254781029

254781029

chemotaxis sensory transducer

GeneID in NCBI database:8210052Locus tag:CLIBASIA_04655
Protein GI in NCBI database:254781029Protein Accession:YP_003065442.1
Gene range:-(1028795, 1034281)Protein Length:1828aa
Gene description:chemotaxis sensory transducer
COG prediction:none
KEGG prediction:chemotaxis sensory transducer
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------183
MSNKKENKATYRDSLKEFEEQSTSDSHENKKRHHSRKKHKYSRRDDSIESKDRQQTTLSKNFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNISQVDKRPSGKKTKNNHAIKEWFNKILSSSTHSKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGRTL
ccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccc
ccccccccccHHHHHHHHHHHHHcccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccccHHHcccccccccccccHHHHHccHHHHHHHHHcHHHcccccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHcccccHEHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHccccc
msnkkenkaTYRDSLKEfeeqstsdshenkkrhhsrkkhkysrrddsieskdrQQTTLSKNfkqasnkqtysgfypandldnggiTHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIkfytnspmdsfydfamrPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRlidpeeyssekMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLEnnytksemRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEdsfcsnlksttdntlreVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQgcfadshgnmeDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFeetiaghpqsIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSfndtfnnksdhvsgiLKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNlagsenkidgaigSASQFIRDILDENSSRIESLLScsnnsvnstlLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSmsqsttdisgkleISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDvdhtisshtnESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITnritdssqdVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIkidgtlsnietrsrdTVRLIDHNLadignktvktiDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQklsktsddiALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAasynkglhsdeynisqvdkrpsgkktknnHAIKEWFNKILSssthskgkssshidisdkdslSSIDSLVENISKFIDYDAFVQLWKSytlgeddifskRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIaqsnddsplvQEHIMSNYGKVYTMLVHASGRTL
msnkkenkatyrdslkefeeqstsdshenkkrhhsrkkhkysrrddsieskdrqqttlsknfkqasnkqTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAisraselektvrseievlennytksemriDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSraidsfqsiVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLqekedsfcsnlksttdntlrevdnrtnTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSkkqnnisqitsmnterlenTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEetiaghpqsiVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNlagsenkidgaigsASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQqllqnndvitnqiidstsrvrgeivdiSNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKItnritdssqdvttIISDatdslnkvdERLHQttnritettghidtVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETklsldkdanNLVDLTSRlvsksseaqKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQssfikidgtlsnietrsrdTVRLIDhnladignktvktidsnfvtLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSftqklsktsddialtsrriaedlnnsrdilkrdsvslakeakesaDTIRSAIEEQINTLKDFQKLITDSVKNNAAsynkglhsdeynisqvdkrpsgkktknnHAIKEWFNKILSssthskgkssshidisdkdsLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGRTL
MSNKKENKATYRDSLKEFEEQSTSDshenkkrhhsrkkhkysrrddsIESKDRQQTTLSKNFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPillffsffimisRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHeslkeelsltseeISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIEsllscsnnsvnstllRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYnaanalkkleallISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNISQVDKRPSGKKTKNNHAIKEWFNKILsssthskgkssshidisdkdslssidsLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGRTL
***************************************************************************************************ALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISR*********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************DAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEML***************HIMSNYGKVYTMLVHASGRT*
***********RDSL****************************************TTLSKNFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLK***********TSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVS**********TIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNISQV*********KNNHAIKEWFNKILS****************DKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGRTL
*******KATYRDSLKEFEEQSTSD****************************************************NDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS************************************************T*******************SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHAS****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxSTSDSHENKKRHHSRKKHKYSRRDDSIESKDRQQTTLSKNFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLxxxxxxxxxxxxxxxxxxxxxIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFxxxxxxxxxxxxxxxxxxxxxIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNISQVDKRPSGKKTKNNHAIKEWFNKILSSSTHSKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGRTL
MSNKKENKATYRDSLKEFEEQSTSDSHENKKRHHSRKKHKYSRRDDSIESKDRQQTTLSKNFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNISQVDKRPSGKKTKNNHAIKEWFNKILSSSTHSKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGRTL
MSNKKENKATYRDSLKEFEEQSTSDSHENKKRHHSRKKHKYSRRDDSIESKDRQQTTLSKNFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNISQVDKRPSGKKTKNNHAIKEWFNKILSSSTHSKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGRTL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target1828 chemotaxis sensory transducer [Candidatus Liberibacter
3151226011670 chemotaxis sensory transducer [Candidatus Liberibacter 1 0.0
1503967482052 chemotaxis sensory transducer [Sinorhizobium medicae WS 1 1e-151
2278222152109 kinesin-like protein [Sinorhizobium fredii NGR234] Leng 1 1e-149
222086181 2225 hypothetical protein Arad_2643 [Agrobacterium radiobact 1 1e-112
2220861812225 hypothetical protein Arad_2643 [Agrobacterium radiobact 1 1e-72
2220861812225 hypothetical protein Arad_2643 [Agrobacterium radiobact 1 2e-25
3073026892089 conserved hypothetical protein [Sinorhizobium meliloti 1 1e-110
3073026892089 conserved hypothetical protein [Sinorhizobium meliloti 1 1e-25
159655692089 hypothetical protein SMc00190 [Sinorhizobium meliloti 1 1 1e-109
159655692089 hypothetical protein SMc00190 [Sinorhizobium meliloti 1 1 1e-25
>gi|315122601|ref|YP_004063090.1| chemotaxis sensory transducer [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 1670 Back     alignment and organism information
 Score = 2197 bits (5692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1117/1673 (66%), Positives = 1417/1673 (84%), Gaps = 8/1673 (0%)

Query: 161  MISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASE 220
            MISRARDMHDASQSIA IALRL+DPEEYSSEK+ SISSAVR+EI+ +TEEI+RA+SRAS+
Sbjct: 1    MISRARDMHDASQSIAKIALRLVDPEEYSSEKILSISSAVRREIMTITEEIERAVSRASD 60

Query: 221  LEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELS 280
            LEK VRSEI+VLE+NY K+E+R  NIT  L++EREAI++HG QL TSIAEVHE+LKEELS
Sbjct: 61   LEKIVRSEIDVLEDNYNKNEVRAHNITHKLREEREAIVDHGMQLRTSIAEVHEALKEELS 120

Query: 281  LTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIV 340
            LTSEEIS+HLSRA DSFQSIVD+RIAK+T+KT R+VQESA+TISSKIDQLLEVL S+S++
Sbjct: 121  LTSEEISIHLSRATDSFQSIVDMRIAKLTDKTNRVVQESAETISSKIDQLLEVLDSSSMI 180

Query: 341  ITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHI 400
            IT+DFDNRIE+LSN L+NSGRSLAN +  +  MLGNNTDK+S+ LKEQS QF ++FTSHI
Sbjct: 181  ITEDFDNRIETLSNALDNSGRSLANHLSIHASMLGNNTDKISLTLKEQSHQFTESFTSHI 240

Query: 401  CEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLEN 460
            CEMS FFSEKQ SIT TLND++Q+LR+S QEKE+ F +NL+STTDNTL EVDNRT+ +EN
Sbjct: 241  CEMSKFFSEKQSSITSTLNDMIQNLRVSFQEKEELFRNNLQSTTDNTLSEVDNRTSIIEN 300

Query: 461  RITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSN 520
             I  FL +  ETFN  I +F  F++ N +EFE+ L+ NI+KL GCF +SH NMEDLF+SN
Sbjct: 301  TINKFLTDTAETFNKRIAEFGHFFERNFNEFETTLKDNINKLNGCFENSHTNMEDLFISN 360

Query: 521  IQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRID 580
            I+TI SNLDKKTL+ E  LS KQNNI+ +T  N E+LEN LTNSI++LK +L+E+RQ+ID
Sbjct: 361  IKTIDSNLDKKTLILEGTLSTKQNNITHLTEANAEKLENILTNSIDNLKGVLDERRQKID 420

Query: 581  SDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISN 640
            +D+GKKSEELC+SF+SSYQKVSNVIS+REK FSNSL R Q  FEE +AG PQSI+DSISN
Sbjct: 421  TDLGKKSEELCTSFDSSYQKVSNVISEREKSFSNSLIRAQLQFEEALAGRPQSIIDSISN 480

Query: 641  S----TNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNI 696
            +    T+ +YDK MVLAAALSE+QKSLDNSLK HA+DVV+KIT AE+QLVNRF ESS+ I
Sbjct: 481  NIKKLTDTIYDKTMVLAAALSENQKSLDNSLKKHASDVVNKITIAESQLVNRFTESSEQI 540

Query: 697  ICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLH 756
            + SY+++NNKLE I ++HL S  DTF+NKS HV+ +L++S ++I  + S N KRMEE+L 
Sbjct: 541  VFSYSNNNNKLEKILKQHLASLTDTFSNKSSHVNNMLESSAENIKSMLSTNTKRMEEVLS 600

Query: 757  SGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELL 816
            +GS NI  ELS +S  ++ SIDDV+ IST L++RCQ LG+DL+++++K+L SL++AQELL
Sbjct: 601  NGSENIGLELSTVSNTISHSIDDVKAISTELEQRCQGLGNDLISNANKILFSLEEAQELL 660

Query: 817  CTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLT 876
              TFA+RN++FV+ L++NQSKFE+NLV++S L++  LS DI+ +T+IAY+KA+D+ANSLT
Sbjct: 661  NNTFAKRNENFVDTLSENQSKFEHNLVSKSQLIIGSLSQDIKNMTEIAYAKAMDMANSLT 720

Query: 877  EIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDV 936
            +IQGN+GVTL+NHSQ +L+KIS ++T VA+ F+E M +I L+Y++N Q LDKKLSDHI++
Sbjct: 721  KIQGNIGVTLDNHSQIILKKISDADTNVAQAFKERMDSICLAYNDNHQILDKKLSDHINI 780

Query: 937  LRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLL 996
            L+  LAG+E+K+DG+I SASQFI+ ILDENS+RIE+LL+  N+SVNSTLL SHQKFDRLL
Sbjct: 781  LQDVLAGNESKMDGSIESASQFIKKILDENSARIEALLNYGNDSVNSTLLCSHQKFDRLL 840

Query: 997  QEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQT 1056
            +EKSDELIQ+LDN AS LSTAVS +TINL+NNLKE+E SLS+ V+ S+SSFK LS++I  
Sbjct: 841  KEKSDELIQVLDNSASSLSTAVSKETINLQNNLKEREVSLSQTVNDSSSSFKDLSENIND 900

Query: 1057 LAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISE 1116
            L Q+LVSV+G+MSQST D+SG+LE S+DSVN+K+QKCREFFG+ I  FM+EISK+ME+SE
Sbjct: 901  LTQKLVSVVGNMSQSTIDVSGQLEASMDSVNEKVQKCREFFGEKIAIFMNEISKIMEVSE 960

Query: 1117 KRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSA 1176
            +RISQRTQEISQQLLQNNDV+T+QIID+TSR+ GEI +I+ KF+ET ++LE++E KF S 
Sbjct: 961  QRISQRTQEISQQLLQNNDVVTDQIIDNTSRISGEIDNITKKFVETGQLLEEKEGKFRST 1020

Query: 1177 LDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFK 1236
            L+ F++N+S +  +VD  + SHTNE+RS+IE+RI EVK+++SN+D AL  + ST+  +FK
Sbjct: 1021 LNHFNNNLSEVFHEVDQVVLSHTNEARSVIEKRISEVKEIVSNVDNALNVHESTMLNKFK 1080

Query: 1237 EYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNA 1296
            EYV+ FE+NME  +SL DKNN+SM LSF ERS ILD++LSQRS+EIS+SIS AFHKEG+A
Sbjct: 1081 EYVKSFESNMEEWKSLLDKNNNSMQLSFDERSTILDSLLSQRSVEISNSISDAFHKEGDA 1140

Query: 1297 VVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLH 1356
            V N+ID+QIY+AANALKKLE LLI+DVEKIT+RI+DSS DVTTI++ AT+SLNKVD+ L 
Sbjct: 1141 VANIIDKQIYDAANALKKLEELLINDVEKITHRISDSSLDVTTILNAATNSLNKVDKSLF 1200

Query: 1357 QTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSH 1416
            QTTNRI +TTG I TVL+ESSKLF+ KIKDL EIS+  L +MSEIV+KFDKNSQIL+KSH
Sbjct: 1201 QTTNRIIDTTGQISTVLSESSKLFDNKIKDLNEISKDVLFRMSEIVNKFDKNSQILLKSH 1260

Query: 1417 DSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTV 1476
            D L+K QSET L+LDK ANNL  LT++L+SKSSEAQKFV+S+LVD+KK+VEQ +FLSD V
Sbjct: 1261 DLLVKTQSETGLALDKGANNLASLTNKLISKSSEAQKFVISLLVDIKKVVEQTNFLSDKV 1320

Query: 1477 VKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSY 1536
            VK+MT  +Q+SF+ I+GTLSNIE RSRDT++LIDH+L +IGNKTVKTID +F  ++EKS 
Sbjct: 1321 VKSMTHGLQASFLDIEGTLSNIEMRSRDTIKLIDHDLTNIGNKTVKTIDKSFGEIEEKSR 1380

Query: 1537 DLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALT 1596
            +LSNH+ QKI S+IPN+EN FSTLE+KSDQSM+ FLDSLNNKV++FT+KLSKTS++I+LT
Sbjct: 1381 NLSNHIAQKIHSSIPNVENAFSTLEKKSDQSMKEFLDSLNNKVNTFTEKLSKTSEEISLT 1440

Query: 1597 SRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAA 1656
            S +I E+LN+SR++LKRDS+SLA+EAKESADTIR+AIEEQINTL+DFQKL+TDSV++N  
Sbjct: 1441 SHKITEELNDSRNVLKRDSISLAQEAKESADTIRNAIEEQINTLRDFQKLVTDSVQSNPT 1500

Query: 1657 SYNKGLHSDEYNISQVDKRPSGKKTKNNHAIKEWFNKILSSSTHSKGKSSSHIDISDKDS 1716
             Y+K L SD  N  Q+DK  S K+   N +IK+WFN I+ S+T +KGK SS     D + 
Sbjct: 1501 FYDKKLSSDNSNPPQLDKPESNKEITKNKSIKKWFNDIVHSATLNKGKISSS---KDGNL 1557

Query: 1717 LSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSA 1776
            L SIDSLV +IS+FID DAFV LWK YT GEDD+FS++LYT++GQK+F N+QE+Y  +  
Sbjct: 1558 LYSIDSLVSDISQFIDCDAFVDLWKRYTQGEDDLFSQQLYTLRGQKLFRNIQEKYVNNLE 1617

Query: 1777 LRNAIDRYISNFEEMLSEIAQSNDDSPLV-QEHIMSNYGKVYTMLVHASGRTL 1828
             R+ +D YI+NFEEMLSE   S+ DS  V QEHIMSNYGKVYTMLVHASGRTL
Sbjct: 1618 FRSDVDSYITNFEEMLSESVHSSSDSNSVTQEHIMSNYGKVYTMLVHASGRTL 1670


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396748|ref|YP_001327215.1| chemotaxis sensory transducer [Sinorhizobium medicae WSM419] Length = 2052 Back     alignment and organism information
>gi|227822215|ref|YP_002826186.1| kinesin-like protein [Sinorhizobium fredii NGR234] Length = 2109 Back     alignment and organism information
>gi|222086181|ref|YP_002544713.1| hypothetical protein Arad_2643 [Agrobacterium radiobacter K84] Length = 2225 Back     alignment and organism information
>gi|222086181|ref|YP_002544713.1| hypothetical protein Arad_2643 [Agrobacterium radiobacter K84] Length = 2225 Back     alignment and organism information
>gi|222086181|ref|YP_002544713.1| hypothetical protein Arad_2643 [Agrobacterium radiobacter K84] Length = 2225 Back     alignment and organism information
>gi|307302689|ref|ZP_07582445.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C] Length = 2089 Back     alignment and organism information
>gi|307302689|ref|ZP_07582445.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C] Length = 2089 Back     alignment and organism information
>gi|15965569|ref|NP_385922.1| hypothetical protein SMc00190 [Sinorhizobium meliloti 1021] Length = 2089 Back     alignment and organism information
>gi|15965569|ref|NP_385922.1| hypothetical protein SMc00190 [Sinorhizobium meliloti 1021] Length = 2089 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1828 chemotaxis sensory transducer [Candidatus Liberibacter
KOG02431041 KOG0243, KOG0243, KOG0243, Kinesin-like protein [Cytosk 2e-04
>gnl|CDD|35464 KOG0243, KOG0243, KOG0243, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 1828 chemotaxis sensory transducer [Candidatus Liberibacter
pfam01442191 Apolipoprotein Apolipoprotein A1/A4/E domain. These pro 97.96
KOG01611930 consensus 96.37
PRK10361475 DNA recombination protein RmuC; Provisional 95.68
pfam05656112 DUF805 Protein of unknown function (DUF805). This famil 95.41
COG3152125 Predicted membrane protein [Function unknown] 90.89
TIGR02121517 Na_Pro_sym sodium/proline symporter; InterPro: IPR01185 90.15
pfam04156186 IncA IncA protein. Chlamydia trachomatis is an obligate 93.43
KOG46741822 consensus 93.34
>pfam01442 Apolipoprotein Apolipoprotein A1/A4/E domain Back     alignment and domain information
>KOG0161 consensus Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>pfam05656 DUF805 Protein of unknown function (DUF805) Back     alignment and domain information
>COG3152 Predicted membrane protein [Function unknown] Back     alignment and domain information
>TIGR02121 Na_Pro_sym sodium/proline symporter; InterPro: IPR011851 This family consists of the sodium/proline symporter (proline permease) from a number of Gram-negative and Gram-positive bacteria and from the archaeal genus Methanosarcina Back     alignment and domain information
>pfam04156 IncA IncA protein Back     alignment and domain information
>KOG4674 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target1828 chemotaxis sensory transducer [Candidatus Liberibacter
1i84_S1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 4e-13
1i84_S1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 1e-05
1i84_S1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 6e-05
1i84_S1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 1e-04
>gi|13786876|pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
 Score = 84.8 bits (207), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 36/391 (9%), Positives = 121/391 (30%), Gaps = 12/391 (3%)

Query: 1271 LDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRI 1330
            +      R      + +    +  +      + + +        +             R 
Sbjct: 796  IAFQAQCRGYLARKAFAKRQQQLESIFCIQYNVRSFMNVXHWPWMXLFFXIXPLLKVTRQ 855

Query: 1331 TDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEI 1390
             +  Q     +    +   K +  L +   + T+       +L E  +   +   +  E+
Sbjct: 856  EEEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCEE-KNLLQEKLQAETELYAEAEEM 914

Query: 1391 SRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS- 1449
                  +  E+     +    + +  +   + Q+E K    +  +    L     ++   
Sbjct: 915  RVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQKL 974

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
            + +K      +   +         +  +      ++     +   L+  E ++++  +L 
Sbjct: 975  QLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLK 1034

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQ 1569
            + + + I    V+         +EKS      +++K+     ++    + L+ +  +   
Sbjct: 1035 NKHESMISELEVRLKK------EEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKA 1088

Query: 1570 VFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTI 1629
                    ++ +   +L   +       ++I  +L +    L+ D +   K A+  A+  
Sbjct: 1089 QLAKK-EEELQAALARLEDETSQKNNALKKIR-ELESHISDLQED-LESEKAARNKAEKQ 1145

Query: 1630 RSAIEEQINTLK-DFQKLITDSVKNNAASYN 1659
            +  + E++  LK + +  +  +        +
Sbjct: 1146 KRDLSEELEALKTELEDTLDTTATQQELRGS 1176


>gi|13786876|pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>gi|13786876|pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>gi|13786876|pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target1828 chemotaxis sensory transducer [Candidatus Liberibacter
2a01_A243 Apolipoprotein A-I; four-helix bundle, lipid transport; 97.43
1nfn_A191 Apolipoprotein E3; lipid transport, heparin-binding, pl 96.68
1gs9_A165 Apolipoprotein E, APOE4; lipid transport, heparin-bindi 94.5
>2a01_A Apolipoprotein A-I; four-helix bundle, lipid transport; HET: AC9; 2.40A {Homo sapiens} PDB: 3k2s_A* 1av1_A 1gw3_A 1gw4_A Back     alignment and structure
Probab=97.43  E-value=0.00078  Score=45.37  Aligned_cols=231  Identities=8%  Similarity=0.100  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999--99999999999999999999999999999999999999999999999999999
Q gi|254781029|r  323 ISSKIDQLLEVLHSTSIVITKDFDN--RIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHI  400 (1828)
Q Consensus       323 l~~~~~~l~~~L~~~~~~~~~~~~~--~~e~l~~~L~~~~~~l~~~~~~~~~~l~~~~e~l~~~l~e~~~~l~e~l~~~~  400 (1828)
                      +....+...+.+..........+..  ....+...|......+...+......+....+.+...+......+.+.+...+
T Consensus        11 ~~d~~~~~~~~~~~~~~~~~~~l~~s~~~~~l~~~l~e~~~~l~~~~~~l~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~   90 (243)
T 2a01_A           11 VKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDL   90 (243)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSCCSSSSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSCCS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999899999998874789999999999999999999999998789999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781029|r  401 CEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDF  480 (1828)
Q Consensus       401 ~e~~~~l~~~~~~l~~~l~~~~~~l~~~l~e~~~~~~~~l~~~~~~~~~~l~~~~~~l~~~l~~~~~~~~~~l~~~~~~~  480 (1828)
                      .++...+......+...+......+...+......+...+....+.+...+......+...+......+...+......+
T Consensus        91 ~~~~~~l~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~l~~~l~~~~~~l~~~~~~~~~~~~~~l~~~~~~~  170 (243)
T 2a01_A           91 EEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDEL  170 (243)
T ss_dssp             SCSSTTHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHCCSCCSSTHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999878899999999999999998999999999988668999999876789999999999999998889999998


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999999999999999844
Q gi|254781029|r  481 SSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMN  553 (1828)
Q Consensus       481 ~~~~~~~~~el~~~l~~~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~l~~~l~~~~~~l~~~~~~~  553 (1828)
                      ...+...+..+...+...+..+...+......+...+......+...+......+...+......+...+...
T Consensus       171 ~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~e~l~~~l~~~~e~l~~~l~~~~ee~~~~l~~q  243 (243)
T 2a01_A          171 RQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ  243 (243)
T ss_dssp             HHHHHHHHHHHHHHHHHTTTSSSCCHHHHHHHHHHHHHHHHHHSSSCSHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             7768999999998888889999999999999999999999999999879999999999999999999876578



>1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A Back     alignment and structure
>1gs9_A Apolipoprotein E, APOE4; lipid transport, heparin-binding, plasma, lipid binding protein; 1.7A {Homo sapiens} SCOP: a.24.1.1 PDB: 1or3_A 1or2_A 1le4_A 1bz4_A 1lpe_A 1le2_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target1828 chemotaxis sensory transducer [Candidatus Liberibacter
d1gs9a_144 Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606 94.95
>d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Four-helical up-and-down bundle
superfamily: Apolipoprotein
family: Apolipoprotein
domain: Apolipoprotein E
species: Human (Homo sapiens), E4 [TaxId: 9606]
Probab=94.95  E-value=0.081  Score=26.41  Aligned_cols=136  Identities=13%  Similarity=0.170  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781029|r  399 HICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSIT  478 (1828)
Q Consensus       399 ~~~e~~~~l~~~~~~l~~~l~~~~~~l~~~l~e~~~~~~~~l~~~~~~~~~~l~~~~~~l~~~l~~~~~~~~~~l~~~~~  478 (1828)
                      +..++.+.|......+....+.....+...      .+...+.....+....+......+..++.....++...+.....
T Consensus         4 ~~e~~~d~f~~y~~~l~~~a~~~~~~l~~s------el~~el~~~l~e~~~~l~~~~~~l~~~l~p~~~e~~~~l~~~~e   77 (144)
T d1gs9a_           4 RWELALGRFWDYLRWVQTLSEQVQEELLSS------QVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQ   77 (144)
T ss_dssp             HHHHHHHHHHHHHHHHHHCCHHHHHHHHSS------HHHHHHHHHHHHHHHHHHHHHHHHTTSCCCCCSHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             089999899999999987489999999867------99999889999999999999999999878779999988886599


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999
Q gi|254781029|r  479 DFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILS  540 (1828)
Q Consensus       479 ~~~~~~~~~~~el~~~l~~~~~~l~~~l~~~~~~l~~~~~~~~~~~~~~l~~~~~~l~~~l~  540 (1828)
                      .+...+...+.++..++......+...+......+...+....+.+...+......+...+.
T Consensus        78 ~lr~~l~~~lee~r~kl~~~~eel~~~~~~~~ee~r~~l~p~~eel~~~l~~~~eel~~kL~  139 (144)
T d1gs9a_          78 AAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLA  139 (144)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTSTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999987899999999988999999998999999998789999999999889999999860



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00