254781026

254781026

hypothetical protein CLIBASIA_04640

GeneID in NCBI database:8210049Locus tag:CLIBASIA_04640
Protein GI in NCBI database:254781026Protein Accession:YP_003065439.1
Gene range:-(1027107, 1027667)Protein Length:186aa
Gene description:hypothetical protein
COG prediction:[O] Predicted ATPase with chaperone activity
KEGG prediction:hypothetical protein; K07391 magnesium chelatase family protein
SEED prediction:MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPSRTHIRSFCNE
ccccccHHHHHHHHHHHHHcccccHHHHHHHHcEEEccccccccccccccccccccccccHHHHHHHccccccccEEEEccccEEEEEccccccHHHHHHHHHHHHccEEEEEEccEEEEEcccEEEEEEEccccccccccccccccccHHHHHHHHHcccccccccccEEEEEEcccHHHHcccc
ccccccccccHHHHHcccccccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHccccccccccEEEEccccEEEccccccccHHHHHHHcccccccEEEEEEEccccccccHEEEEEccccccccccccccccccccHHHHHHHHHHccccccccEEEEEEcccccHHHHHccc
migppgarkSMLASclpsillplsleESLEVSMIYSIsghssheysfiqnrpfrsphhSVTIAALIGgglqvlpgedslahngvlfldeipefspqTLNALRQPLETGECIIARanrkisypSRIQLIAAmnpcrcgmsnkdenvcirgprcateyqarisgplmdridiriavpsrthirsfcne
migppgarksmLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQarisgplmdrIDIRiavpsrthirsfcne
MIGPPGARKSMlasclpsillplsleeslevsMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPSRTHIRSFCNE
MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPSRTHI******
**********MLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPSRTHIRSFCNE
******A*KSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPSRTHIR*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPSRTHIRSFCNE
MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPSRTHIRSFCNE
MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPSRTHIRSFCNE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target186 hypothetical protein CLIBASIA_04640 [Candidatus Liberib
315122602422 hypothetical protein CKC_04270 [Candidatus Liberibacter 1 7e-85
159184251 510 hypothetical protein Atu0311 [Agrobacterium tumefaciens 1 2e-66
241207282 510 Mg chelatase, subunit ChlI [Rhizobium leguminosarum bv. 1 6e-66
327192037 540 putative Mg-chelatase protein [Rhizobium etli CNPAF512] 1 1e-65
86355980 510 Mg-chelatase protein [Rhizobium etli CFN 42] Length = 5 1 2e-65
325291745 489 magnesium chelatase family protein [Agrobacterium sp. H 1 3e-65
209551905 510 Mg chelatase, subunit ChlI [Rhizobium leguminosarum bv. 1 3e-65
319407913 510 conserved hypothetical protein [Bartonella schoenbuchen 1 3e-65
116250107 510 Mg2+ chelatase family protein [Rhizobium leguminosarum 1 3e-65
190889991 510 Mg-chelatase [Rhizobium etli CIAT 652] Length = 510 1 3e-65
>gi|315122602|ref|YP_004063091.1| hypothetical protein CKC_04270 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 422 Back     alignment and organism information
 Score =  317 bits (811), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 165/176 (93%)

Query: 1   MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSV 60
           MIGPPGA KSMLASCLPSIL PLSL+ESLEVSMIYS+S  SS E SFIQ+RPFR+PHHSV
Sbjct: 215 MIGPPGAGKSMLASCLPSILPPLSLKESLEVSMIYSLSRKSSDESSFIQDRPFRTPHHSV 274

Query: 61  TIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKIS 120
           T AALIGGG QVLPGE SLAHNG+LFLDE+PEFSP TLN+LRQPLETGECII+RANRKIS
Sbjct: 275 TTAALIGGGTQVLPGEASLAHNGILFLDELPEFSPHTLNSLRQPLETGECIISRANRKIS 334

Query: 121 YPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPS 176
           YP+RIQLIAAMNPCRCGMS++DENVCIRGPRCA EYQ+RISGPLMDRIDIRIAVP+
Sbjct: 335 YPARIQLIAAMNPCRCGMSSRDENVCIRGPRCAIEYQSRISGPLMDRIDIRIAVPA 390


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159184251|ref|NP_353342.2| hypothetical protein Atu0311 [Agrobacterium tumefaciens str. C58] Length = 510 Back     alignment and organism information
>gi|241207282|ref|YP_002978378.1| Mg chelatase, subunit ChlI [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 510 Back     alignment and organism information
>gi|327192037|gb|EGE59018.1| putative Mg-chelatase protein [Rhizobium etli CNPAF512] Length = 540 Back     alignment and organism information
>gi|86355980|ref|YP_467872.1| Mg-chelatase protein [Rhizobium etli CFN 42] Length = 510 Back     alignment and organism information
>gi|325291745|ref|YP_004277609.1| magnesium chelatase family protein [Agrobacterium sp. H13-3] Length = 489 Back     alignment and organism information
>gi|209551905|ref|YP_002283822.1| Mg chelatase, subunit ChlI [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 510 Back     alignment and organism information
>gi|319407913|emb|CBI81567.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 510 Back     alignment and organism information
>gi|116250107|ref|YP_765945.1| Mg2+ chelatase family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 510 Back     alignment and organism information
>gi|190889991|ref|YP_001976533.1| Mg-chelatase [Rhizobium etli CIAT 652] Length = 510 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target186 hypothetical protein CLIBASIA_04640 [Candidatus Liberib
COG0606 490 COG0606, COG0606, Predicted ATPase with chaperone activ 4e-66
TIGR00368499 TIGR00368, TIGR00368, Mg chelatase-related protein 7e-56
PRK09862 506 PRK09862, PRK09862, putative ATP-dependent protease; Pr 3e-45
COG0714 329 COG0714, COG0714, MoxR-like ATPases [General function p 7e-04
pfam01078207 pfam01078, Mg_chelatase, Magnesium chelatase, subunit C 6e-76
COG1239 423 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme meta 2e-07
KOG0480 764 KOG0480, KOG0480, KOG0480, DNA replication licensing fa 0.003
COG1241 682 COG1241, MCM2, Predicted ATPase involved in replication 0.004
TIGR02031 589 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subuni 4e-06
TIGR02442 633 TIGR02442, Cob-chelat-sub, cobaltochelatase subunit 2e-05
COG3829 560 COG3829, RocR, Transcriptional regulator containing PAS 7e-04
TIGR02902 531 TIGR02902, spore_lonB, ATP-dependent protease LonB 0.002
PRK11388 638 PRK11388, PRK11388, DNA-binding transcriptional regulat 0.003
>gnl|CDD|30951 COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|129465 TIGR00368, TIGR00368, Mg chelatase-related protein Back     alignment and domain information
>gnl|CDD|182120 PRK09862, PRK09862, putative ATP-dependent protease; Provisional Back     alignment and domain information
>gnl|CDD|31058 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information
>gnl|CDD|31432 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|35701 KOG0480, KOG0480, KOG0480, DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|31434 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|162667 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D Back     alignment and domain information
>gnl|CDD|162859 TIGR02442, Cob-chelat-sub, cobaltochelatase subunit Back     alignment and domain information
>gnl|CDD|33622 COG3829, RocR, Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|131948 TIGR02902, spore_lonB, ATP-dependent protease LonB Back     alignment and domain information
>gnl|CDD|183114 PRK11388, PRK11388, DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 186 hypothetical protein CLIBASIA_04640 [Candidatus Liberib
TIGR00368 505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 100.0
PRK09862 506 putative ATP-dependent protease; Provisional 100.0
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 100.0
COG0606 490 Predicted ATPase with chaperone activity [Posttranslati 100.0
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 100.0
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 100.0
TIGR02030 340 BchI-ChlI magnesium chelatase ATPase subunit I; InterPr 100.0
CHL00081 347 chlI Mg-protoporyphyrin IX chelatase 100.0
pfam00493 327 MCM MCM2/3/5 family. 100.0
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 100.0
smart00350 509 MCM minichromosome maintenance proteins. 99.98
COG1241 682 MCM2 Predicted ATPase involved in replication control, 99.97
KOG0480 764 consensus 99.96
PTZ00111 916 DNA replication licensing factor MCM4; Provisional 99.95
KOG0478 804 consensus 99.94
KOG0482 721 consensus 99.94
TIGR02902 532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 99.94
TIGR02031 705 BchD-ChlD magnesium chelatase ATPase subunit D; InterPr 99.94
KOG0477 854 consensus 99.94
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 99.91
KOG0479 818 consensus 99.9
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 99.9
KOG0481 729 consensus 99.88
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 99.83
pfam07726131 AAA_3 ATPase family associated with various cellular ac 99.82
COG0714 329 MoxR-like ATPases [General function prediction only] 99.76
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 99.67
PRK10865857 protein disaggregation chaperone; Provisional 99.65
TIGR00635 305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 99.64
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 99.63
CHL00095823 clpC Clp protease ATP binding subunit 99.63
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 99.61
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 99.59
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.56
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 99.54
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.54
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 99.52
COG1221 403 PspF Transcriptional regulators containing an AAA-type 99.46
COG2255 332 RuvB Holliday junction resolvasome, helicase subunit [D 99.44
PRK13342 417 recombination factor protein RarA; Reviewed 99.39
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; Provis 99.36
CHL00181287 cbbX CbbX; Provisional 99.35
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.31
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 99.29
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 99.26
PRK13531 498 regulatory ATPase RavA; Provisional 99.2
TIGR02974 349 phageshock_pspF psp operon transcriptional activator Ps 99.2
pfam00004131 AAA ATPase family associated with various cellular acti 99.15
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 98.95
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 98.95
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 98.91
CHL00195491 ycf46 Ycf46; Provisional 98.88
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 98.88
PRK03992390 proteasome-activating nucleotidase; Provisional 98.87
CHL00176 631 ftsH cell division protein; Validated 98.86
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 98.79
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.77
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 98.76
TIGR01818 471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 98.74
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 98.71
smart00382148 AAA ATPases associated with a variety of cellular activ 98.69
KOG0730693 consensus 98.67
KOG0734 752 consensus 98.64
KOG2004 906 consensus 98.62
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 98.62
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 98.54
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 98.5
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 98.49
PHA02244 383 ATPase-like protein 98.42
KOG0738491 consensus 98.28
CHL00095 823 clpC Clp protease ATP binding subunit 98.27
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 98.24
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 98.23
KOG0731 774 consensus 98.21
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 98.2
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 98.17
PRK10865 857 protein disaggregation chaperone; Provisional 98.16
KOG1808 1856 consensus 98.16
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 98.1
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational modi 97.99
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.74
PHA01747425 putative ATP-dependent protease 97.6
TIGR02688470 TIGR02688 conserved hypothetical protein TIGR02688; Int 97.55
PRK06526254 transposase; Provisional 97.53
PRK08181269 transposase; Validated 97.51
PRK09183258 transposase/IS protein; Provisional 97.45
KOG0736 953 consensus 97.27
KOG0728404 consensus 96.66
KOG0733 802 consensus 96.12
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 95.39
PRK12377248 putative replication protein; Provisional 95.26
KOG0744423 consensus 95.04
COG3172187 NadR Predicted ATPase/kinase involved in NAD metabolism 94.83
PRK07952242 DNA replication protein DnaC; Validated 94.77
TIGR02653 677 Lon_rel_chp conserved hypothetical protein; InterPro: I 94.22
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 94.05
TIGR01526346 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransfe 93.98
PRK08116262 hypothetical protein; Validated 93.59
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 93.1
PRK13765 637 ATP-dependent protease Lon; Provisional 99.84
COG1067 647 LonB Predicted ATP-dependent protease [Posttranslationa 98.94
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 98.58
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 98.0
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 98.0
TIGR00764 662 lon_rel ATP-dependent protease, putative; InterPro: IPR 97.87
COG4930 683 Predicted ATP-dependent Lon-type protease [Posttranslat 94.71
COG3829 560 RocR Transcriptional regulator containing PAS, AAA-type 99.44
PRK05022 510 anaerobic nitric oxide reductase transcription regulato 99.42
PRK10820 513 DNA-binding transcriptional regulator TyrR; Provisional 99.4
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 99.37
PRK11388 639 DNA-binding transcriptional regulator DhaR; Provisional 99.36
TIGR01817 574 nifA Nif-specific regulatory protein; InterPro: IPR0101 99.33
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisional 99.26
COG3604 550 FhlA Transcriptional regulator containing GAF, AAA-type 99.25
PRK10365 441 transcriptional regulatory protein ZraR; Provisional 99.23
COG2204 464 AtoC Response regulator containing CheY-like receiver, 99.21
PRK11608 325 pspF phage shock protein operon transcriptional activat 99.2
TIGR02915 451 PEP_resp_reg putative PEP-CTERM system response regulat 99.15
KOG1051 898 consensus 98.98
KOG2028 554 consensus 98.88
COG4650 531 RtcR Sigma54-dependent transcription regulator containi 98.87
TIGR02329 658 propionate_PrpR propionate catabolism operon regulatory 98.84
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 98.7
TIGR00382 452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 98.65
COG3283 511 TyrR Transcriptional regulator of aromatic amino acids 98.63
KOG0733 802 consensus 98.63
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 98.6
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 98.39
KOG0745 564 consensus 98.28
KOG0989 346 consensus 98.25
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 98.24
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 98.22
KOG0727408 consensus 97.97
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.86
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 97.69
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 97.67
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 97.61
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 97.61
KOG0652424 consensus 97.59
KOG0735952 consensus 97.54
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 97.42
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 97.39
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 97.36
PRK07940 395 DNA polymerase III subunit delta'; Validated 97.34
pfam03969 361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 97.29
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 97.26
TIGR02397 363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 97.25
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 97.01
KOG0991 333 consensus 96.99
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 96.96
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 96.92
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 96.91
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 96.88
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 96.87
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 96.84
pfam05272198 VirE Virulence-associated protein E. This family contai 96.83
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 96.65
KOG0726440 consensus 96.48
KOG0729435 consensus 96.42
COG4988559 CydD ABC-type transport system involved in cytochrome b 96.28
COG1485 367 Predicted ATPase [General function prediction only] 96.25
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 96.23
PRK08699 325 DNA polymerase III subunit delta'; Validated 96.13
COG1484254 DnaC DNA replication protein [DNA replication, recombin 96.09
pfam05621302 TniB Bacterial TniB protein. This family consists of se 95.61
COG0488530 Uup ATPase components of ABC transporters with duplicat 95.58
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 95.36
PRK06090 319 DNA polymerase III subunit delta'; Validated 95.27
KOG2170344 consensus 95.16
KOG0736 953 consensus 94.86
TIGR01189204 ccmA heme ABC exporter, ATP-binding protein CcmA; Inter 94.42
pfam01057271 Parvo_NS1 Parvovirus non-structural protein NS1. This f 94.21
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 94.2
PRK11147632 ABC transporter ATPase component; Reviewed 94.19
PRK10636638 putative ABC transporter ATP-binding protein; Provision 94.04
KOG0066807 consensus 94.02
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 93.88
KOG0651388 consensus 93.29
COG4178604 ABC-type uncharacterized transport system, permease and 93.01
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 92.93
TIGR02768 888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 92.76
PRK13341 726 recombination factor protein RarA/unknown domain fusion 99.43
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 98.62
PRK12402 337 replication factor C small subunit 2; Reviewed 98.56
KOG0742 630 consensus 98.51
COG0470 325 HolB ATPase involved in DNA replication [DNA replicatio 97.66
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 97.27
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 97.17
PRK07399314 DNA polymerase III subunit delta'; Validated 96.52
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 95.92
KOG1942456 consensus 95.74
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 95.58
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 94.51
KOG2035 351 consensus 94.06
cd03115173 SRP The signal recognition particle (SRP) mediates the 92.59
PRK00440 318 rfc replication factor C small subunit; Reviewed 98.45
KOG0737386 consensus 98.0
PRK09112 352 DNA polymerase III subunit delta'; Validated 97.6
PRK07471 363 DNA polymerase III subunit delta'; Validated 97.19
PRK13695174 putative NTPase; Provisional 97.12
PRK05564 313 DNA polymerase III subunit delta'; Validated 97.06
PRK08769 319 DNA polymerase III subunit delta'; Validated 96.78
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.76
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 96.63
PRK07132 303 DNA polymerase III subunit delta'; Validated 96.62
PRK05917290 DNA polymerase III subunit delta'; Validated 96.28
KOG0990 360 consensus 96.25
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.25
PRK10875 607 recD exonuclease V subunit alpha; Provisional 95.83
KOG1969 877 consensus 95.78
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 95.43
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 95.33
pfam03266168 DUF265 Protein of unknown function, DUF265. 94.96
PRK06964 342 DNA polymerase III subunit delta'; Validated 94.77
KOG0055 1228 consensus 94.53
pfam01443226 Viral_helicase1 Viral (Superfamily 1) RNA helicase. Hel 94.39
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 93.5
PRK10789569 putative multidrug transporter membrane\ATP-binding com 93.43
pfam05970 418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 93.36
pfam09848 348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 93.27
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 93.1
PRK10790593 putative multidrug transporter membrane\ATP-binding com 93.05
pfam06048 284 DUF927 Domain of unknown function (DUF927). Family of b 92.79
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 92.64
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 98.14
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 97.9
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 97.58
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 97.53
PRK04195 403 replication factor C large subunit; Provisional 97.49
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 97.43
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 97.3
PRK04132 863 replication factor C small subunit; Provisional 97.3
PRK08058 329 DNA polymerase III subunit delta'; Validated 96.91
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 96.74
PRK05707 328 DNA polymerase III subunit delta'; Validated 96.72
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 96.7
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 96.69
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 96.6
PRK06871 324 DNA polymerase III subunit delta'; Validated 96.43
PRK07993 334 DNA polymerase III subunit delta'; Validated 95.75
cd03246173 ABCC_Protease_Secretion This family represents the ABC 94.83
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 94.15
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 94.02
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 93.75
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 93.53
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 92.8
PRK13826 1102 Dtr system oriT relaxase; Provisional 92.15
KOG0739439 consensus 97.58
KOG0740428 consensus 97.39
PRK03839180 putative kinase; Provisional 97.22
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 97.0
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 96.64
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 96.63
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 96.63
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 96.63
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 96.61
KOG0743457 consensus 96.58
PRK11147 632 ABC transporter ATPase component; Reviewed 96.54
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 96.3
PRK08118167 topology modulation protein; Reviewed 96.29
PRK07261171 topology modulation protein; Provisional 96.25
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 96.24
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 96.12
COG3839 338 MalK ABC-type sugar transport systems, ATPase component 96.08
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 96.03
KOG0741 744 consensus 95.97
PRK00411 394 cdc6 cell division control protein 6; Reviewed 95.97
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 95.96
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 95.9
KOG2383 467 consensus 95.89
cd03234226 ABCG_White The White subfamily represents ABC transport 95.88
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 95.82
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.78
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 95.76
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 95.75
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 95.75
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 95.73
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 95.68
PRK09270230 frcK putative fructose transport system kinase; Reviewe 95.65
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 95.63
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 95.63
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.63
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 95.61
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 95.6
PRK11144 352 modC molybdate transporter ATP-binding protein; Provisi 95.59
pfam00406186 ADK Adenylate kinase. 95.58
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 95.58
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 95.57
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 95.56
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 95.52
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 95.5
PRK05057172 aroK shikimate kinase I; Reviewed 95.49
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 95.48
COG3842 352 PotA ABC-type spermidine/putrescine transport systems, 95.47
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.47
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 95.46
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 95.46
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 95.45
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 95.45
PRK00131175 aroK shikimate kinase; Reviewed 95.41
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.4
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 95.4
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 95.4
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 95.39
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 95.39
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 95.38
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.38
TIGR01187 331 potA polyamine ABC transporter, ATP-binding protein; In 95.37
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 95.37
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 95.37
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 95.37
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.36
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 95.35
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.33
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 95.33
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 95.32
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 95.31
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 95.3
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.28
PTZ00088225 adenylate kinase 1; Provisional 95.28
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 95.27
PRK00279215 adk adenylate kinase; Reviewed 95.23
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 95.22
PRK13947171 shikimate kinase; Provisional 95.22
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 95.22
PRK02496185 adk adenylate kinase; Provisional 95.19
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 95.19
TIGR00750 333 lao LAO/AO transport system ATPase; InterPro: IPR005129 95.19
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 95.18
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 95.18
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 95.18
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 95.17
PRK13544208 consensus 95.15
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.14
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.14
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 95.14
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 95.14
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 95.12
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.1
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 95.08
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 95.08
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 95.08
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 95.05
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 95.05
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 95.05
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 95.02
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.99
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 94.98
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.98
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.98
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 94.96
PRK10908222 cell division protein FtsE; Provisional 94.96
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 94.95
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 94.94
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 94.93
COG1123539 ATPase components of various ABC-type transport systems 94.92
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.91
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 94.91
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 94.9
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 94.89
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 94.89
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 94.88
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 94.87
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.85
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 94.82
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 94.81
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 94.8
KOG3347176 consensus 94.79
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 94.79
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 94.79
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 94.77
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 94.75
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 94.74
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.74
PRK09984262 phosphonate/organophosphate ester transporter subunit; 94.74
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 94.73
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.73
PRK13542224 consensus 94.73
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.71
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 94.71
PRK13946195 shikimate kinase; Provisional 94.71
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.7
PRK13949169 shikimate kinase; Provisional 94.69
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.69
PRK03731172 aroL shikimate kinase II; Reviewed 94.66
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 94.66
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.63
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 94.62
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 94.61
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 94.6
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 94.6
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 94.55
COG1134249 TagH ABC-type polysaccharide/polyol phosphate transport 94.54
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 94.52
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 94.52
PRK13948182 shikimate kinase; Provisional 94.51
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 94.48
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 94.44
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 94.42
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 94.4
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, ATPa 94.36
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 94.34
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 94.33
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 94.31
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.3
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 94.29
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 94.29
COG1117253 PstB ABC-type phosphate transport system, ATPase compon 94.27
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 94.24
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 94.23
PRK03695245 vitamin B12-transporter ATPase; Provisional 94.22
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 94.21
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 94.2
PRK09536 409 btuD corrinoid ABC transporter ATPase; Reviewed 94.19
PRK00625173 shikimate kinase; Provisional 94.17
PRK13768253 GTPase; Provisional 94.17
COG4619223 ABC-type uncharacterized transport system, ATPase compo 94.16
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 94.07
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 94.06
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 94.05
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 94.05
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 94.02
PRK10762 501 D-ribose transporter ATP binding protein; Provisional 93.99
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 93.98
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 93.94
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 93.94
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 93.92
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 93.92
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 93.89
PRK13764 605 ATPase; Provisional 93.89
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 93.84
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 93.83
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 93.8
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 93.8
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 93.79
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 93.73
PRK10982 491 galactose/methyl galaxtoside transporter ATP-binding pr 93.73
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 93.71
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 93.7
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 93.68
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 93.66
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 93.65
PRK06696227 uridine kinase; Validated 93.58
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 93.53
PRK05541176 adenylylsulfate kinase; Provisional 93.47
PRK11022 327 dppD dipeptide transporter ATP-binding subunit; Provisi 93.46
PRK10744257 phosphate transporter subunit; Provisional 93.46
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 93.46
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 93.45
COG4138248 BtuD ABC-type cobalamin transport system, ATPase compon 93.44
COG4618580 ArpD ABC-type protease/lipase transport system, ATPase 93.41
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 93.4
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 93.4
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 93.39
cd01896233 DRG The developmentally regulated GTP-binding protein ( 93.34
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 93.32
PRK11153 343 metN DL-methionine transporter ATP-binding subunit; Pro 93.3
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 93.3
PRK13409 590 putative ATPase RIL; Provisional 93.29
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 93.28
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 93.27
pfam06068 395 TIP49 TIP49 C-terminus. This family consists of the C-t 93.24
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 93.23
cd01124187 KaiC KaiC is a circadian clock protein primarily found 93.14
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 93.14
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 93.14
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 93.12
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 93.11
PRK13536306 nodulation factor exporter subunit NodI; Provisional 93.1
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 93.07
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Me 93.04
PTZ00243 1560 ABC transporter; Provisional 93.03
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 93.02
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 93.01
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate synthase 93.0
KOG0730 693 consensus 93.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 92.92
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 92.92
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 92.9
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 92.89
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 92.88
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 92.87
COG1127263 Ttg2A ABC-type transport system involved in resistance 92.85
COG1855 604 ATPase (PilT family) [General function prediction only] 92.85
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 92.62
PRK09435325 arginine/ornithine transport system ATPase; Provisional 92.55
PRK10522547 multidrug transporter membrane component/ATP-binding co 92.54
COG0645170 Predicted kinase [General function prediction only] 92.51
PRK11288 501 araG L-arabinose transporter ATP-binding protein; Provi 92.5
cd03114148 ArgK-like The function of this protein family is unkown 92.48
COG4608268 AppF ABC-type oligopeptide transport system, ATPase com 92.45
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 92.43
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 92.41
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 92.38
PRK13549513 xylose transporter ATP-binding subunit; Provisional 92.29
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 92.25
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 92.24
COG4525259 TauB ABC-type taurine transport system, ATPase componen 92.13
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 92.13
KOG3595 1395 consensus 96.38
>TIGR00368 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 This family of bacterial proteins are variously described as 'hypothetical protein yifB', 'competence protein', 'hypothetical protein' or 'Mg chelatase-related protein' Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>pfam01078 Mg_chelatase Magnesium chelatase, subunit ChlI Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR012804 Cobalamin (vitamin B12) can be complexed with metal via ATP-dependent reactions (aerobic pathway) (e Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I; InterPro: IPR011775 This entry represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>pfam00493 MCM MCM2/3/5 family Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0480 consensus Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>KOG0478 consensus Back     alignment and domain information
>KOG0482 consensus Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB; InterPro: IPR014251 This entry represents LonB, a paralog of the ATP-dependent protease La (LonA, IPR004815 from INTERPRO) Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D; InterPro: IPR011776 This entry represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX Back     alignment and domain information
>KOG0477 consensus Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252 This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria Back     alignment and domain information
>KOG0479 consensus Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>KOG0481 consensus Back     alignment and domain information
>pfam07728 AAA_5 AAA domain (dynein-related subfamily) Back     alignment and domain information
>pfam07726 AAA_3 ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>pfam07724 AAA_2 AAA domain (Cdc48 subfamily) Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K; InterPro: IPR014232 Proteins in this entry include the stage V sporulation protein K (SpoVK), a close homologue of the Rubisco expression protein CbbX (IPR000470 from INTERPRO), and are members of an ATPase family associated with various cellular activities Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF; InterPro: IPR014317 Members of this protein are PspF, the sigma-54-dependent transcriptional activator of the phage shock protein (psp) operon, found in Escherichia coli and numerous other species Back     alignment and domain information
>pfam00004 AAA ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR013462 The GvpN protein is associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy , Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information