254781027

254781027

hypothetical protein CLIBASIA_04645

GeneID in NCBI database:8210050Locus tag:CLIBASIA_04645
Protein GI in NCBI database:254781027Protein Accession:YP_003065440.1
Gene range:-(1027698, 1028024)Protein Length:108aa
Gene description:hypothetical protein
COG prediction:[O] Predicted ATPase with chaperone activity
KEGG prediction:hypothetical protein
SEED prediction:MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MASIQAISTESFSHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRIVAPSTLLELINHLNNKQLLPQPCKSTYKKRDNLPNFAEIKGQKTIKRAL
ccccccccHHHHccEEEEEEEccccHHHHHHHHHHcccEEEEcHHHHHHHHHHHcccEEEEcccHHHHHHHHccccccccccccccccccccccHHHHccHHHHHHcc
ccccccccHHHHHHHEHHHHHcccccHHHHHHHHHccccEEEccccHHHHHHccccccEccHHHHHHHHHHHccccccccccccccccccccccHHHHHcHHHHHHHc
MASIQAISTESFSHYLAVGeinldgslpaaicaknmnkdficpqscgseaawasdslrivAPSTLLELINHLnnkqllpqpckstykkrdnlpnfaeikgQKTIKRAL
MASIQAISTESFSHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRIVAPSTLLELINHLnnkqllpqpckstykkrdnlpnfaeikgqktikral
MASIQAISTESFSHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRIVAPSTLLELINHLNNKQLLPQPCKSTYKKRDNLPNFAEIKGQKTIKRAL
MASIQAISTESFSHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRIVAPSTLLELINHLNNKQLLP*********RDNLPNFAEIKGQKTIKRAL
MASIQAISTESFSHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRIVAPSTLLELINHLNNKQLLPQPCKSTYKKRDNLPNFAEIKGQKTIKRAL
****QAISTESFSHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRIVAPSTLLELINHLNNKQLLP***********NLPNFAEIKGQKTI*R**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASIQAISTESFSHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRIVAPSTLLELINHLNNKQLLPQPCKSTYKKRDNLPNFAEIKGQKTIKRAL
MASIQAISTESFSHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRIVAPSTLLELINHLNNKQLLPQPCKSTYKKRDNLPNFAEIKGQKTIKRAL
MASIQAISTESFSHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRIVAPSTLLELINHLNNKQLLPQPCKSTYKKRDNLPNFAEIKGQKTIKRAL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target108 hypothetical protein CLIBASIA_04645 [Candidatus Liberib
315122602 422 hypothetical protein CKC_04270 [Candidatus Liberibacter 1 9e-40
261314832 288 Mg chelatase [Brucella pinnipedialis M163/99/10] Length 1 3e-20
307943372 508 putative Mg chelatase family protein [Roseibium sp. Tri 1 5e-20
256158633 315 Mg chelatase-related protein [Brucella ceti M490/95/1] 1 5e-20
159184251 510 hypothetical protein Atu0311 [Agrobacterium tumefaciens 1 2e-19
121602697 510 Mg chelatase-like protein [Bartonella bacilliformis KC5 1 2e-19
325291745 489 magnesium chelatase family protein [Agrobacterium sp. H 1 3e-19
306843552 521 Mg chelatase-related protein [Brucella sp. BO1] Length 1 4e-19
319407913 510 conserved hypothetical protein [Bartonella schoenbuchen 1 4e-19
323138791 512 Mg chelatase, subunit ChlI [Methylocystis sp. ATCC 4924 1 4e-19
>gi|315122602|ref|YP_004063091.1| hypothetical protein CKC_04270 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 422 Back     alignment and organism information
 Score =  166 bits (421), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 92/115 (80%), Gaps = 7/115 (6%)

Query: 1   MASIQAISTESFSHYLAVGEINLDGSL-------PAAICAKNMNKDFICPQSCGSEAAWA 53
           MASIQAI+ ES   YLAVGEINLDGSL       PAAICAKN+NKD ICP+ CGSEAAWA
Sbjct: 89  MASIQAINRESLCRYLAVGEINLDGSLAAINGALPAAICAKNLNKDLICPKVCGSEAAWA 148

Query: 54  SDSLRIVAPSTLLELINHLNNKQLLPQPCKSTYKKRDNLPNFAEIKGQKTIKRAL 108
           SDSL I+APS +LEL NHLNNKQ L +P KS YK R NL NF++IKGQKTIKRAL
Sbjct: 149 SDSLNIIAPSNILELTNHLNNKQQLSRPFKSEYKNRTNLANFSDIKGQKTIKRAL 203


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|261314832|ref|ZP_05954029.1| Mg chelatase [Brucella pinnipedialis M163/99/10] Length = 288 Back     alignment and organism information
>gi|307943372|ref|ZP_07658716.1| putative Mg chelatase family protein [Roseibium sp. TrichSKD4] Length = 508 Back     alignment and organism information
>gi|256158633|ref|ZP_05456520.1| Mg chelatase-related protein [Brucella ceti M490/95/1] Length = 315 Back     alignment and organism information
>gi|159184251|ref|NP_353342.2| hypothetical protein Atu0311 [Agrobacterium tumefaciens str. C58] Length = 510 Back     alignment and organism information
>gi|121602697|ref|YP_989592.1| Mg chelatase-like protein [Bartonella bacilliformis KC583] Length = 510 Back     alignment and organism information
>gi|325291745|ref|YP_004277609.1| magnesium chelatase family protein [Agrobacterium sp. H13-3] Length = 489 Back     alignment and organism information
>gi|306843552|ref|ZP_07476153.1| Mg chelatase-related protein [Brucella sp. BO1] Length = 521 Back     alignment and organism information
>gi|319407913|emb|CBI81567.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 510 Back     alignment and organism information
>gi|323138791|ref|ZP_08073855.1| Mg chelatase, subunit ChlI [Methylocystis sp. ATCC 49242] Length = 512 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target108 hypothetical protein CLIBASIA_04645 [Candidatus Liberib
TIGR00368 499 TIGR00368, TIGR00368, Mg chelatase-related protein 1e-06
COG0606 490 COG0606, COG0606, Predicted ATPase with chaperone activ 8e-17
>gnl|CDD|129465 TIGR00368, TIGR00368, Mg chelatase-related protein Back     alignment and domain information
>gnl|CDD|30951 COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 108 hypothetical protein CLIBASIA_04645 [Candidatus Liberib
PRK09862 506 putative ATP-dependent protease; Provisional 99.97
TIGR00368 505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 99.97
COG0606 490 Predicted ATPase with chaperone activity [Posttranslati 99.96
TIGR02902532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 98.51
PRK11823454 DNA repair protein RadA; Provisional 98.35
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 98.19
pfam05362205 Lon_C Lon protease (S16) C-terminal proteolytic domain. 98.18
TIGR00763941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 98.09
TIGR00416481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 97.76
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 97.64
TIGR02903616 spore_lon_C ATP-dependent protease, Lon family; InterPr 97.43
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Posttra 97.37
PRK13765637 ATP-dependent protease Lon; Provisional 97.34
KOG2004906 consensus 96.78
COG1067647 LonB Predicted ATP-dependent protease [Posttranslationa 96.52
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>TIGR00368 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 This family of bacterial proteins are variously described as 'hypothetical protein yifB', 'competence protein', 'hypothetical protein' or 'Mg chelatase-related protein' Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB; InterPro: IPR014251 This entry represents LonB, a paralog of the ATP-dependent protease La (LonA, IPR004815 from INTERPRO) Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam05362 Lon_C Lon protease (S16) C-terminal proteolytic domain Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA; InterPro: IPR004504 RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252 This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>KOG2004 consensus Back     alignment and domain information
>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target108 hypothetical protein CLIBASIA_04645 [Candidatus Liberib
1xhk_A187 Putative protease LA homolog; LON protease, ATP depende 99.19
2x36_A207 LON protease homolog, mitochondrial; hydrolase, catalyt 98.81
1rre_A200 ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydr 98.81
1z0w_A207 Putative protease LA homolog type; ATP-dependent protea 98.8
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-binding, 98.46
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-binding, 97.81
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta sheet 94.93
>1xhk_A Putative protease LA homolog; LON protease, ATP dependent, catalytic DYAD, hydrolase; HET: MES; 1.90A {Methanocaldococcus jannaschii} SCOP: d.14.1.10 Back     alignment and structure
Probab=99.19  E-value=2.6e-11  Score=76.69  Aligned_cols=68  Identities=19%  Similarity=0.305  Sum_probs=57.9

Q ss_pred             CCCCCHHHHCCEEEEEEECCCCCH-------HHHHHHHHCC-CEEEEEHHHHHHHHHHCCCCEEEECCCHHHHHHHHCC
Q ss_conf             458885773566899850357753-------7999872039-8699836550455631288107510749999999709
Q gi|254781027|r    4 IQAISTESFSHYLAVGEINLDGSL-------PAAICAKNMN-KDFICPQSCGSEAAWASDSLRIVAPSTLLELINHLNN   74 (108)
Q Consensus         4 sgqi~~~~l~~~~~iGELsLdG~L-------p~al~a~~~~-~~~iiP~~N~~Ea~lv~~~~~v~~~~~L~evv~~l~g   74 (108)
                      ..++|.  -.++.|.|||+|||++       +.+.+|++.| +++|+|.+|..|+..+ ++++|++++||.|+++++.+
T Consensus       110 ~~~~~i--~~~~~~tGEl~L~G~V~~V~Gi~~ki~~A~~~G~~~viiP~~N~~e~~~~-~~i~i~~v~~l~eai~~l~~  185 (187)
T 1xhk_A          110 LLDIPL--KQDFAITGSLDLSGNVLAIGGVNEKIEAAKRYGFKRVIIPEANMIDVIET-EGIEIIPVKTLDEIVPLVFD  185 (187)
T ss_dssp             HHTCCB--CSSEEECCEECTTCBEECCSCHHHHHHHHHHTTCSEEEEEGGGGGGCCCC-CSSEEEEESBHHHHHHHHBC
T ss_pred             HCCCCC--CCCEEEEEECCCCCEEEEECCHHHHHHHHHHCCCCEEEECHHHHHHCCCC-CCCEEEEECCHHHHHHHHHC
T ss_conf             649986--54179997025895688438999999999986999999887786551646-99599992829999999765



>2x36_A LON protease homolog, mitochondrial; hydrolase, catalytic DYAD, transit peptide; 2.00A {Homo sapiens} PDB: 2x36_C Back     alignment and structure
>1rre_A ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydrolase; HET: MSE; 1.75A {Escherichia coli} SCOP: d.14.1.10 PDB: 1rr9_A* Back     alignment and structure
>1z0w_A Putative protease LA homolog type; ATP-dependent protease, catalytic Ser-Lys DYAD, B-type LON, hydrolase; 1.20A {Archaeoglobus fulgidus} PDB: 1z0b_A 1z0c_A 1z0e_A 1z0g_A 1z0t_A 1z0v_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, cytoplasm, hydrolase, nucleotide-B protease, serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target108 hypothetical protein CLIBASIA_04645 [Candidatus Liberib
d1xhka_185 ATP-dependent protease Lon (La), catalytic domain {Meth 99.24
d1rrea_182 ATP-dependent protease Lon (La), catalytic domain {Esch 99.0
>d1xhka_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: ATP-dependent protease Lon (La), catalytic domain
domain: ATP-dependent protease Lon (La), catalytic domain
species: Methanococcus jannaschii [TaxId: 2190]
Probab=99.24  E-value=7e-12  Score=78.38  Aligned_cols=68  Identities=19%  Similarity=0.305  Sum_probs=57.7

Q ss_pred             CCCCCHHHHCCEEEEEEECCCCCH-------HHHHHHHHCC-CEEEEEHHHHHHHHHHCCCCEEEECCCHHHHHHHHCC
Q ss_conf             458885773566899850357753-------7999872039-8699836550455631288107510749999999709
Q gi|254781027|r    4 IQAISTESFSHYLAVGEINLDGSL-------PAAICAKNMN-KDFICPQSCGSEAAWASDSLRIVAPSTLLELINHLNN   74 (108)
Q Consensus         4 sgqi~~~~l~~~~~iGELsLdG~L-------p~al~a~~~~-~~~iiP~~N~~Ea~lv~~~~~v~~~~~L~evv~~l~g   74 (108)
                      ...+|.  -+++.|+|||+|||++       +.+.+|++.| +++|+|.+|..|+..+ ++++|++++||.|+++++.+
T Consensus       108 ~~~~~i--~~~~~~~GEl~L~G~VrpV~gi~~ki~~A~~~G~~~viiP~~n~~e~~~~-~~i~i~~v~~l~eai~~l~~  183 (185)
T d1xhka_         108 LLDIPL--KQDFAITGSLDLSGNVLAIGGVNEKIEAAKRYGFKRVIIPEANMIDVIET-EGIEIIPVKTLDEIVPLVFD  183 (185)
T ss_dssp             HHTCCB--CSSEEECCEECTTCBEECCSCHHHHHHHHHHTTCSEEEEEGGGGGGCCCC-CSSEEEEESBHHHHHHHHBC
T ss_pred             HHCCCC--CCEEEEEECCCCCHHHHHCCCHHHHHHHHHHCCCCEEEECHHHHHHCCCC-CCCEEEEECCHHHHHHHHHC
T ss_conf             708986--32078871245533455215789999999983998999877776540656-99699991839999999866



>d1rrea_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 108 hypothetical protein CLIBASIA_04645 [Candidatus Li
1z0w_A_207 (A:) Putative protease LA homolog type; ATP-depend 3e-10
1xhk_A_187 (A:) Putative protease LA homolog; LON protease, A 8e-06
>1z0w_A (A:) Putative protease LA homolog type; ATP-dependent protease, catalytic Ser-Lys DYAD, B-type LON, hydrolase; 1.20A {Archaeoglobus fulgidus} PDB: 1z0b_A 1z0c_A 1z0e_A 1z0g_A 1z0t_A 1z0v_ALength = 207 Back     alignment and structure
 Score = 58.6 bits (141), Expect = 3e-10
 Identities = 11/101 (10%), Positives = 28/101 (27%), Gaps = 20/101 (19%)

Query: 13  SHYLAVGEINLDGS-------LPAAICAKNM-NKDFICPQSCGSEAAWASD---SLRIVA 61
                 G +++ G              A     K  I P+    +    ++    + ++ 
Sbjct: 115 QSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIP 174

Query: 62  PSTLLELINHLNNKQLLPQPCKSTYKKRDNLPNFAEIKGQK 102
            S + E++ H+                   +  F E++   
Sbjct: 175 VSRINEVLEHVLEDGKKKNR---------LMSKFKELELAA 206


>1xhk_A (A:) Putative protease LA homolog; LON protease, ATP dependent, catalytic DYAD, hydrolase; HET: MES; 1.90A {Methanocaldococcus jannaschii}Length = 187 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target108 hypothetical protein CLIBASIA_04645 [Candidatus Liberib
1z0w_A_207 Putative protease LA homolog type; ATP-dependent p 99.29
1rre_A_200 ATP-dependent protease LA; catalytic Ser-Lys DYAD, 99.1
1xhk_A_187 Putative protease LA homolog; LON protease, ATP de 99.04
>1z0w_A (A:) Putative protease LA homolog type; ATP-dependent protease, catalytic Ser-Lys DYAD, B-type LON, hydrolase; 1.20A {Archaeoglobus fulgidus} PDB: 1z0b_A 1z0c_A 1z0e_A 1z0g_A 1z0t_A 1z0v_A Back     alignment and structure
Probab=99.29  E-value=1.9e-12  Score=83.24  Aligned_cols=82  Identities=13%  Similarity=0.212  Sum_probs=68.2

Q ss_pred             HCCEEEEEEECCCCCH-------HHHHHHHHCC-CEEEEEHHHHHHHHHH---CCCCEEEECCCHHHHHHHHCCCCCCCC
Q ss_conf             3566899850357753-------7999872039-8699836550455631---288107510749999999709864676
Q gi|254781027|r   12 FSHYLAVGEINLDGSL-------PAAICAKNMN-KDFICPQSCGSEAAWA---SDSLRIVAPSTLLELINHLNNKQLLPQ   80 (108)
Q Consensus        12 l~~~~~iGELsLdG~L-------p~al~a~~~~-~~~iiP~~N~~Ea~lv---~~~~~v~~~~~L~evv~~l~g~~~~~~   80 (108)
                      -.++.|.|||+|||++       +.+.+|++.| +.+|||.+|..|+.+.   .+++++++++||.|+++++.+....++
T Consensus       114 ~~~~~~tGel~l~G~V~~V~gi~~ki~aA~~~G~k~vivP~~n~~~~~l~~~~~~gi~i~~v~~l~ea~~~~~~~~~~~~  193 (207)
T 1z0w_A          114 DQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKN  193 (207)
T ss_dssp             ETTEEECCEECTTSBEECCSCHHHHHHHHHHTTCSEEEEEGGGGGGCCCCTTTTTSSEEEEESBHHHHHHHHBCCSHHHH
T ss_pred             CHHEEEHHHHCCCHHHCCHHHHHHHHHHHHHCCCCEEECCCCCHHHCCCCCCCCCCEEEEEECCHHHHHHHHHCCCCCCH
T ss_conf             00111012316513322001088999999976983797166665533546011698499996959999999812675311


Q ss_pred             CCCCCCCCCCCCCCHHHHCCHH
Q ss_conf             7754446765699876715846
Q gi|254781027|r   81 PCKSTYKKRDNLPNFAEIKGQK  102 (108)
Q Consensus        81 ~~~~~~~~~~~~~Df~dV~GQ~  102 (108)
                      .         ...||.||+||.
T Consensus       194 ~---------~~~~~~~~~~q~  206 (207)
T 1z0w_A          194 R---------LMSKFKELELAA  206 (207)
T ss_dssp             H---------HHHHHHHHHHHH
T ss_pred             H---------HHHHHHHCCCCC
T ss_conf             5---------677665233246



>1rre_A (A:) ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydrolase; HET: MSE; 1.75A {Escherichia coli} Back     alignment and structure
>1xhk_A (A:) Putative protease LA homolog; LON protease, ATP dependent, catalytic DYAD, hydrolase; HET: MES; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure