254781025

254781025

deoxyuridine 5 27-triphosphate nucleotidohydrolase

GeneID in NCBI database:8210048Locus tag:CLIBASIA_04635
Protein GI in NCBI database:254781025Protein Accession:YP_003065438.1
Gene range:+(1026246, 1026710)Protein Length:154aa
Gene description:deoxyuridine 5 27-triphosphate nucleotidohydrolase
COG prediction:[F] dUTPase
KEGG prediction:deoxyuridine 5 27-triphosphate nucleotidohydrolase; K01520 dUTP pyrophosphatase [EC:3.6.1.23]
SEED prediction:Deoxyuridine-triphosphate nucleotidohydrolase (EC 3.6.1.23)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:Nudix proteins (nucleoside triphosphate hydrolases);
Housecleaning nucleoside triphosphate pyrophosphatases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAMPMGKNERNEKGFGSTGLY
ccEEEEEEEEcccccccccccccccccccccEEEEccccccEEEccccEEEEcccEEEEEccccEEEEEccccccccccEEEccccEEEcccccccEEEEEEEcccccEEEccccEEEEEEEEEEEEccccccccEEccccccccccccccccc
cccEEEEEEccccccccccccccccccccccHHHHccccccEEEccccEEEEEEEEEEEccccEEEEEEccHHHHHHHcEEEccccEEEccccccEEEEEEEEcccccEEEccccEEEEEEEEEcccccccccEEEcccccccccccccccccc
mqsidipflqlphahgiplpeyktsgssgmdlfaalpedepvellpgmrslipggyiiaippgyegqvrsrsGLALNYGvaclnspgtidsdyRGEIKILLINLGQENFLIMRGMRIAQLIIANSvrahpslisampmgknernekgfgstgly
MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLisampmgknernekgfgstgly
MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLipggyiiaippgyegQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAMPMGKNERNEKGFGSTGLY
**SIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAMPMGKNERNE**FG*****
MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAMPMGKNERN**********
*QSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAMPMG***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAMPMGKNERNEKGFGSTGLY
MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAMPMGKNERNEKGFGSTGLY
MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAMPMGKNERNEKGFGSTGLY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target154 deoxyuridine 5 27-triphosphate nucleotidohydrolase [Can
315122604154 deoxyuridine 5 27-triphosphate nucleotidohydrolase [Can 1 2e-66
268317896160 deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [R 1 3e-42
49474660185 deoxyuridine 5 27-triphosphate nucleotidohydrolase [Bar 1 6e-42
254419390152 dUTP diphosphatase superfamily [Brevundimonas sp. BAL3] 1 3e-41
15964098160 deoxyuridine 5'-triphosphate nucleotidohydrolase [Sinor 1 6e-41
163757800168 deoxyuridine 5`triphosphate nucleotidohydrolase protein 1 2e-40
114798633151 deoxyuridine 5'-triphosphate nucleotidohydrolase [Hypho 1 2e-40
222147296154 deoxyuridine 5primetriphosphate nucleotidohydrolase [Ag 1 3e-40
319406233183 Deoxyuridine 5'-triphosphate nucleotidohydrolase [Barto 1 1e-39
298290311161 deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [S 1 1e-39
>gi|315122604|ref|YP_004063093.1| deoxyuridine 5 27-triphosphate nucleotidohydrolase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 154 Back     alignment and organism information
 Score =  255 bits (651), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 139/154 (90%)

Query: 1   MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAI 60
           MQ + I F +LPHAHGIPLPEYKT GSSGMDLFAAL ED+PVELLPGMRSLIPGGY++A+
Sbjct: 1   MQFVHISFSRLPHAHGIPLPEYKTEGSSGMDLFAALAEDKPVELLPGMRSLIPGGYVVAL 60

Query: 61  PPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQL 120
           PPGYEGQ+RSRSGLAL++G++CLNSPGTIDSDYRGEIKILLINLGQENFLI RGMRIAQL
Sbjct: 61  PPGYEGQIRSRSGLALDHGISCLNSPGTIDSDYRGEIKILLINLGQENFLITRGMRIAQL 120

Query: 121 IIANSVRAHPSLISAMPMGKNERNEKGFGSTGLY 154
           +IANSV    +L+S +P+ K+ER  KGFGSTGLY
Sbjct: 121 VIANSVCVRANLVSEIPIEKSERGNKGFGSTGLY 154


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|268317896|ref|YP_003291615.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Rhodothermus marinus DSM 4252] Length = 160 Back     alignment and organism information
>gi|49474660|ref|YP_032702.1| deoxyuridine 5 27-triphosphate nucleotidohydrolase [Bartonella quintana str. Toulouse] Length = 185 Back     alignment and organism information
>gi|254419390|ref|ZP_05033114.1| dUTP diphosphatase superfamily [Brevundimonas sp. BAL3] Length = 152 Back     alignment and organism information
>gi|15964098|ref|NP_384451.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Sinorhizobium meliloti 1021] Length = 160 Back     alignment and organism information
>gi|163757800|ref|ZP_02164889.1| deoxyuridine 5`triphosphate nucleotidohydrolase protein [Hoeflea phototrophica DFL-43] Length = 168 Back     alignment and organism information
>gi|114798633|ref|YP_761940.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Hyphomonas neptunium ATCC 15444] Length = 151 Back     alignment and organism information
>gi|222147296|ref|YP_002548253.1| deoxyuridine 5primetriphosphate nucleotidohydrolase [Agrobacterium vitis S4] Length = 154 Back     alignment and organism information
>gi|319406233|emb|CBI79870.1| Deoxyuridine 5'-triphosphate nucleotidohydrolase [Bartonella sp. AR 15-3] Length = 183 Back     alignment and organism information
>gi|298290311|ref|YP_003692250.1| deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [Starkeya novella DSM 506] Length = 161 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target154 deoxyuridine 5 27-triphosphate nucleotidohydrolase [Can
PRK00601150 PRK00601, dut, deoxyuridine 5'-triphosphate nucleotidoh 2e-53
TIGR00576141 TIGR00576, dut, deoxyuridine 5'-triphosphate nucleotido 2e-42
cd0755792 cd07557, trimeric_dUTPase, Trimeric dUTP diphosphatases 2e-22
pfam00692129 pfam00692, dUTPase, dUTPase 2e-20
PHA03094144 PHA03094, PHA03094, dUTPase; Provisional 9e-18
KOG3370140 KOG3370, KOG3370, KOG3370, dUTPase [Nucleotide transpor 6e-17
PLN02547157 PLN02547, PLN02547, dUTP pyrophosphatase 7e-17
PHA02703165 PHA02703, PHA02703, ORF007 dUTPase; Provisional 4e-16
PTZ00143155 PTZ00143, PTZ00143, deoxyuridine 5'-triphosphate nucleo 2e-08
PRK13956147 PRK13956, dut, deoxyuridine 5'-triphosphate nucleotidoh 1e-06
COG0756148 COG0756, Dut, dUTPase [Nucleotide transport and metabol 8e-40
COG0717183 COG0717, Dcd, Deoxycytidine deaminase [Nucleotide trans 7e-07
TIGR02274179 TIGR02274, dCTP_deam, deoxycytidine triphosphate deamin 3e-06
PRK02253167 PRK02253, PRK02253, deoxyuridine 5'-triphosphate nucleo 5e-04
>gnl|CDD|179077 PRK00601, dut, deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|129666 TIGR00576, dut, deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) Back     alignment and domain information
>gnl|CDD|143638 cd07557, trimeric_dUTPase, Trimeric dUTP diphosphatases Back     alignment and domain information
>gnl|CDD|144334 pfam00692, dUTPase, dUTPase Back     alignment and domain information
>gnl|CDD|165376 PHA03094, PHA03094, dUTPase; Provisional Back     alignment and domain information
>gnl|CDD|38580 KOG3370, KOG3370, KOG3370, dUTPase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178162 PLN02547, PLN02547, dUTP pyrophosphatase Back     alignment and domain information
>gnl|CDD|165079 PHA02703, PHA02703, ORF007 dUTPase; Provisional Back     alignment and domain information
>gnl|CDD|185476 PTZ00143, PTZ00143, deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184417 PRK13956, dut, deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|31099 COG0756, Dut, dUTPase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|31061 COG0717, Dcd, Deoxycytidine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|162793 TIGR02274, dCTP_deam, deoxycytidine triphosphate deaminase Back     alignment and domain information
>gnl|CDD|179395 PRK02253, PRK02253, deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 154 deoxyuridine 5 27-triphosphate nucleotidohydrolase [Can
TIGR00576151 dut dUTP diphosphatase; InterPro: IPR008181 Synonym(s): 100.0
PRK00601149 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; P 100.0
COG0756148 Dut dUTPase [Nucleotide transport and metabolism] 100.0
PRK13956147 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; P 100.0
PTZ00143155 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provi 100.0
pfam00692129 dUTPase dUTPase. dUTPase hydrolyses dUTP to dUMP and py 100.0
KOG3370140 consensus 100.0
PHA01707158 dut 2'-deoxyuridine 5'-triphosphatase 99.75
cd0755792 trimeric_dUTPase Trimeric dUTP diphosphatases. Trimeric 99.94
PRK02253159 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provi 99.76
COG0717183 Dcd Deoxycytidine deaminase [Nucleotide transport and m 99.72
pfam06559 366 DCD 2'-deoxycytidine 5'-triphosphate deaminase (DCD). T 98.1
PRK07559 366 2'-deoxycytidine 5'-triphosphate deaminase; Provisional 98.0
pfam06559366 DCD 2'-deoxycytidine 5'-triphosphate deaminase (DCD). T 96.77
PRK07559366 2'-deoxycytidine 5'-triphosphate deaminase; Provisional 96.66
pfam05784346 Herpes_UL82_83 Betaherpesvirus UL82/83 protein N termin 95.37
pfam04797384 Herpes_ORF11 Herpesvirus dUTPase protein. This family o 95.29
TIGR02274198 dCTP_deam deoxycytidine triphosphate deaminase; InterPr 99.91
PRK00416174 dcd deoxycytidine triphosphate deaminase; Reviewed 99.77
>TIGR00576 dut dUTP diphosphatase; InterPro: IPR008181 Synonym(s): dUTP diphosphatase, Deoxyuridine-triphosphatase Back     alignment and domain information
>PRK00601 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>COG0756 Dut dUTPase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13956 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>PTZ00143 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>pfam00692 dUTPase dUTPase Back     alignment and domain information
>KOG3370 consensus Back     alignment and domain information
>PHA01707 dut 2'-deoxyuridine 5'-triphosphatase Back     alignment and domain information
>cd07557 trimeric_dUTPase Trimeric dUTP diphosphatases Back     alignment and domain information
>PRK02253 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>COG0717 Dcd Deoxycytidine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam06559 DCD 2'-deoxycytidine 5'-triphosphate deaminase (DCD) Back     alignment and domain information
>PRK07559 2'-deoxycytidine 5'-triphosphate deaminase; Provisional Back     alignment and domain information
>pfam06559 DCD 2'-deoxycytidine 5'-triphosphate deaminase (DCD) Back     alignment and domain information
>PRK07559 2'-deoxycytidine 5'-triphosphate deaminase; Provisional Back     alignment and domain information
>pfam05784 Herpes_UL82_83 Betaherpesvirus UL82/83 protein N terminus Back     alignment and domain information
>pfam04797 Herpes_ORF11 Herpesvirus dUTPase protein Back     alignment and domain information
>TIGR02274 dCTP_deam deoxycytidine triphosphate deaminase; InterPro: IPR011962 Members of this family include the Escherichia coli monofunctional deoxycytidine triphosphate deaminase (dCTP deaminase) and a Methanocaldococcus jannaschii bifunctional dCTP deaminase (3 Back     alignment and domain information
>PRK00416 dcd deoxycytidine triphosphate deaminase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target154 deoxyuridine 5 27-triphosphate nucleotidohydrolase [Can
3mbq_A178 Crystal Structure Of Deoxyuridine 5-Triphosphate Nu 4e-37
1dup_A152 Deoxyuridine 5'-Triphosphate Nucleotido Hydrolase ( 8e-37
1rnj_A152 Crystal Structure Of Inactive Mutant Dutpase Comple 3e-36
2p9o_A169 Structure Of Dutpase From Arabidopsis Thaliana Leng 6e-28
2hqu_A164 Human Dutpase In Complex With Alpha,Beta-Iminodutp 7e-28
1q5h_A147 Human Dutp Pyrophosphatase Complex With Dudp Length 7e-28
2okd_A147 High Resolution Crystal Structures Of Vaccinia Viru 2e-27
2okb_A137 High Resolution Crystal Structures Of Vaccinia Viru 2e-25
3lqw_A163 Crystal Structure Of Deoxyuridine 5-Triphosphate Nu 4e-25
3c3i_A141 Evolution Of Chlorella Virus Dutpase Length = 141 4e-23
3p48_A147 Structure Of The Yeast Dutpase Dut1 In Complex With 1e-22
3f4f_A167 Crystal Structure Of Dut1p, A Dutpase From Saccharo 3e-22
3c2t_A141 Evolution Of Chlorella Virus Dutpase Length = 141 3e-22
3ca9_A165 Evolution Of Chlorella Virus Dutpase Length = 165 6e-22
3ecy_A160 Crystal Structural Analysis Of Drosophila Melanogas 7e-22
1sjn_A170 Mycobacterium Tuberculosis Dutpase Complexed With M 3e-20
1six_A174 Mycobacterium Tuberculosis Dutpase Complexed With M 3e-20
1mq7_A154 Crystal Structure Of Dutpase From Mycobacterium Tub 3e-20
3loj_A174 Structure Of Mycobacterium Tuberculosis Dutpase H14 2e-19
3i93_A158 Crystal Structure Of Mycobacterium Tuberculosis Dut 2e-19
3hza_A174 Crystal Structure Of Dutpase H145w Mutant Length = 2e-19
3h6d_A174 Structure Of The Mycobacterium Tuberculosis Dutpase 2e-18
1f7d_A136 Crystal Structures Of Feline Immunodeficiency Virus 3e-15
1dut_A133 Fiv Dutp Pyrophosphatase Length = 133 3e-15
1vyq_A173 Novel Inhibitors Of Plasmodium Falciparum Dutpase P 5e-14
2xcd_A144 Structure Of Yncf,The Genomic Dutpase From Bacillus 8e-14
2baz_A142 Structure Of Yoss, A Putative Dutpase From Bacillus 1e-12
1duc_A134 Eiav Dutpase DudpSTRONTIUM COMPLEX Length = 134 1e-12
3h6x_A148 Crystal Structure Of Dutpase From Streptococcus Mut 2e-12
2d4n_A152 Crystal Structure Of M-Pmv Dutpase Complexed With D 4e-10
2d4l_A152 Crystal Structure Of Truncated In C-Terminal M-Pmv 1e-09
>gi|294979839|pdb|3MBQ|A Chain A, Crystal Structure Of Deoxyuridine 5-Triphosphate Nucleotidohydrolase From Brucella Melitensis, Orthorhombic Crystal Form Length = 178 Back     alignment and structure
 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 78/145 (53%), Positives = 101/145 (69%), Gaps = 2/145 (1%)

Query: 8   FLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQ 67
            ++L HA G+ LP Y+T+GS+GMDL AA+ ED  + LLPG R+L+P G I+ IP GYE Q
Sbjct: 34  IIRLEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYEVQ 93

Query: 68  VRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVR 127
           +R RSGLA   G+ CLN+PGTIDSDYRGE+K+LLINLG ++F I RGMRIAQ + A  ++
Sbjct: 94  IRPRSGLAFKNGITCLNTPGTIDSDYRGEVKVLLINLGDDDFRIERGMRIAQAVFAPVIQ 153

Query: 128 AHPSLISAMPMGKNERNEKGFGSTG 152
                     + +  R   GFGSTG
Sbjct: 154 PKIE--ERAKISETARGAGGFGSTG 176


>gi|1311150|pdb|1DUP|A Chain A, Deoxyuridine 5'-Triphosphate Nucleotido Hydrolase (D-Utpase) Length = 152 Back     alignment and structure
>gi|55669664|pdb|1RNJ|A Chain A, Crystal Structure Of Inactive Mutant Dutpase Complexed With Substrate Analogue Imido-Dutp Length = 152 Back     alignment and structure
>gi|167013261|pdb|2P9O|A Chain A, Structure Of Dutpase From Arabidopsis Thaliana Length = 169 Back     alignment and structure
gi|157835079|pdb|2HQU|A Chain A, Human Dutpase In Complex With Alpha,Beta-Iminodutp And Magnesium Ion Length = 164 Back     alignment and structure
>gi|34810576|pdb|1Q5H|A Chain A, Human Dutp Pyrophosphatase Complex With Dudp Length = 147 Back     alignment and structure
>gi|146386637|pdb|2OKD|A Chain A, High Resolution Crystal Structures Of Vaccinia Virus Dutpase Length = 147 Back     alignment and structure
>gi|146386634|pdb|2OKB|A Chain A, High Resolution Crystal Structures Of Vaccinia Virus Dutpase Length = 137 Back     alignment and structure
>gi|290790283|pdb|3LQW|A Chain A, Crystal Structure Of Deoxyuridine 5-Triphosphate Nucleotidohydrolase From Entamoeba Histolytica Length = 163 Back     alignment and structure
>gi|223365797|pdb|3C3I|A Chain A, Evolution Of Chlorella Virus Dutpase Length = 141 Back     alignment and structure
gi|310689983|pdb|3P48|A Chain A, Structure Of The Yeast Dutpase Dut1 In Complex With Dumpnpp Length = 147 Back     alignment and structure
>gi|212375105|pdb|3F4F|A Chain A, Crystal Structure Of Dut1p, A Dutpase From Saccharomyces Cerevisiae Length = 167 Back     alignment and structure
>gi|224036291|pdb|3C2T|A Chain A, Evolution Of Chlorella Virus Dutpase Length = 141 Back     alignment and structure
>gi|224510561|pdb|3CA9|A Chain A, Evolution Of Chlorella Virus Dutpase Length = 165 Back     alignment and structure
>gi|209156721|pdb|3ECY|A Chain A, Crystal Structural Analysis Of Drosophila Melanogaster Dutpase Length = 160 Back     alignment and structure
>gi|47169153|pdb|1SJN|A Chain A, Mycobacterium Tuberculosis Dutpase Complexed With Magnesium And Alpha,Beta-Imido-Dutp Length = 170 Back     alignment and structure
>gi|47169150|pdb|1SIX|A Chain A, Mycobacterium Tuberculosis Dutpase Complexed With Magnesium And Alpha,Beta-Imido-Dutp Length = 174 Back     alignment and structure
gi|24987797|pdb|1MQ7|A Chain A, Crystal Structure Of Dutpase From Mycobacterium Tuberculosis (Rv2697c) Length = 154 Back     alignment and structure
>gi|302566146|pdb|3LOJ|A Chain A, Structure Of Mycobacterium Tuberculosis Dutpase H145a Mutant Length = 174 Back     alignment and structure
>gi|269914483|pdb|3I93|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Dutpase Stop138t Mutant Length = 158 Back     alignment and structure
>gi|269914482|pdb|3HZA|A Chain A, Crystal Structure Of Dutpase H145w Mutant Length = 174 Back     alignment and structure
>gi|269914448|pdb|3H6D|A Chain A, Structure Of The Mycobacterium Tuberculosis Dutpase D28n Mutant Length = 174 Back     alignment and structure
>gi|10120534|pdb|1F7D|A Chain A, Crystal Structures Of Feline Immunodeficiency Virus Dutp Pyrophosphatase And Its Nucleotide Complexes In Three Crystal Forms Length = 136 Back     alignment and structure
>gi|1942421|pdb|1DUT|A Chain A, Fiv Dutp Pyrophosphatase Length = 133 Back     alignment and structure
gi|67463796|pdb|1VYQ|A Chain A, Novel Inhibitors Of Plasmodium Falciparum Dutpase Provide A Platform For Anti-Malarial Drug Design Length = 173 Back     alignment and structure
gi|302565938|pdb|2XCD|A Chain A, Structure Of Yncf,The Genomic Dutpase From Bacillus Subtilis Length = 144 Back     alignment and structure
gi|118137331|pdb|2BAZ|A Chain A, Structure Of Yoss, A Putative Dutpase From Bacillus Subtilis Length = 142 Back     alignment and structure
>gi|157830892|pdb|1DUC|A Chain A, Eiav Dutpase DudpSTRONTIUM COMPLEX Length = 134 Back     alignment and structure
>gi|295789315|pdb|3H6X|A Chain A, Crystal Structure Of Dutpase From Streptococcus Mutans Length = 148 Back     alignment and structure
>gi|119389090|pdb|2D4N|A Chain A, Crystal Structure Of M-Pmv Dutpase Complexed With Dupnpp, Substrate Analogue Length = 152 Back     alignment and structure
>gi|119389088|pdb|2D4L|A Chain A, Crystal Structure Of Truncated In C-Terminal M-Pmv Dutpase Length = 152 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target154 deoxyuridine 5 27-triphosphate nucleotidohydrolase [Can
3mdx_A178 Deoxyuridine 5'-triphosphate nucleotidohydrolase; metal 2e-41
1euw_A152 Dutpase, deoxyuridine 5'-triphosphate nucleotidohydrola 3e-40
3lqw_A163 Deoxyuridine 5'-triphosphate nucleotidohydrolase; emera 4e-30
3h6x_A148 Dutpase; jelly-roll beta-barrel, hydrolase; 1.70A {Stre 2e-29
2xcd_A144 Probable deoxyuridine 5'-triphosphate nucleotidoh YNCF; 5e-29
3p48_A147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; trime 7e-29
1f7d_A136 POL polyprotein; eight stranded beta-barrel, viral prot 2e-28
3hza_A174 Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly 9e-25
2bsy_A 278 Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpa 3e-23
2bsy_A278 Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpa 3e-22
1vyq_A173 Deoxyuridine 5'-triphosphate nucleotidohydrolase; drug 2e-22
2baz_A142 YOSS, hypothetical protein BSU20020; homotrimer, beta b 9e-21
1dun_A134 Deoxyuridine 5'-triphosphate nucleoditohydrolase; dutpa 1e-20
3ca9_A165 Deoxyuridine triphosphatase; dutpase chlorella virus, h 1e-20
2d4n_A152 DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason-pfize 2e-19
2ol1_A147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, 2e-19
3ecy_A160 CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimer 2e-19
3c2t_A141 Deoxyuridine triphosphatase; dutpase chlorella virus, h 3e-19
3f4f_A167 Deoxyuridine 5'-triphosphate nucleotidohydrolase; trime 4e-19
3ehw_A164 DUTP pyrophosphatase; jelly-roll, FULL-length C-termina 2e-18
2p9o_A169 DUTP pyrophosphatase-like protein; dutpase, magnesium b 6e-17
2yzj_A169 167AA long hypothetical dutpase; all beta proteins, hyp 2e-08
2qxx_A190 DCTP deaminase, deoxycytidine triphosphate deaminase; d 4e-09
1xs1_A193 DCTP deaminase, deoxycytidine triphosphate deaminase; n 5e-07
2r9q_A370 AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; 8e-07
1pkh_A204 Bifunctional deaminase/diphosphatase; DCTP deaminase, d 9e-07
3km3_A206 DCTP deaminase, deoxycytidine triphosphate deaminase; s 0.004
>3mdx_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; metal-binding, nucleotide metabolism, structural genomics; 1.45A {Brucella melitensis} PDB: 3mbq_A Length = 178 Back     alignment and structure
 Score =  162 bits (412), Expect = 2e-41
 Identities = 78/147 (53%), Positives = 103/147 (70%), Gaps = 2/147 (1%)

Query: 6   IPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYE 65
           +  ++L HA G+ LP Y+T+GS+GMDL AA+ ED  + LLPG R+L+P G I+ IP GYE
Sbjct: 32  LGIIRLEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYE 91

Query: 66  GQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANS 125
            Q+R RSGLA   G+ CLN+PGTIDSDYRGE+K+LLINLG ++F I RGMRIAQ + A  
Sbjct: 92  VQIRPRSGLAFKNGITCLNTPGTIDSDYRGEVKVLLINLGDDDFRIERGMRIAQAVFAPV 151

Query: 126 VRAHPSLISAMPMGKNERNEKGFGSTG 152
           ++      + +   +  R   GFGSTG
Sbjct: 152 IQPKIEERAKIS--ETARGAGGFGSTG 176


>1euw_A Dutpase, deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, mercury derivative; 1.05A {Escherichia coli} SCOP: b.85.4.1 PDB: 1dud_A 1dup_A 1eu5_A 1rn8_A* 1seh_A* 2hr6_A* 2hrm_A* 1rnj_A* 1syl_A* Length = 152 Back     alignment and structure
>3lqw_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; emerald biostructures, ALS collaborative crystallography; 1.30A {Entamoeba histolytica} Length = 163 Back     alignment and structure
>3h6x_A Dutpase; jelly-roll beta-barrel, hydrolase; 1.70A {Streptococcus mutans} Length = 148 Back     alignment and structure
>2xcd_A Probable deoxyuridine 5'-triphosphate nucleotidoh YNCF; hydrolase; 1.84A {Bacillus subtilis} PDB: 2xce_A* 2baz_A Length = 144 Back     alignment and structure
>3p48_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, DUMPPNP pyrophosphatase, phosphoprotein, structural genomics; HET: DUP; 1.67A {Saccharomyces cerevisiae} Length = 147 Back     alignment and structure
>1f7d_A POL polyprotein; eight stranded beta-barrel, viral protein, hydrolase; 1.40A {Feline immunodeficiency virus} SCOP: b.85.4.1 PDB: 1f7k_A* 1f7n_A* 1f7o_A 1f7p_A* 1f7q_A* 1f7r_A* 1dut_A Length = 136 Back     alignment and structure
>3hza_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, domain swapping, nucleotide metabolism; HET: DUP; 1.20A {Mycobacterium tuberculosis} PDB: 1six_A* 1slh_A* 1sm8_A* 1smc_A* 1snf_A* 2py4_A* 3h6d_A* 3i93_A* 1mq7_A 1sjn_A* Length = 174 Back     alignment and structure
>2bsy_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4} SCOP: b.85.4.1 b.85.4.1 PDB: 2bt1_A* 2we1_A* 2we0_A* 2we2_A* 2we3_A* Length = 278 Back     alignment and structure
>2bsy_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4} SCOP: b.85.4.1 b.85.4.1 PDB: 2bt1_A* 2we1_A* 2we0_A* 2we2_A* 2we3_A* Length = 278 Back     alignment and structure
>1vyq_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; drug design, dutpase, deoxyuridine nucleotidohydrolase, malaria; HET: DUX; 2.4A {Plasmodium falciparum} SCOP: b.85.4.1 Length = 173 Back     alignment and structure
>2baz_A YOSS, hypothetical protein BSU20020; homotrimer, beta barrel, unknown function; 2.30A {Bacillus subtilis} Length = 142 Back     alignment and structure
>1dun_A Deoxyuridine 5'-triphosphate nucleoditohydrolase; dutpase, EIAV, trimeric enzyme, aspartyl protease; 1.90A {Equine infectious anemia virus} SCOP: b.85.4.1 PDB: 1duc_A Length = 134 Back     alignment and structure
>3ca9_A Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} Length = 165 Back     alignment and structure
>2d4n_A DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason-pfizer monkey virus} PDB: 2d4m_A 2d4l_A* Length = 152 Back     alignment and structure
>2ol1_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, jelly-roll, superfamily, dutpase-like; HET: UMP; 1.80A {Vaccinia virus} PDB: 2oke_A* 2okd_A* 2ol0_A* 2okb_A Length = 147 Back     alignment and structure
>3ecy_A CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimeric assembly, hydrolase; 1.88A {Drosophila melanogaster} Length = 160 Back     alignment and structure
>3c2t_A Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} PDB: 3c3i_A* Length = 141 Back     alignment and structure
>3f4f_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, UMP, product complex, DUTP pyrophosphatase, DITP; HET: UMP; 2.00A {Saccharomyces cerevisiae} PDB: 3hhq_A Length = 167 Back     alignment and structure
>3ehw_A DUTP pyrophosphatase; jelly-roll, FULL-length C-terminal ARM, enzyme-ligand complex, hydrolase; HET: DUP; 1.80A {Homo sapiens} SCOP: b.85.4.1 PDB: 2hqu_A* 1q5h_A* 1q5u_X Length = 164 Back     alignment and structure
>2p9o_A DUTP pyrophosphatase-like protein; dutpase, magnesium binding, hydrolase; 2.00A {Arabidopsis thaliana} PDB: 2pc5_A Length = 169 Back     alignment and structure
>2yzj_A 167AA long hypothetical dutpase; all beta proteins, hypothetical protein, NPPSFA; HET: DUD; 1.66A {Sulfolobus tokodaii} PDB: 2zdc_A Length = 169 Back     alignment and structure
>2qxx_A DCTP deaminase, deoxycytidine triphosphate deaminase; distorted beta barrel, hydrolase, nucleotide metabolism; HET: TTP 1PE; 2.00A {Mycobacterium tuberculosis H37RV} PDB: 2qlp_A* Length = 190 Back     alignment and structure
>1xs1_A DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli} SCOP: b.85.4.1 PDB: 2v9x_A* 1xs6_A* 1xs4_A* 2j4q_A* 2j4h_A* Length = 193 Back     alignment and structure
>2r9q_A AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str} Length = 370 Back     alignment and structure
>1pkh_A Bifunctional deaminase/diphosphatase; DCTP deaminase, dutpase, DCD-DUT, MJ0430, DCTP, DUTP, hydrolase; 1.42A {Methanocaldococcus jannaschii} SCOP: b.85.4.1 PDB: 1ogh_A 1pkj_A* 1pkk_A* 2hxb_A 2hxe_A 3gf0_A 2hxd_A* Length = 204 Back     alignment and structure
>3km3_A DCTP deaminase, deoxycytidine triphosphate deaminase; ssgcid, NIH, niaid, SBRI, UW, decode, iodide phasing, hydrolase; 2.10A {Anaplasma phagocytophilum HZ} Length = 206 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target154 deoxyuridine 5 27-triphosphate nucleotidohydrolase [Can
3mdx_A178 Deoxyuridine 5'-triphosphate nucleotidohydrolase; metal 100.0
1euw_A152 Dutpase, deoxyuridine 5'-triphosphate nucleotidohydrola 100.0
3hza_A174 Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly 100.0
3ecy_A160 CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimer 100.0
3ehw_A164 DUTP pyrophosphatase; jelly-roll, FULL-length C-termina 100.0
2p9o_A169 DUTP pyrophosphatase-like protein; dutpase, magnesium b 100.0
3ca9_A165 Deoxyuridine triphosphatase; dutpase chlorella virus, h 100.0
2ol1_A147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, 100.0
3f4f_A167 Deoxyuridine 5'-triphosphate nucleotidohydrolase; trime 100.0
3c2t_A141 Deoxyuridine triphosphatase; dutpase chlorella virus, h 100.0
3lqw_A163 Deoxyuridine 5'-triphosphate nucleotidohydrolase; emera 100.0
3p48_A147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; trime 100.0
3h6x_A148 Dutpase; jelly-roll beta-barrel, hydrolase; 1.70A {Stre 100.0
1vyq_A173 Deoxyuridine 5'-triphosphate nucleotidohydrolase; drug 100.0
2xcd_A144 Probable deoxyuridine 5'-triphosphate nucleotidoh YNCF; 100.0
1f7d_A136 POL polyprotein; eight stranded beta-barrel, viral prot 100.0
1dun_A134 Deoxyuridine 5'-triphosphate nucleoditohydrolase; dutpa 100.0
2d4n_A152 DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason-pfize 100.0
2bsy_A278 Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpa 100.0
2bsy_A 278 Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpa 99.9
2qxx_A190 DCTP deaminase, deoxycytidine triphosphate deaminase; d 99.89
1xs1_A193 DCTP deaminase, deoxycytidine triphosphate deaminase; n 99.83
2yzj_A169 167AA long hypothetical dutpase; all beta proteins, hyp 99.83
1pkh_A204 Bifunctional deaminase/diphosphatase; DCTP deaminase, d 99.66
2r9q_A370 AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; 99.64
3km3_A206 DCTP deaminase, deoxycytidine triphosphate deaminase; s 99.75
2r9q_A 370 AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; 99.58
>3mdx_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; metal-binding, nucleotide metabolism, structural genomics; 1.45A {Brucella melitensis} PDB: 3mbq_A Back     alignment and structure
Probab=100.00  E-value=0  Score=332.15  Aligned_cols=147  Identities=53%  Similarity=0.928  Sum_probs=140.7

Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCEEEEEEECCCCCCEEECCCCEEEEECCCHHHCCCCEEEEEEECCCCEEEEEEECCC
Q ss_conf             78999767547970374357886408789103778738937997399965860225876146787526631332220235
Q gi|254781025|r    5 DIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACLN   84 (154)
Q Consensus         5 ~iki~~~~~~~~~~lP~~~t~~~AG~Dl~a~~~~~e~~~i~pg~~~li~Tgi~i~ip~g~~~~i~~RSsl~~K~gl~~~n   84 (154)
                      +++|++|++.++++||+|+|++||||||||+++++++++|+|+++++|+||+++++|+||+++|++|||+++|+||.+.|
T Consensus        31 ~~~~~~l~~~~~~~lP~rat~gdAG~DL~a~~~~~~~v~i~Pge~~~I~TGi~i~iP~g~~g~I~~RSsla~K~gl~l~n  110 (178)
T 3mdx_A           31 TLGIIRLEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYEVQIRPRSGLAFKNGITCLN  110 (178)
T ss_dssp             CCEEEECGGGTTSCCCCCSSTTCSCEEEECCCCTTCCEEECTTCEEEEEEEEEEECCTTEEEEEECCHHHHHHHCEEETT
T ss_pred             EEEEEECCCCCCCCCCCCCCCCEEEEEEECCCCCCCCEEECCCCEEEEECCCEEECCCCCEEEEECCCCCCEEEEEEECC
T ss_conf             07899898878999886789985886687256778987988998899868924755999788997278502160799523


Q ss_pred             CCEEECCCCCCCEEEEEEECCCCEEEEECCCCEEEEEEEECCCCEEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             503665687887699999807944999559503589997504340699871357754268888735467
Q gi|254781025|r   85 SPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAMPMGKNERNEKGFGSTGL  153 (154)
Q Consensus        85 ~~GvID~~YrGei~v~l~N~~~~~~~i~~G~RIaQlv~~~~~~~~~~~v~~~~l~~t~RG~~GFGSTG~  153 (154)
                      ++||||+||||||+|.|+|++++++.|++|+|||||||+|+.+++|+++  ++|++|+||+|||||||.
T Consensus       111 ~~GIIDsdYrGEI~v~l~N~~~~~~~I~~GdRIAQlv~~p~~~~~~~ev--~~l~~t~RG~gGFGSTG~  177 (178)
T 3mdx_A          111 TPGTIDSDYRGEVKVLLINLGDDDFRIERGMRIAQAVFAPVIQPKIEER--AKISETARGAGGFGSTGT  177 (178)
T ss_dssp             CSEEECTTCCSEEEEEEEECSSSCEEECTTCEEEEEEEEECCCCCCCCC--CC-----CCTTCC-----
T ss_pred             CCCEECCCCCCEEEEEEEECCCCCEEECCCCEEEEEEEEECCCCEEEEC--CCCCCCCCCCCCCCCCCC
T ss_conf             5546867775157999997989997981999899999832376659994--857877668996485883



>1euw_A Dutpase, deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, mercury derivative; 1.05A {Escherichia coli} SCOP: b.85.4.1 PDB: 1dud_A 1dup_A 1eu5_A 1rn8_A* 1seh_A* 2hr6_A* 2hrm_A* 1rnj_A* 1syl_A* Back     alignment and structure
>3hza_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, domain swapping, nucleotide metabolism; HET: DUP; 1.20A {Mycobacterium tuberculosis} PDB: 1six_A* 1slh_A* 1sm8_A* 1smc_A* 1snf_A* 2py4_A* 3h6d_A* 3i93_A* 1mq7_A 1sjn_A* Back     alignment and structure
>3ecy_A CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimeric assembly, hydrolase; 1.88A {Drosophila melanogaster} Back     alignment and structure
>3ehw_A DUTP pyrophosphatase; jelly-roll, FULL-length C-terminal ARM, enzyme-ligand complex, hydrolase; HET: DUP; 1.80A {Homo sapiens} SCOP: b.85.4.1 PDB: 2hqu_A* 1q5h_A* 1q5u_X Back     alignment and structure
>2p9o_A DUTP pyrophosphatase-like protein; dutpase, magnesium binding, hydrolase; 2.00A {Arabidopsis thaliana} PDB: 2pc5_A Back     alignment and structure
>3ca9_A Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} Back     alignment and structure
>2ol1_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, jelly-roll, superfamily, dutpase-like; HET: UMP; 1.80A {Vaccinia virus} PDB: 2oke_A* 2okd_A* 2ol0_A* 2okb_A Back     alignment and structure
>3f4f_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, UMP, product complex, DUTP pyrophosphatase, DITP; HET: UMP; 2.00A {Saccharomyces cerevisiae} PDB: 3hhq_A Back     alignment and structure
>3c2t_A Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} PDB: 3c3i_A* Back     alignment and structure
>3lqw_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; emerald biostructures, ALS collaborative crystallography; 1.30A {Entamoeba histolytica} Back     alignment and structure
>3p48_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, DUMPPNP pyrophosphatase, phosphoprotein, structural genomics; HET: DUP; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3h6x_A Dutpase; jelly-roll beta-barrel, hydrolase; 1.70A {Streptococcus mutans} Back     alignment and structure
>1vyq_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; drug design, dutpase, deoxyuridine nucleotidohydrolase, malaria; HET: DUX; 2.4A {Plasmodium falciparum} SCOP: b.85.4.1 Back     alignment and structure
>2xcd_A Probable deoxyuridine 5'-triphosphate nucleotidoh YNCF; hydrolase; 1.84A {Bacillus subtilis} PDB: 2xce_A* 2baz_A Back     alignment and structure
>1f7d_A POL polyprotein; eight stranded beta-barrel, viral protein, hydrolase; 1.40A {Feline immunodeficiency virus} SCOP: b.85.4.1 PDB: 1f7k_A* 1f7n_A* 1f7o_A 1f7p_A* 1f7q_A* 1f7r_A* 1dut_A Back     alignment and structure
>1dun_A Deoxyuridine 5'-triphosphate nucleoditohydrolase; dutpase, EIAV, trimeric enzyme, aspartyl protease; 1.90A {Equine infectious anemia virus} SCOP: b.85.4.1 PDB: 1duc_A Back     alignment and structure
>2d4n_A DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason-pfizer monkey virus} PDB: 2d4m_A 2d4l_A* Back     alignment and structure
>2bsy_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4} SCOP: b.85.4.1 b.85.4.1 PDB: 2bt1_A* 2we1_A* 2we0_A* 2we2_A* 2we3_A* Back     alignment and structure
>2bsy_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4} SCOP: b.85.4.1 b.85.4.1 PDB: 2bt1_A* 2we1_A* 2we0_A* 2we2_A* 2we3_A* Back     alignment and structure
>2qxx_A DCTP deaminase, deoxycytidine triphosphate deaminase; distorted beta barrel, hydrolase, nucleotide metabolism; HET: TTP 1PE; 2.00A {Mycobacterium tuberculosis H37RV} PDB: 2qlp_A* Back     alignment and structure
>1xs1_A DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli} SCOP: b.85.4.1 PDB: 2v9x_A* 1xs6_A* 1xs4_A* 2j4q_A* 2j4h_A* Back     alignment and structure
>2yzj_A 167AA long hypothetical dutpase; all beta proteins, hypothetical protein, NPPSFA; HET: DUD; 1.66A {Sulfolobus tokodaii} PDB: 2zdc_A Back     alignment and structure
>1pkh_A Bifunctional deaminase/diphosphatase; DCTP deaminase, dutpase, DCD-DUT, MJ0430, DCTP, DUTP, hydrolase; 1.42A {Methanocaldococcus jannaschii} SCOP: b.85.4.1 PDB: 1ogh_A 1pkj_A* 1pkk_A* 2hxb_A 2hxe_A 3gf0_A 2hxd_A* Back     alignment and structure
>2r9q_A AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3km3_A DCTP deaminase, deoxycytidine triphosphate deaminase; ssgcid, NIH, niaid, SBRI, UW, decode, iodide phasing, hydrolase; 2.10A {Anaplasma phagocytophilum HZ} Back     alignment and structure
>2r9q_A AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 154 deoxyuridine 5 27-triphosphate nucleotidohydrolase [Can
d1euwa_136 b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohy 2e-26
d1sixa_153 b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohy 2e-22
d2bsya1113 b.85.4.1 (A:4-116) Monomeric viral dUTPase {Epstein-bar 6e-22
d2bsya2136 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epstein-b 1e-21
d1f7da_118 b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohy 3e-19
d1vyqa1159 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nucleot 1e-18
d1duna_120 b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohy 8e-17
d3ehwa1136 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate nucleo 2e-16
d1xs1a_193 b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCT 4e-08
d1pkha_182 b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Arch 8e-08
>d1euwa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]} Length = 136 Back     information, alignment and structure

class: All beta proteins
fold: beta-clip
superfamily: dUTPase-like
family: dUTPase-like
domain: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase)
species: Escherichia coli [TaxId: 562]
 Score =  111 bits (279), Expect = 2e-26
 Identities = 55/130 (42%), Positives = 74/130 (56%), Gaps = 3/130 (2%)

Query: 1   MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAI 60
           M+ ID+  L        PLP Y TSGS+G+DL A L  ++ VEL PG  +L+P G  I I
Sbjct: 2   MKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRACL--NDAVELAPGDTTLVPTGLAIHI 59

Query: 61  P-PGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQ 119
             P     +  RSGL   +G+   N  G IDSDY+G++ I + N GQ++F I  G RIAQ
Sbjct: 60  ADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDSFTIQPGERIAQ 119

Query: 120 LIIANSVRAH 129
           +I    V+A 
Sbjct: 120 MIFVPVVQAE 129


>d1sixa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]} Length = 153 Back     information, alignment and structure
>d2bsya1 b.85.4.1 (A:4-116) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]} Length = 113 Back     information, alignment and structure
>d2bsya2 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]} Length = 136 Back     information, alignment and structure
>d1f7da_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]} Length = 118 Back     information, alignment and structure
>d1vyqa1 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]} Length = 159 Back     information, alignment and structure
>d1duna_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Equine infectious anemia virus [TaxId: 11665]} Length = 120 Back     information, alignment and structure
>d3ehwa1 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d1xs1a_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]} Length = 193 Back     information, alignment and structure
>d1pkha_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 182 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target154 deoxyuridine 5 27-triphosphate nucleotidohydrolase [Can
d3ehwa1136 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 100.0
d1sixa_153 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 100.0
d1euwa_136 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 100.0
d1vyqa1159 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 100.0
d1f7da_118 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 100.0
d1duna_120 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 100.0
d2bsya2136 Monomeric viral dUTPase {Epstein-barr virus [TaxId: 103 99.97
d2bsya1113 Monomeric viral dUTPase {Epstein-barr virus [TaxId: 103 99.95
d1xs1a_193 Deoxycytidine triphosphate deaminase (dCTP deaminase) { 99.82
d1pkha_182 Bifunctional dCTP deaminase/dUTPase {Archaeon Methanoco 99.73
>d3ehwa1 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: beta-clip
superfamily: dUTPase-like
family: dUTPase-like
domain: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=0  Score=284.50  Aligned_cols=136  Identities=32%  Similarity=0.558  Sum_probs=127.1

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCEEEEEEECCCCCCEEECCCCEEEEECCCHHHCCCCEEEEEEECCCCEEEEEEECC
Q ss_conf             57899976754797037435788640878910377873893799739996586022587614678752663133222023
Q gi|254781025|r    4 IDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACL   83 (154)
Q Consensus         4 ~~iki~~~~~~~~~~lP~~~t~~~AG~Dl~a~~~~~e~~~i~pg~~~li~Tgi~i~ip~g~~~~i~~RSsl~~K~gl~~~   83 (154)
                      |++||+|+.  +++.+|+|+|++||||||||+    ++++|+|+++++|+||+++++|+||+++|+||||++.|++|.+ 
T Consensus         1 m~~k~~kl~--~~a~~P~r~t~~~AG~DL~~~----ed~~i~p~~~~~i~tgi~~~ip~g~~~~i~~RSs~~~k~~l~~-   73 (136)
T d3ehwa1           1 MQLRFARLS--EHATAPTRGSARAAGYDLYSA----YDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDV-   73 (136)
T ss_dssp             CCEEEEESS--TTCCCCEESSTTCSEEEEECS----SCEEECTTEEEEEECCEEEECCTTEEEEEECCHHHHHHHCEEE-
T ss_pred             CEEEEEECC--CCCCCCCCCCCCCCEEEEECC----EEEEEECCCEEEEECCCEEEECCCCEEEEEEECCCCCCCEEEE-
T ss_conf             979999899--998786127899715999547----5499973632899978488604895887864035566445980-


Q ss_pred             CCCEEECCCCCCCEEEEEEECCCCEEEEECCCCEEEEEEEECCCCEEEEEECCCCCCCCCCCCCCC
Q ss_conf             550366568788769999980794499955950358999750434069987135775426888873
Q gi|254781025|r   84 NSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAMPMGKNERNEKGFG  149 (154)
Q Consensus        84 n~~GvID~~YrGei~v~l~N~~~~~~~i~~G~RIaQlv~~~~~~~~~~~v~~~~l~~t~RG~~GFG  149 (154)
                       +.||||+||||||++.++|++++++.|++|+||||+++.|+..+++++++  ++++|+||++|||
T Consensus        74 -~~GvID~dYrGei~v~l~N~~~~~~~i~~G~riaQlv~~~~~~~~~~~v~--~l~~t~RG~gGFG  136 (136)
T d3ehwa1          74 -GAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQ--ALDDTERGSGGFG  136 (136)
T ss_dssp             -ECCEECTTBCSCCEEEEEECSSSCEEECTTCEEEEEEEEEBCCCCEEECS--CCCCCSSBTCCTT
T ss_pred             -CCEEECCCCCCEEEEEEEECCCCCEEEECCCEEEEEEECCCCCEEEEEEC--CCCCCCCCCCCCC
T ss_conf             -78797488873299999961563327724973899998167852899946--3687746789898



>d1sixa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]} Back     information, alignment and structure
>d1euwa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vyqa1 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1f7da_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]} Back     information, alignment and structure
>d1duna_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Equine infectious anemia virus [TaxId: 11665]} Back     information, alignment and structure
>d2bsya2 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]} Back     information, alignment and structure
>d2bsya1 b.85.4.1 (A:4-116) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]} Back     information, alignment and structure
>d1xs1a_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pkha_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 154 deoxyuridine 5 27-triphosphate nucleotidohydrolase
1dun_A_134 (A:) Deoxyuridine 5'-triphosphate nucleoditohydrol 3e-30
1euw_A_152 (A:) Dutpase, deoxyuridine 5'-triphosphate nucleot 3e-30
3hza_A_174 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrol 5e-30
2ol1_A_147 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrol 2e-29
3c2t_A_141 (A:) Deoxyuridine triphosphatase; dutpase chlorell 2e-28
3ca9_A_165 (A:) Deoxyuridine triphosphatase; dutpase chlorell 2e-28
1pkh_A_204 (A:) Bifunctional deaminase/diphosphatase; DCTP de 1e-27
3f4f_A_167 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrol 2e-27
2baz_A_142 (A:) YOSS, hypothetical protein BSU20020; homotrim 3e-27
1xs1_A_193 (A:) DCTP deaminase, deoxycytidine triphosphate de 7e-27
2p9o_A_169 (A:) DUTP pyrophosphatase-like protein; dutpase, m 1e-26
1f7d_A_136 (A:) POL polyprotein; eight stranded beta-barrel, 1e-26
3ecy_A_160 (A:) CG4584-PA, isoform A (bcDNA.LD08534); jelly-r 3e-26
2bsy_A_117-244128 (A:117-244) Deoxyuridine 5'-triphosphate nucleotid 3e-26
3ehw_A_164 (A:) DUTP pyrophosphatase; jelly-roll, FULL-length 3e-26
3km3_A_206 (A:) DCTP deaminase, deoxycytidine triphosphate de 7e-26
2qxx_A_190 (A:) DCTP deaminase, deoxycytidine triphosphate de 1e-25
2d4n_A_152 (A:) DU; jelly roll, hydrolase; HET: UPR; 1.53A {M 3e-25
1vyq_A_173 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrol 7e-25
2yzj_A_169 (A:) 167AA long hypothetical dutpase; all beta pro 2e-21
2r9q_A_175-370196 (A:175-370) AGR_C_764P, 2'-deoxycytidine 5'-tripho 2e-20
2r9q_A_1-174174 (A:1-174) AGR_C_764P, 2'-deoxycytidine 5'-triphosp 9e-20
>1dun_A (A:) Deoxyuridine 5'-triphosphate nucleoditohydrolase; dutpase, EIAV, trimeric enzyme, aspartyl protease; 1.90A {Equine infectious anemia virus}Length = 134 Back     alignment and structure
 Score =  125 bits (315), Expect = 3e-30
 Identities = 40/141 (28%), Positives = 63/141 (44%), Gaps = 9/141 (6%)

Query: 14  AHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSG 73
           A+     + K    +G DL         + +      +IP    I +PP   G V  +S 
Sbjct: 3   AYQGTQIKEKRDEDAGFDLCVP----YDIMIPVSDTKIIPTDVKIQVPPNSFGWVTGKSS 58

Query: 74  LALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLI 133
           +A       L + G ID  Y GEI+++  N+G+ N  ++ G + AQLII        S  
Sbjct: 59  MAKQG---LLINGGIIDEGYTGEIQVICTNIGKSNIKLIEGQKFAQLIILQHH--SNSRQ 113

Query: 134 SAMPMGKNERNEKGFGSTGLY 154
                  ++R +KGFGSTG++
Sbjct: 114 PWDENKISQRGDKGFGSTGVF 134


>1euw_A (A:) Dutpase, deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, mercury derivative; 1.05A {Escherichia coli}Length = 152 Back     alignment and structure
>3hza_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, domain swapping, nucleotide metabolism; HET: DUP; 1.20A {Mycobacterium tuberculosis} PDB: 1six_A* 1slh_A* 1sm8_A* 1smc_A* 1snf_A* 2py4_A* 3h6d_A* 3i93_A* 1mq7_A 1sjn_A*Length = 174 Back     alignment and structure
>2ol1_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, jelly-roll, superfamily, dutpase-like; HET: UMP; 1.80A {Vaccinia virus} PDB: 2oke_A* 2okd_A* 2ol0_A* 2okb_ALength = 147 Back     alignment and structure
>3c2t_A (A:) Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} PDB: 3c3i_A*Length = 141 Back     alignment and structure
>3ca9_A (A:) Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A}Length = 165 Back     alignment and structure
>1pkh_A (A:) Bifunctional deaminase/diphosphatase; DCTP deaminase, dutpase, DCD-DUT, MJ0430, DCTP, DUTP, hydrolase; 1.42A {Methanocaldococcus jannaschii}Length = 204 Back     alignment and structure
>3f4f_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, UMP, product complex, DUTP pyrophosphatase, DITP; HET: UMP; 2.00A {Saccharomyces cerevisiae} PDB: 3hhq_ALength = 167 Back     alignment and structure
>2baz_A (A:) YOSS, hypothetical protein BSU20020; homotrimer, beta barrel, unknown function; 2.30A {Bacillus subtilis}Length = 142 Back     alignment and structure
>1xs1_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli}Length = 193 Back     alignment and structure
>2p9o_A (A:) DUTP pyrophosphatase-like protein; dutpase, magnesium binding, hydrolase; 2.00A {Arabidopsis thaliana} PDB: 2pc5_ALength = 169 Back     alignment and structure
>1f7d_A (A:) POL polyprotein; eight stranded beta-barrel, viral protein, hydrolase; 1.40A {Feline immunodeficiency virus}Length = 136 Back     alignment and structure
>3ecy_A (A:) CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimeric assembly, hydrolase; 1.88A {Drosophila melanogaster}Length = 160 Back     alignment and structure
>2bsy_A (A:117-244) Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4}Length = 128 Back     alignment and structure
>3ehw_A (A:) DUTP pyrophosphatase; jelly-roll, FULL-length C-terminal ARM, enzyme-ligand complex, hydrolase; HET: DUP; 1.80A {Homo sapiens}Length = 164 Back     alignment and structure
>3km3_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; ssgcid, NIH, niaid, SBRI, UW, decode, iodide phasing, hydrolase; 2.10A {Anaplasma phagocytophilum HZ}Length = 206 Back     alignment and structure
>2qxx_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; distorted beta barrel, hydrolase, nucleotide metabolism; HET: TTP 1PE; 2.00A {Mycobacterium tuberculosis H37RV} PDB: 2qlp_A*Length = 190 Back     alignment and structure
>2d4n_A (A:) DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason-pfizer monkey virus} PDB: 2d4m_A 2d4l_A*Length = 152 Back     alignment and structure
>1vyq_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; drug design, dutpase, deoxyuridine nucleotidohydrolase, malaria; HET: DUX; 2.4A {Plasmodium falciparum}Length = 173 Back     alignment and structure
>2yzj_A (A:) 167AA long hypothetical dutpase; all beta proteins, hypothetical protein, NPPSFA; HET: DUD; 1.66A {Sulfolobus tokodaii} PDB: 2zdc_ALength = 169 Back     alignment and structure
>2r9q_A (A:175-370) AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str}Length = 196 Back     alignment and structure
>2r9q_A (A:1-174) AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str}Length = 174 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target154 deoxyuridine 5 27-triphosphate nucleotidohydrolase [Can
1euw_A_152 Dutpase, deoxyuridine 5'-triphosphate nucleotidohy 100.0
3c2t_A_141 Deoxyuridine triphosphatase; dutpase chlorella vir 100.0
2baz_A_142 YOSS, hypothetical protein BSU20020; homotrimer, b 100.0
3hza_A_174 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
2ol1_A_147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
1dun_A_134 Deoxyuridine 5'-triphosphate nucleoditohydrolase; 100.0
1f7d_A_136 POL polyprotein; eight stranded beta-barrel, viral 100.0
2p9o_A_169 DUTP pyrophosphatase-like protein; dutpase, magnes 100.0
3ecy_A_160 CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, 100.0
3f4f_A_167 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
3ca9_A_165 Deoxyuridine triphosphatase; dutpase chlorella vir 100.0
3ehw_A_164 DUTP pyrophosphatase; jelly-roll, FULL-length C-te 100.0
1vyq_A_173 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
2bsy_A_117-244128 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
2qxx_A_190 DCTP deaminase, deoxycytidine triphosphate deamina 100.0
1xs1_A_193 DCTP deaminase, deoxycytidine triphosphate deamina 100.0
2d4n_A_152 DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason- 100.0
1pkh_A_204 Bifunctional deaminase/diphosphatase; DCTP deamina 100.0
3km3_A_206 DCTP deaminase, deoxycytidine triphosphate deamina 99.97
2r9q_A_175-370196 AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deami 99.97
2yzj_A_169 167AA long hypothetical dutpase; all beta proteins 99.96
2bsy_A_1-116_245-278150 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 98.98
2r9q_A_1-174174 AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deami 99.92
>1euw_A (A:) Dutpase, deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, mercury derivative; 1.05A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=8.1e-42  Score=257.57  Aligned_cols=149  Identities=40%  Similarity=0.633  Sum_probs=134.2

Q ss_pred             CCEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEEECCCCCCEEECCCCEEEEECCCHHHCCCC-EEEEEEECCCCEEEEE
Q ss_conf             963578999767547970374357886408789103778738937997399965860225876-1467875266313322
Q gi|254781025|r    1 MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPG-YEGQVRSRSGLALNYG   79 (154)
Q Consensus         1 M~~~~iki~~~~~~~~~~lP~~~t~~~AG~Dl~a~~~~~e~~~i~pg~~~li~Tgi~i~ip~g-~~~~i~~RSsl~~K~g   79 (154)
                      |+.+.++++.-+.+..+.+|++.+++||||||+++  .++.++|+|+++++++|++++++|++ |.++|++|||++.|..
T Consensus         2 ~~~~~~~i~~~~~~~~~~~p~~~~~~~ag~Dl~~~--~~~~~~l~P~~~~lv~t~~~i~lP~~~~~~~i~~RSsl~~~g~   79 (152)
T 1euw_A            2 MKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRAC--LNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHG   79 (152)
T ss_dssp             CCCCEEEECSTTBTTTBCCCCCSSTTCCCEEEECC--CSSCEEECTTCEEEEEEEEEEECCCTTEEEEEEECHHHHHHHC
T ss_pred             CCEEEEEEECCCCCCCCCCCCCCCCCHHHEEECCC--CCCCEEECCCCEEEEECCEEEECCCCCEEEEEECCCCCHHHCC
T ss_conf             85165899776656788877757998301617226--7886888999889987896998389876999952675313278


Q ss_pred             EECCCCCEEECCCCCCCEEEEEEECCCCEEEEECCCCEEEEEEEECCCCEEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             20235503665687887699999807944999559503589997504340699871357754268888735467
Q gi|254781025|r   80 VACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAMPMGKNERNEKGFGSTGL  153 (154)
Q Consensus        80 l~~~n~~GvID~~YrGei~v~l~N~~~~~~~i~~G~RIaQlv~~~~~~~~~~~v~~~~l~~t~RG~~GFGSTG~  153 (154)
                      |.+.|++|+||+||||+|++.++|.++.++.|++|+||||++|.++..+.+++++  ++.+++||++||||||+
T Consensus        80 i~~~~~~g~iD~gy~G~i~i~l~N~~~~~~~I~~g~rIaQlv~~~~~~~~~~~~~--~~~~~~Rg~~gfGStG~  151 (152)
T 1euw_A           80 IVLGNLVGLIDSDYQGQLMISVWNRGQDSFTIQPGERIAQMIFVPVVQAEFNLVE--DFDATDRGEGGFGHSGR  151 (152)
T ss_dssp             EEETTSSEEECTTCCSEEEEEEEECSSSCEEECTTCEEEEEEEEECCCCCCCCCS--CC---------------
T ss_pred             EEECCCCCEECCCCCCEEEEEEEECCCCCEEECCCCEEEEEEEEEECCCCEEEEC--CCCCCCCCCCCCCCCCC
T ss_conf             5843656409899976179999957998989809998999998641446679934--16876334897676880



>3c2t_A (A:) Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} PDB: 3c3i_A* Back     alignment and structure
>2baz_A (A:) YOSS, hypothetical protein BSU20020; homotrimer, beta barrel, unknown function; 2.30A {Bacillus subtilis} Back     alignment and structure
>3hza_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, domain swapping, nucleotide metabolism; HET: DUP; 1.20A {Mycobacterium tuberculosis} PDB: 1six_A* 1slh_A* 1sm8_A* 1smc_A* 1snf_A* 2py4_A* 3h6d_A* 3i93_A* 1mq7_A 1sjn_A* Back     alignment and structure
>2ol1_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, jelly-roll, superfamily, dutpase-like; HET: UMP; 1.80A {Vaccinia virus} PDB: 2oke_A* 2okd_A* 2ol0_A* 2okb_A Back     alignment and structure
>1dun_A (A:) Deoxyuridine 5'-triphosphate nucleoditohydrolase; dutpase, EIAV, trimeric enzyme, aspartyl protease; 1.90A {Equine infectious anemia virus} Back     alignment and structure
>1f7d_A (A:) POL polyprotein; eight stranded beta-barrel, viral protein, hydrolase; 1.40A {Feline immunodeficiency virus} Back     alignment and structure
>2p9o_A (A:) DUTP pyrophosphatase-like protein; dutpase, magnesium binding, hydrolase; 2.00A {Arabidopsis thaliana} PDB: 2pc5_A Back     alignment and structure
>3ecy_A (A:) CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimeric assembly, hydrolase; 1.88A {Drosophila melanogaster} Back     alignment and structure
>3f4f_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, UMP, product complex, DUTP pyrophosphatase, DITP; HET: UMP; 2.00A {Saccharomyces cerevisiae} PDB: 3hhq_A Back     alignment and structure
>3ca9_A (A:) Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} Back     alignment and structure
>3ehw_A (A:) DUTP pyrophosphatase; jelly-roll, FULL-length C-terminal ARM, enzyme-ligand complex, hydrolase; HET: DUP; 1.80A {Homo sapiens} Back     alignment and structure
>1vyq_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; drug design, dutpase, deoxyuridine nucleotidohydrolase, malaria; HET: DUX; 2.4A {Plasmodium falciparum} Back     alignment and structure
>2bsy_A (A:117-244) Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4} Back     alignment and structure
>2qxx_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; distorted beta barrel, hydrolase, nucleotide metabolism; HET: TTP 1PE; 2.00A {Mycobacterium tuberculosis H37RV} PDB: 2qlp_A* Back     alignment and structure
>1xs1_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli} Back     alignment and structure
>2d4n_A (A:) DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason-pfizer monkey virus} PDB: 2d4m_A 2d4l_A* Back     alignment and structure
>1pkh_A (A:) Bifunctional deaminase/diphosphatase; DCTP deaminase, dutpase, DCD-DUT, MJ0430, DCTP, DUTP, hydrolase; 1.42A {Methanocaldococcus jannaschii} Back     alignment and structure
>3km3_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; ssgcid, NIH, niaid, SBRI, UW, decode, iodide phasing, hydrolase; 2.10A {Anaplasma phagocytophilum HZ} Back     alignment and structure
>2r9q_A (A:175-370) AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>2yzj_A (A:) 167AA long hypothetical dutpase; all beta proteins, hypothetical protein, NPPSFA; HET: DUD; 1.66A {Sulfolobus tokodaii} PDB: 2zdc_A Back     alignment and structure
>2bsy_A (A:1-116,A:245-278) Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4} Back     alignment and structure
>2r9q_A (A:1-174) AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str} Back     alignment and structure