.54
PRK07845467 flavoprotein disulfide reductase; Reviewed 97.44
PRK13748561 putative mercuric reductase; Provisional 97.41
PRK13512438 coenzyme A disulfide reductase; Provisional 97.4
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 97.26
PRK07846453 mycothione/glutathione reductase; Reviewed 97.26
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 97.2
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 97.18
PRK12831464 putative oxidoreductase; Provisional 97.08
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.08
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 96.98
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 96.77
PTZ00153673 lipoamide dehydrogenase; Provisional 96.71
PRK11749460 putative oxidoreductase; Provisional 96.33
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 96.11
PRK10882329 hydrogenase 2 protein HybA; Provisional 95.17
PRK098531032 putative selenate reductase subunit YgfK; Provisional 94.86
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 94.72
PRK06370459 mercuric reductase; Validated 94.58
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 94.41
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 93.53
PRK10262321 thioredoxin reductase; Provisional 93.33
pfam08491276 SE Squalene epoxidase. This domain is found in squalene 98.17
TIGR00137444 gid gid protein; InterPro: IPR004417 The gid proteins a 98.09
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 97.59
pfam00996439 GDI GDP dissociation inhibitor. 97.01
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in tran 96.23
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 95.24
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.68
KOG3923342 consensus 97.25
KOG0399 2142 consensus 96.86
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 96.85
PRK13795630 hypothetical protein; Provisional 96.82
PRK05888172 NADH dehydrogenase subunit I; Provisional 96.63
PRK0265181 photosystem I subunit VII; Provisional 96.48
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. Membe 96.34
PRK09898208 hypothetical protein; Provisional 96.15
PRK10330181 electron transport protein HydN; Provisional 96.06
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone ox 95.75
COG114668 Ferredoxin [Energy production and conversion] 95.59
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S prote 95.54
PRK05035 725 electron transport complex protein RnfC; Provisional 95.45
CHL0006581 psaC photosystem I subunit VII 95.41
COG1142165 HycB Fe-S-cluster-containing hydrogenase components 2 [ 95.28
PRK07118276 ferredoxin; Validated 94.74
CHL00014173 ndhI NADH dehydrogenase subunit I 94.64
COG0437203 HybA Fe-S-cluster-containing hydrogenase components 1 [ 91.14
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit delta; R 90.15
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzyme, i 95.78
PRK13409590 putative ATPase RIL; Provisional 95.18
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog [Gene 94.74
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 94.5
PRK03659602 glutathione-regulated potassium-efflux system protein K 91.43
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 93.76
PRK09496455 trkA potassium transporter peripheral membrane componen 93.2
TIGR03224411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protei 91.86
PTZ00318514 NADH dehydrogenase; Provisional 90.16
>KOG2415 consensus Back     alignment and domain information
>PRK10015 hypothetical protein; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07608 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family; InterPro: IPR010971 This entry represents a family of FAD-dependent hydroxylases (monooxygenases) which are all believed to act in the aerobic ubiquinone biosynthesis pathway Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>pfam04820 Trp_halogenase Tryptophan halogenase Back     alignment and domain information
>KOG0042 consensus Back     alignment and domain information
>TIGR02061 aprA adenylylsulfate reductase, alpha subunit; InterPro: IPR011803 During dissimilatory sulphate reduction or sulphur oxidation, adenylylsulphate (APS) reductase catalyzes reversibly the two-electron reduction of APS to sulphite and AMP Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family; InterPro: IPR011777 This entry includes geranylgeranyl reductases involved in chlorophyll and bacteriochlorophyll biosynthesis as well as other related enzymes which may also act on geranylgeranyl groups or related substrates Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 This entry represents a group of geranylgeranyl reductases specific for the biosyntheses of bacteriochlorophyll and chlorophyll Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase; InterPro: IPR011774 This entry represents the reductase which acts reduces the geranylgeranyl group to the phytyl group in the side chain of chlorophyll Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>pfam01494 FAD_binding_3 FAD binding domain Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information